5HP8A

Crystal structures of rida in complex with pyruvate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
SQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPAPSPARSTYQVAALPLNAKIEIECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reactive Intermediate Deaminase A, chloroplastic
publication title Crystal structures of RidA, an important enzyme for the prevention of toxic side products
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 5hp8A00
2UYNA 1ONIA 1QD9A 1XHOA 1FNJA 2UYKA 2EWCA 3R0PA 3KJKA 1X25A 2UYNB 3GTZA 1DBFA 2B33A 3M1XA 3QUWA 3VCZA 3ZOPA 3ZP7A 2UYPA 2UYJA 3M4SA 5HP8A 3ZO8A 3K0TA 3L7QA 3LMEA 1QAHA 1XRGA 2CW4A 2OTMA 2CWJA 2IG8A 3KJJA 3ZP4A 4NWOB 3I3FA 1JD1A 1NQ3A 3D01A 2CVLA 1QU9A 1COMA 1ODEA 1UI9A 1UFYA 5HP7A 1J7HA 2CHSA 3MQWA 2DYYA 3V4DA 3LYBA 4ZK7A 3K12A 1PF5A 2CSLA 3I7TA 1FNKA 2CHTA
chains in the Genus database with same CATH superfamily
4ZI7A 5KX5A 2VXYA 3VCZA 3V7EA 2H8CA 4O2AA 2UYJA 3HWUA 3S0WA 3DDNA 3CB2A 4G4WA 3CD6F 3S0HA 2HP0A 3LWPC 3M84A 1QU9A 2RHLA 2VAMA 2LCAA 3C8LA 5JQGA 2Z1UA 1QVFF 1DT9A 5EAZA 5GONB 2RHJA 4U3JA 2HS4A 5A2QM 3ESJA 2F9ZC 2YYEA 1GO1A 4DXDA 4YJ2A 4C8IA 5IJ0A 1FFXA 3NK6A 3F6MA 2VAWA 3M1XA 3QUWA 3MCAB 3M4SA 5LXTA 5J2UA 2BO1A 3OBWA 1Q82H 2CW4A 3KJJA 4TV9B 3N2KB 4BT4A 3D54A 2YXZA 4O4LB 1JFFA 5LP6C 1KQSF 3P0ZA 5J2TA 4DRXA 3C9UA 4NUTA 2KG4A 2RHHA 3PLAC 3N4ZA 3E20B 3JVHA 5HY1A 3E22A 3HKEA 1VQKF 1T0KB 3ON1A 3DC2A 4ZOLB 4NQ3A 3VI6A 3ZOPA 2HP3A 2ZAUA 2ZVYA 4I4TA 4O2BA 3NK7A 2Z1TA 3QTYA 2LBWA 3L7QA 1VHAA 4BT7A 4O4HB 4BY9D 3J80M 2KTUA 3LWQC 4B46A 1U43A 2LBXA 3UT5B 2BTUA 4IIJA 1PF5A 3RYCA 3SIVA 4X1IB 1VQ8F 3I7TA 3HKCB 1W2BF 1Q7YH 5G4UC 1JN1A 4BT5A 3JASB 4WBNB 3LFOA 5JH7B 3J81M 2R751 3K0TA 3FFMA 4IHJB 2AIFA 2JNBA 3LWOC 5C8YA 4RHAA 4BVRA 1PXWA 5MN5A 4F6RA 1H47A 2Z01A 2HQSC 2Z1EA 4EB6A 1W55A 2PHNA 5LOVA 4TV8A 3VOAA 3IEQA 5FNVB 2VGMA 3CCEF 3JAMM 5KMGB 5LP6A 3CCSF 3CCQF 2GVIA 4I55B 5EB1B 3CMAF 4TZZA 2WALA 2PMPA 4M8IA 3WGNA 3CPWF 4BW0B 5CA0A 4C8EA 1YJNF 2MQEA 3CCJF 2DT4A 3N2GB 4O4JB 4O4IB 5EYPB 3C9SA 2CVLA 3HTNA 4HNAB 1RA4A 3CCLF 3TD3A 4YJ3A 1SZQA 1IV1A 3IKEA 4I50A 3ERNA 5CA1B 5BMVB 3V4DA 