5HP8A

Crystal structures of rida in complex with pyruvate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
SQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPAPSPARSTYQVAALPLNAKIEIECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reactive Intermediate Deaminase A, chloroplastic
publication title Crystal structures of RidA, an important enzyme for the prevention of toxic side products
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 5hp8A00
1XHOA 1QAHA 2EWCA 3ZOPA 3VCZA 3ZO8A 2UYNB 2CHSA 2UYKA 1J7HA 2CVLA 3ZP7A 2B33A 2UYPA 2CWJA 1FNKA 3QUWA 1DBFA 1QD9A 2IG8A 3KJKA 3LMEA 1FNJA 1X25A 2CHTA 3R0PA 3ZP4A 1JD1A 3M4SA 3LYBA 3M1XA 3D01A 2UYNA 2OTMA 1ONIA 3L7QA 1PF5A 2CSLA 3I3FA 3K0TA 2UYJA 4ZK7A 3GTZA 3I7TA 1COMA 1QU9A 3K12A 4NWOB 1NQ3A 5HP8A 2CW4A 1UFYA 1XRGA 1UI9A 5HP7A 3KJJA 3MQWA 3V4DA 2DYYA 1ODEA
chains in the Genus database with same CATH superfamily
3N4ZA 3CMEF 1X7OA 5FNVA 3WJRA 3ZO8A 5EIBD 2KTUA 2CWJA 2QI2A 4U3JB 3V3TA 1VQLF 2HS3A 2I6DA 1U43A 2AMTA 5J2TA 1VH8A 2HP0B 3MBMA 4TV9A 5KX5B 4I55B 5HXZA 3ERNA 4I4TB 5LP6B 3HJWC 3SIUA 4G4ZA 3JASB 1U3PA 4R40B 5IT9M 3B6NA 3SIVA 1XHOA 1QAHA 3D54A 4I4TA 5LA6B 3HKBB 3VOAA 2B33A 2UYPA 5GIPC 1DBFA 3JASA 5JCOA 1W5EA 2OZBA 4BVQA 2VAWA 3RE3A 3T80A 1TVKB 3D01A 5LA6A 2OTMA 2Z1TA 5HY0A 3I3FA 3IKFA 3K0TA 4O2BA 1E7KA 1RLUA 4O2AA 5HP8A 2CW4A 4BT3A 4C4WC 3DDNA 3RYFA 4C8IA 5C8YB 3JAWA 4PWTA 5CA1B 2HQSC 2PHNA 2Q1YA 2F9ZC 3JARB 3OONA 2CHSA 4BT7A 3CC4F 4G4WA 4ZI7B 5CB4B 1KC8H 1YJWF 1W5FA 4IIJB 1Q7YH 2G9IA 4I50A 1JY8A 5GINC 2LBWA 4LCKA 4C82A 1IV2A 4ZHYB 1VQ8F 1T0KB 1YHQF 4YJ3B 1XBIA 1QU9A 3CYPB 5DCVA 4IIJA 1GO1A 1U40A 1XRGA 5LXTA 3K14A 1S72F 4X3MA 4BVTA 1KNJA 3ON1A 1YITF 3HKDB 5EYPA 3MCQA 1U3LA 5IJ9B 4O4JB 1JFFB 4YJ3A 1OFUA 4G4VA 1Q81H 2H8CA 4ZHWA 3G4SF 4ZOLB 4BT2A 3RA5A 5EZYA 1CK2A 2CZWA 2RHOA 3WGJA 5KMGA 1M1KH 2L26A 2H6LA 4DRXA 4ZOLA 5FJ4C 4X1IB 2VXYA 3S0HA 2EWCA 5GONA 1W42A 2VGNA 3P4EA 2PMPA 5LP6C 4NQ3A 3KHNA 3PLAC 1J7HA 1KNKA 3MCAB 2Z1UA 3CCLF 3VYSC 4TUYA 1YJNF 5EWRA 2OTJF 3CB2A 3DC2A 1JD1A 5BMVB 4F6RB 1YI2F 5J2UA 3J7AR 3F0DA 5FNVB 4C8EA 3P10A 3CD6F 3N2GB 3FD5A 2GZLA 5EB1B 3F0GA 2IQQA 5GAPK 3V4DA 2BO1A 5J2TB 3M1XA 3CPWF 4TV9B 3I56F 5EO3A 2YXZA 3RYCA 1YGYA 2GVIA 4C8GA 1M90H 3F0EA 5EIBC 3CYQA 3N2GA 3S0WA 5A2QM 4O4HB 2P6YA 5HY1A 1VQ6F 1FSZA 3JALA 1SA0A 3M4SA 4LNUB 3G6EF 3GYQA 3NK7A 3L7QA 3JAMM 1PF5A 4X1YA 2AIFA 4O4HA 3RA6A 5IYZA 1UFYA 2HS4A 3P0ZA 5HP7A 1R1MA 1YQNA 3HTNA 3K2XA 4LNUA 5JQGA 3S03A 3WGNA 2UYNB 3HAXD 2DT4A 3QUWA 5IJ0A 1SZQA 3NK6A 3Q8HA 4O2BB 4O2AB 1W2BF 3RYFB 3JAWB 1PXWA 3V7QA 2UYNA 3M84A 1ONIA 4BW0B 2UZHA 2ZAUA 2N48A 1IV4A 1IV1A 3RYHA 3J80M 5G4UC 3E22A 2ALEA 3CPQA 4WBNB 3U0OA 4ZHVA 4I50B 2FGYA 1W581 2HS0A 1ZWZA 2VAPA 3S06A 5MN6A 3LWVC 5LYJA 3UT5A 5GIOC 5B8FA 4TV8A 1QD9A 3JVHA 4WBNA 3CCUF 5LXTB 4BVSA 5HY4A 1VQVA 3CG6A 1H7MA 3CCJF 3JAKA 2RB9A 3WPXA 2HP3A 1VQNF 5EYPB 4ZK7A 1NMUB 3JCMM 3I7TA 2RHJA 2ZOVA 1VQOF 1OAPA 3CMAF 1YJ9F 3HKEA 1Q86H 5EZYB 2UYKA 1VQ9F 1YIJF 3AGKA 4B5CA 2Z1FA 5KMGB 1FNKA 2QEXF 4DRXB 3CCRF 3N2KB 1W40A 2QTPA 3KE1A 1DT9A 1Z5WA 4O4IB 4B62A 3VMFB 3J81M 5GONB 1RLGA 3LFOA 3VIUA 3IR9A 2I6RA 3CC2F 3WGLA 1Q8RA 3N2KA 4G88A 4TUYB 4O4IA 3N4YA 4X1KB 4RQOA 4DXDA 3WPWA 1K9MH 4HNAA 3MDOA 3JATA 2YYEA 3FFMA 5J2UB 2QA4F 1W41A 3S02A 3F0FA 3OW2F 3VYUC 5GANK 3C9TA 4X1KA 3E1YA 3HKCA 3WJQA 2WALA 2LBTA 3RYCB 2W8BC 4IHJB 1K8AH 1X7PA 1SDSA 4B46A 3IKEA 4ERHA 1Q82H 3MQWA 5CA0A 2Z1EA 5ITZA 3IEWA 2H8EA 3JALB 1SA0B 4RHAA 3QTYA 4BVRA 1TUBA 4EI8A 1VQPF 5HY2A 4IHJA 4X1YB 3KJKA 3LMEA 4BT6A 1GX1A 5IYZB 1Z5VA 2CHTA 3D00A 2HRUA 3HWUA 4G4YA 5AVMA 5JQGB 3ESJA 4YJ2A 1KQSF 2LCAA 4X20A 3RYIA 1CN7A 1NQ3A 1VK3A 3IEQA 4O4LA 5IJ0B 3CCVF 3TD5A 2OTLF 1W57A 3VCZA 1W59A 1QVGF 5JH7A 1IPAA 5JVDA 1X52A 3VYTC 3RYHB 4FFBA 3CXCF 3NMUC 3E22B 5LOVA 5G4VC 3R0PA 3WGMA 4TZZA 1QVFF 2MQEA 3FPIA 4NUTA 3S0YA 1JN1A 5LYJB 4U3JA 2ZODA 3UT5B 4U39A 1T0AA 3VOBA 3GTZA 4M8IA 3K12A 5HXUA 4EI9A 4NWOB 4TV8B 2BTQB 2HP0A 3GHZA 5KX5A 3KJJA 4B45A 1KD1H 4I55A 4E6EA 1H48A 4EI7A 3ZOPA 3CC7F 5LP6A 3JAKB 2LBXA 2VGMA 4EB6B 3E20B 4ZHQB 3EORA 2ZF8A 2HVYD 1X25A 3ZP4A 2JNBA 2RHLA 3VI6A 5EB0A 3LWOC 1RQ2A 3HKEB 3HKBA 3O85A 5MN4A 1W55A 1VQMF 1XV2A 5HWEA 3CCSF 4EB6A 4ZHQA 1RQ7A 1N8RH 2ZVYA 3FD6A 2HRYA 3CCEF 2BTUA 3NVIB 1TVKA 1VQ5F 1W5BA 2R751 1GO0A 3TD3A 2HX0A 2K1SA 5C8YA 3WXMB 3LWRC 1FNJA 3FBAA 1VQ7F 2Q1XA 1VQKF 5CA1A 1FFXB 2BTOA 1K73H 3JARA 2KGWA 1RA4A 4G4XA 5CB4A 4ZI7A 1JJ2F 4HNAB 3JATB 1COMA 5EAZA 1W3EX 3G71F 1UI9A 2FC3A 1FFXA 3C8LA 3QHDA 3CCMF 4C81A 3VO8A 3HKCB 2CVLA 2IAFA 2GLZA 4KWEA 4X3LA 2KG4A 3F6MA 2RHHA 3C9UA 5JCOC 2V9YA 3HKDA 2Z01A 5FLXM 5CA0B 5ITZB 5IJ9A 4O4JA 3LWPC 3I55F 1JFFA 3TD4A 1TUBB 1IV3A 2R6R1 2OHWA 1CLIA 3LDTA 4XCQA 3LWQC 2DYYA 1ODEA 3KIZA 3OBYA 1NJIH 3C9RA 3ELCA 5MN5A 3BYQA 2AIZP 4YJ2B 2VAMA 3ZP7A 1H47A 4X20B 3RYIB 4BT4A 1W5AA 2IG8A 3NVKE 3WGKA 4BT5A 2KTVA 4O4LB 2ZVZA 4X1IA 3WJPA 3PAFA 3C9SA 3IMPA 3OBWA 3LYBA 1VQ4F 3CCQF 2CSLA 2UYJA 5JH7B 2NMUA 5JVDB 3V7EA 3VTIC 1VHAA 1GZ0A 4FFBB 5LOVB 5BMVA 4F6RA 4BY9D