3D00A 3JAWA 1W57A 3JCMM 1YGYA 3F0DA 4ZHYB 5GIOC 4FFBB 3CCRF 1YI2F 3NVIB 2ZODA 3B6NA 5IYZA 1GX1A 1CN7A 3CC7F 2H6LA 3C9RA 1IV4A 4O2AB 5EB0A 5LYJB 2BTQB 4ZHVA 2HP0B 1TUBA 3KIZA 3NVKE 1CLIA 3FPIA 1H7MA 1Q81H 1U3LA 3EORA 1W41A 3CXCF 1Q8RA 1K8AH 4C4WC 1VQ9F 4ERHA 4YJ2B 5IJ0B 2UYPA 3KE1A 1M90H 2R6R1 3RYIA 5AVMA 1VH8A 3LDTA 5J2UB 5LXTB 1VQ6F 1QVGF 4BT3A 3TD4A 1JD1A 3NMUC 2ZF8A 1M1KH 3RE3A 3F0GA 1JFFB 4ZK7A 5IJ9A 3TD5A 3VOBA 5J2TB 2ZOVA 2ALEA 3HKDB 5GANK 2EWCA 2IQQA 2I6RA 3GTZA 1DBFA 5EO3A 3VO8A 5B8FA 5GAPK 4B45A 4TV9A 3G6EF 3N2KA 2QI2A 4C81A 3QHDA 4O2BB 1YJ9F 1E7KA 3CG6A 1X7OA 1RLUA 3VIUA 4TUYA 2K1SA 1W5BA 2HRYA 3JATB 5CB4A 1IPAA 1UI9A 2G9IA 3RA6A 3MBMA 1H48A 2DYYA 4G4VA 2N48A 3K12A 3K14A 3VMFB 4C82A 2UYNA 1FNJA 4G4YA 2CZWA 2IAFA 5MN6A 1SA0A 3RYFA 3I55F 2V9YA 5EZYB 4X1YA 1GZ0A 3E1YA 3UT5A 2GZLA 2KTVA 3G4SF 2OTJF 4X1KB 3WPXA 3CCVF 5GIPC 3J7AR 4F6RB 1VK3A 3V7QA 4EB6B 3P4EA 5JVDA 5G4VC 1W5AA 4EI8A 2FC3A 3RYHA 1VQ5F 4TV8B 1Q86H 3CPQA 4WBNA 5HY4A 3WGMA 2QTPA 4IHJA 2RHOA 3VTIC 5LP6B 4ZHQB 5ITZA 3JALA 4B5CA 3V3TA 4BVTA 3LMEA 1QAHA 1NMUB 3CYQA 3I3FA 1W5FA 1NQ3A 3HKBB 3VYUC 2VAPA 4EI7A 1RQ2A 4X3LA 4RQOA 2QA4F 4YJ3B 5LA6A 4X20A 3BYQA 4E6EA 3K2XA 1OAPA 4R40B 4BT6A 1TVKA 1QD9A 1RQ7A 3KJKA 4ZI7B 5HXUA 5EIBD 3U0OA 1IV3A 5HY0A 1U40A 3ZO8A 4O4IA 5IYZB 1YITF 5EYPA 5KX5B 1VQLF 1JY8A 2AIZP 4LNUA 1X7PA 1SDSA 3D01A 5CA1A 3JAKA 3JARA 1KD1H 1W581 3F0EA 2FGYA 1N8RH 1KNKA 5JQGB 1TUBB 1GO0A 2L26A 4FFBA 5HWEA 5FJ4C 3GHZA 3HJWC 4U3JB 2CSLA 2HVYD 3IEWA 2CHTA 4XCQA 1ONIA 2QEXF 1XHOA 2LBTA 2Q1YA 3VYSC 2UYKA 1VQNF 1OFUA 3ZP7A 1YJWF 3KHNA 3GYQA 5LYJA 1R1MA 3WGLA 2I6DA 1FFXB 2KGWA 3WGKA 3OBYA 1YHQF 3HAXD 3RYIB 3ZP4A 2AMTA 3T80A 4C8GA 1ZWZA 3ELCA 1T0AA 3OW2F 3FBAA 1ODEA 5GONA 4PWTA 2HX0A 4DRXB 5IJ9B 3WJPA 4G4XA 3E22B 3R0PA 2NMUA 5JCOC 3HKEB 1IV2A 3IR9A 3S02A 4BVSA 5FLXM 3S03A 2OTMA 4I4TB 3S06A 3AGKA 1VQPF 4O4LA 3P10A 4BT2A 3IKFA 3CC2F 1UFYA 1W59A 4TUYB 1W42A 5CB4B 1J7HA 2CHSA 3CC4F 2W8BC 4IIJB 1NJIH 5IT9M 3HKDA 3SIUA 2Z1FA 5DCVA 4ZOLA 3RYCB 1S72F 1Z5WA 2UYNB 3FD5A 4KWEA 5HP8A 4O4HA 1SA0B 3WPWA 2HS0A 3JATA 3PAFA 5EWRA 3RYFB 4X1YB 4ZHWA 5C8YB 1W40A 5HP7A 3CMEF 1K9MH 1KC8H 4X1IA 3LYBA 3MCQA 3WXMB 3HKCA 5HXZA 5JVDB 5LOVB 1FNKA 1Z5VA 4G88A 3C9TA 5GINC 1VQ4F 3RYHB 3JASA 5EZYA 3WGJA 1X25A 5JH7A 3OONA 1VQOF 4U39A 1W5EA 2UZHA 3S0YA 1YIJF 5ITZB 2CWJA 2IG8A 3JALB 4X1KA 3G71F 1XV2A 1VQ7F 2OTLF 4LCKA 1X52A 1VQMF 5CA0B 2OZBA 2BTOA 5JCOA 3WJRA 1KNJA 1XBIA 1FSZA 4B62A 1JJ2F 1U3PA 3IMPA 3CCMF 5FNVA 2H8EA 3RA5A 5LA6B 4I50B 4X20B 5EIBC 5KMGA 3JAWB 2P6YA 1CK2A 1W3EX 4I55A 3VYTC 4ZHQA 1YQNA 5MN4A 1TVKB 4X3MA 3CCUF 2B33A 4G4ZA 3CYPB 2Q1XA 3F0FA 2VGNA 2RB9A 3N2GA 4O4JA 3HKBA 1XRGA 4NWOB 1K73H 3LWRC 2GLZA 4HNAA 3I56F 5HY2A 2ZVZA 3WJQA 2HS3A 4LNUB 1COMA 5BMVA 1VQVA 3Q8HA 3MQWA 3JAKB 3LWVC 3JARB 3MDOA 4EI9A 4BVQA 1RLGA 2OHWA 3FD6A 3O85A 2HRUA 3N4YA
chains in the Genus database with same CATH topology
2UYNA 1ONIA 1QD9A 1XHOA 1FNJA 2UYKA 2EWCA 3R0PA 3KJKA 1X25A 2UYNB 3GTZA 1DBFA 2B33A 3M1XA 3QUWA 3VCZA 3ZOPA 3ZP7A 2UYPA 2UYJA 3M4SA 5HP8A 3ZO8A 3K0TA 3L7QA 3LMEA 1QAHA 1XRGA 2CW4A 2OTMA 2CWJA 2IG8A 3KJJA 3ZP4A 4NWOB 3I3FA 1JD1A 1NQ3A 3D01A 2CVLA 1QU9A 1COMA 1ODEA 1UI9A 1UFYA 5HP7A 1J7HA 2CHSA 3MQWA 2DYYA 3V4DA 3LYBA 4ZK7A 3K12A 1PF5A 2CSLA 3I7TA 1FNKA 2CHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYN A;  1ONI A;  1QD9 A;  1XHO A;  1FNJ A;  2UYK A;  2EWC A;  3R0P A;  3KJK A;  1X25 A;  2UYN B;  3GTZ A;  1DBF A;  2B33 A;  3M1X A;  3QUW A;  3VCZ A;  3ZOP A;  3ZP7 A;  2UYP A;  2UYJ A;  3M4S A;  5HP8 A;  3ZO8 A;  3K0T A;  3L7Q A;  3LME A;  1QAH A;  1XRG A;  2CW4 A;  2OTM A;  2CWJ A;  2IG8 A;  3KJJ A;  3ZP4 A;  4NWO B;  3I3F A;  1JD1 A;  1NQ3 A;  3D01 A;  2CVL A;  1QU9 A;  1COM A;  1ODE A;  1UI9 A;  1UFY A;  5HP7 A;  1J7H A;  2CHS A;  3MQW A;  2DYY A;  3V4D A;  3LYB A;  4ZK7 A;  3K12 A;  1PF5 A;  2CSL A;  3I7T A;  1FNK A;  2CHT A; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  5KX5 A;  2VXY A;  3VCZ A;  3V7E A;  2H8C A;  4O2A A;  2UYJ A;  3HWU A;  3S0W A;  3DDN A;  3CB2 A;  4G4W A;  3CD6 F;  3S0H A;  2HP0 A;  3LWP C;  3M84 A;  1QU9 A;  2RHL A;  2VAM A;  2LCA A;  3C8L A;  5JQG A;  2Z1U A;  1QVF F;  1DT9 A;  5EAZ A;  5GON B;  2RHJ A;  4U3J A;  2HS4 A;  5A2Q M;  3ESJ A;  2F9Z C;  2YYE A;  1GO1 A;  4DXD A;  4YJ2 A;  4C8I A;  5IJ0 A;  1FFX A;  3NK6 A;  3F6M A;  2VAW A;  3M1X A;  3QUW A;  3MCA B;  3M4S A;  5LXT A;  5J2U A;  2BO1 A;  3OBW A;  1Q82 H;  2CW4 A;  3KJJ A;  4TV9 B;  3N2K B;  4BT4 A;  3D54 A;  2YXZ A;  4O4L B;  1JFF A;  5LP6 C;  1KQS F;  3P0Z A;  5J2T A;  4DRX A;  3C9U A;  4NUT A;  2KG4 A;  2RHH A;  3PLA C;  3N4Z A;  3E20 B;  3JVH A;  5HY1 A;  3E22 A;  3HKE A;  1VQK F;  1T0K B;  3ON1 A;  3DC2 A;  4ZOL B;  4NQ3 A;  3VI6 A;  3ZOP A;  2HP3 A;  2ZAU A;  2ZVY A;  4I4T A;  4O2B A;  3NK7 A;  2Z1T A;  3QTY A;  2LBW A;  3L7Q A;  1VHA A;  4BT7 A;  4O4H B;  4BY9 D;  3J80 M;  2KTU A;  3LWQ C;  4B46 A;  1U43 A;  2LBX A;  3UT5 B;  2BTU A;  4IIJ A;  1PF5 A;  3RYC A;  3SIV A;  4X1I B;  1VQ8 F;  3I7T A;  3HKC B;  1W2B F;  1Q7Y H;  5G4U C;  1JN1 A;  4BT5 A;  3JAS B;  4WBN B;  3LFO A;  5JH7 B;  3J81 M;  2R75 1;  3K0T A;  3FFM A;  4IHJ B;  2AIF A;  2JNB A;  3LWO C;  5C8Y A;  4RHA A;  4BVR A;  1PXW A;  5MN5 A;  4F6R A;  1H47 A;  2Z01 A;  2HQS C;  2Z1E A;  4EB6 A;  1W55 A;  2PHN A;  5LOV A;  4TV8 A;  3VOA A;  3IEQ A;  5FNV B;  2VGM A;  3CCE F;  3JAM M;  5KMG B;  5LP6 A;  3CCS F;  3CCQ F;  2GVI A;  4I55 B;  5EB1 B;  3CMA F;  4TZZ A;  2WAL A;  2PMP A;  4M8I A;  3WGN A;  3CPW F;  4BW0 B;  5CA0 A;  4C8E A;  1YJN F;  2MQE A;  3CCJ F;  2DT4 A;  3N2G B;  4O4J B;  4O4I B;  5EYP B;  3C9S A;  2CVL A;  3HTN A;  4HNA B;  1RA4 A;  3CCL F;  3TD3 A;  4YJ3 A;  1SZQ A;  1IV1 A;  3IKE A;  4I50 A;  3ERN A;  5CA1 B;  5BMV B;  3V4D A;  3D00 A;  3JAW A;  1W57 A;  3JCM M;  1YGY A;  3F0D A;  4ZHY B;  5GIO C;  4FFB B;  3CCR F;  1YI2 F;  3NVI B;  2ZOD A;  3B6N A;  5IYZ A;  1GX1 A;  1CN7 A;  3CC7 F;  2H6L A;  3C9R A;  1IV4 A;  4O2A B;  5EB0 A;  5LYJ B;  2BTQ B;  4ZHV A;  2HP0 B;  1TUB A;  3KIZ A;  3NVK E;  1CLI A;  3FPI A;  1H7M A;  1Q81 H;  1U3L A;  3EOR A;  1W41 A;  3CXC F;  1Q8R A;  1K8A H;  4C4W C;  1VQ9 F;  4ERH A;  4YJ2 B;  5IJ0 B;  2UYP A;  3KE1 A;  1M90 H;  2R6R 1;  3RYI A;  5AVM A;  1VH8 A;  3LDT A;  5J2U B;  5LXT B;  1VQ6 F;  1QVG F;  4BT3 A;  3TD4 A;  1JD1 A;  3NMU C;  2ZF8 A;  1M1K H;  3RE3 A;  3F0G A;  1JFF B;  4ZK7 A;  5IJ9 A;  3TD5 A;  3VOB A;  5J2T B;  2ZOV A;  2ALE A;  3HKD B;  5GAN K;  2EWC A;  2IQQ A;  2I6R A;  3GTZ A;  1DBF A;  5EO3 A;  3VO8 A;  5B8F A;  5GAP K;  4B45 A;  4TV9 A;  3G6E F;  3N2K A;  2QI2 A;  4C81 A;  3QHD A;  4O2B B;  1YJ9 F;  1E7K A;  3CG6 A;  1X7O A;  1RLU A;  3VIU A;  4TUY A;  2K1S A;  1W5B A;  2HRY A;  3JAT B;  5CB4 A;  1IPA A;  1UI9 A;  2G9I A;  3RA6 A;  3MBM A;  1H48 A;  2DYY A;  4G4V A;  2N48 A;  3K12 A;  3K14 A;  3VMF B;  4C82 A;  2UYN A;  1FNJ A;  4G4Y A;  2CZW A;  2IAF A;  5MN6 A;  1SA0 A;  3RYF A;  3I55 F;  2V9Y A;  5EZY B;  4X1Y A;  1GZ0 A;  3E1Y A;  3UT5 A;  2GZL A;  2KTV A;  3G4S F;  2OTJ F;  4X1K B;  3WPX A;  3CCV F;  5GIP C;  3J7A R;  4F6R B;  1VK3 A;  3V7Q A;  4EB6 B;  3P4E A;  5JVD A;  5G4V C;  1W5A A;  4EI8 A;  2FC3 A;  3RYH A;  1VQ5 F;  4TV8 B;  1Q86 H;  3CPQ A;  4WBN A;  5HY4 A;  3WGM A;  2QTP A;  4IHJ A;  2RHO A;  3VTI C;  5LP6 B;  4ZHQ B;  5ITZ A;  3JAL A;  4B5C A;  3V3T A;  4BVT A;  3LME A;  1QAH A;  1NMU B;  3CYQ A;  3I3F A;  1W5F A;  1NQ3 A;  3HKB B;  3VYU C;  2VAP A;  4EI7 A;  1RQ2 A;  4X3L A;  4RQO A;  2QA4 F;  4YJ3 B;  5LA6 A;  4X20 A;  3BYQ A;  4E6E A;  3K2X A;  1OAP A;  4R40 B;  4BT6 A;  1TVK A;  1QD9 A;  1RQ7 A;  3KJK A;  4ZI7 B;  5HXU A;  5EIB D;  3U0O A;  1IV3 A;  5HY0 A;  1U40 A;  3ZO8 A;  4O4I A;  5IYZ B;  1YIT F;  5EYP A;  5KX5 B;  1VQL F;  1JY8 A;  2AIZ P;  4LNU A;  1X7P A;  1SDS A;  3D01 A;  5CA1 A;  3JAK A;  3JAR A;  1KD1 H;  1W58 1;  3F0E A;  2FGY A;  1N8R H;  1KNK A;  5JQG B;  1TUB B;  1GO0 A;  2L26 A;  4FFB A;  5HWE A;  5FJ4 C;  3GHZ A;  3HJW C;  4U3J B;  2CSL A;  2HVY D;  3IEW A;  2CHT A;  4XCQ A;  1ONI A;  2QEX F;  1XHO A;  2LBT A;  2Q1Y A;  3VYS C;  2UYK A;  1VQN F;  1OFU A;  3ZP7 A;  1YJW F;  3KHN A;  3GYQ A;  5LYJ A;  1R1M A;  3WGL A;  2I6D A;  1FFX B;  2KGW A;  3WGK A;  3OBY A;  1YHQ F;  3HAX D;  3RYI B;  3ZP4 A;  2AMT A;  3T80 A;  4C8G A;  1ZWZ A;  3ELC A;  1T0A A;  3OW2 F;  3FBA A;  1ODE A;  5GON A;  4PWT A;  2HX0 A;  4DRX B;  5IJ9 B;  3WJP A;  4G4X A;  3E22 B;  3R0P A;  2NMU A;  5JCO C;  3HKE B;  1IV2 A;  3IR9 A;  3S02 A;  4BVS A;  5FLX M;  3S03 A;  2OTM A;  4I4T B;  3S06 A;  3AGK A;  1VQP F;  4O4L A;  3P10 A;  4BT2 A;  3IKF A;  3CC2 F;  1UFY A;  1W59 A;  4TUY B;  1W42 A;  5CB4 B;  1J7H A;  2CHS A;  3CC4 F;  2W8B C;  4IIJ B;  1NJI H;  5IT9 M;  3HKD A;  3SIU A;  2Z1F A;  5DCV A;  4ZOL A;  3RYC B;  1S72 F;  1Z5W A;  2UYN B;  3FD5 A;  4KWE A;  5HP8 A;  4O4H A;  1SA0 B;  3WPW A;  2HS0 A;  3JAT A;  3PAF A;  5EWR A;  3RYF B;  4X1Y B;  4ZHW A;  5C8Y B;  1W40 A;  5HP7 A;  3CME F;  1K9M H;  1KC8 H;  4X1I A;  3LYB A;  3MCQ A;  3WXM B;  3HKC A;  5HXZ A;  5JVD B;  5LOV B;  1FNK A;  1Z5V A;  4G88 A;  3C9T A;  5GIN C;  1VQ4 F;  3RYH B;  3JAS A;  5EZY A;  3WGJ A;  1X25 A;  5JH7 A;  3OON A;  1VQO F;  4U39 A;  1W5E A;  2UZH A;  3S0Y A;  1YIJ F;  5ITZ B;  2CWJ A;  2IG8 A;  3JAL B;  4X1K A;  3G71 F;  1XV2 A;  1VQ7 F;  2OTL F;  4LCK A;  1X52 A;  1VQM F;  5CA0 B;  2OZB A;  2BTO A;  5JCO A;  3WJR A;  1KNJ A;  1XBI A;  1FSZ A;  4B62 A;  1JJ2 F;  1U3P A;  3IMP A;  3CCM F;  5FNV A;  2H8E A;  3RA5 A;  5LA6 B;  4I50 B;  4X20 B;  5EIB C;  5KMG A;  3JAW B;  2P6Y A;  1CK2 A;  1W3E X;  4I55 A;  3VYT C;  4ZHQ A;  1YQN A;  5MN4 A;  1TVK B;  4X3M A;  3CCU F;  2B33 A;  4G4Z A;  3CYP B;  2Q1X A;  3F0F A;  2VGN A;  2RB9 A;  3N2G A;  4O4J A;  3HKB A;  1XRG A;  4NWO B;  1K73 H;  3LWR C;  2GLZ A;  4HNA A;  3I56 F;  5HY2 A;  2ZVZ A;  3WJQ A;  2HS3 A;  4LNU B;  1COM A;  5BMV A;  1VQV A;  3Q8H A;  3MQW A;  3JAK B;  3LWV C;  3JAR B;  3MDO A;  4EI9 A;  4BVQ A;  1RLG A;  2OHW A;  3FD6 A;  3O85 A;  2HRU A;  3N4Y A; 
#chains in the Genus database with same CATH homology
 2UYN A;  1ONI A;  1QD9 A;  1XHO A;  1FNJ A;  2UYK A;  2EWC A;  3R0P A;  3KJK A;  1X25 A;  2UYN B;  3GTZ A;  1DBF A;  2B33 A;  3M1X A;  3QUW A;  3VCZ A;  3ZOP A;  3ZP7 A;  2UYP A;  2UYJ A;  3M4S A;  5HP8 A;  3ZO8 A;  3K0T A;  3L7Q A;  3LME A;  1QAH A;  1XRG A;  2CW4 A;  2OTM A;  2CWJ A;  2IG8 A;  3KJJ A;  3ZP4 A;  4NWO B;  3I3F A;  1JD1 A;  1NQ3 A;  3D01 A;  2CVL A;  1QU9 A;  1COM A;  1ODE A;  1UI9 A;  1UFY A;  5HP7 A;  1J7H A;  2CHS A;  3MQW A;  2DYY A;  3V4D A;  3LYB A;  4ZK7 A;  3K12 A;  1PF5 A;  2CSL A;  3I7T A;  1FNK A;  2CHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...