chains in the Genus database with same CATH topology
1XHOA 1QAHA 2EWCA 3ZOPA 3VCZA 3ZO8A 2UYNB 2CHSA 2UYKA 1J7HA 2CVLA 3ZP7A 2B33A 2UYPA 2CWJA 1FNKA 3QUWA 1DBFA 1QD9A 2IG8A 3KJKA 3LMEA 1FNJA 1X25A 2CHTA 3R0PA 3ZP4A 1JD1A 3M4SA 3LYBA 3M1XA 3D01A 2UYNA 2OTMA 1ONIA 3L7QA 1PF5A 2CSLA 3I3FA 3K0TA 2UYJA 4ZK7A 3GTZA 3I7TA 1COMA 1QU9A 3K12A 4NWOB 1NQ3A 5HP8A 2CW4A 1UFYA 1XRGA 1UI9A 5HP7A 3KJJA 3MQWA 3V4DA 2DYYA 1ODEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHO A;  1QAH A;  2EWC A;  3ZOP A;  3VCZ A;  3ZO8 A;  2UYN B;  2CHS A;  2UYK A;  1J7H A;  2CVL A;  3ZP7 A;  2B33 A;  2UYP A;  2CWJ A;  1FNK A;  3QUW A;  1DBF A;  1QD9 A;  2IG8 A;  3KJK A;  3LME A;  1FNJ A;  1X25 A;  2CHT A;  3R0P A;  3ZP4 A;  1JD1 A;  3M4S A;  3LYB A;  3M1X A;  3D01 A;  2UYN A;  2OTM A;  1ONI A;  3L7Q A;  1PF5 A;  2CSL A;  3I3F A;  3K0T A;  2UYJ A;  4ZK7 A;  3GTZ A;  3I7T A;  1COM A;  1QU9 A;  3K12 A;  4NWO B;  1NQ3 A;  5HP8 A;  2CW4 A;  1UFY A;  1XRG A;  1UI9 A;  5HP7 A;  3KJJ A;  3MQW A;  3V4D A;  2DYY A;  1ODE A; 
#chains in the Genus database with same CATH topology
 3N4Z A;  3CME F;  1X7O A;  5FNV A;  3WJR A;  3ZO8 A;  5EIB D;  2KTU A;  2CWJ A;  2QI2 A;  4U3J B;  3V3T A;  1VQL F;  2HS3 A;  2I6D A;  1U43 A;  2AMT A;  5J2T A;  1VH8 A;  2HP0 B;  3MBM A;  4TV9 A;  5KX5 B;  4I55 B;  5HXZ A;  3ERN A;  4I4T B;  5LP6 B;  3HJW C;  3SIU A;  4G4Z A;  3JAS B;  1U3P A;  4R40 B;  5IT9 M;  3B6N A;  3SIV A;  1XHO A;  1QAH A;  3D54 A;  4I4T A;  5LA6 B;  3HKB B;  3VOA A;  2B33 A;  2UYP A;  5GIP C;  1DBF A;  3JAS A;  5JCO A;  1W5E A;  2OZB A;  4BVQ A;  2VAW A;  3RE3 A;  3T80 A;  1TVK B;  3D01 A;  5LA6 A;  2OTM A;  2Z1T A;  5HY0 A;  3I3F A;  3IKF A;  3K0T A;  4O2B A;  1E7K A;  1RLU A;  4O2A A;  5HP8 A;  2CW4 A;  4BT3 A;  4C4W C;  3DDN A;  3RYF A;  4C8I A;  5C8Y B;  3JAW A;  4PWT A;  5CA1 B;  2HQS C;  2PHN A;  2Q1Y A;  2F9Z C;  3JAR B;  3OON A;  2CHS A;  4BT7 A;  3CC4 F;  4G4W A;  4ZI7 B;  5CB4 B;  1KC8 H;  1YJW F;  1W5F A;  4IIJ B;  1Q7Y H;  2G9I A;  4I50 A;  1JY8 A;  5GIN C;  2LBW A;  4LCK A;  4C82 A;  1IV2 A;  4ZHY B;  1VQ8 F;  1T0K B;  1YHQ F;  4YJ3 B;  1XBI A;  1QU9 A;  3CYP B;  5DCV A;  4IIJ A;  1GO1 A;  1U40 A;  1XRG A;  5LXT A;  3K14 A;  1S72 F;  4X3M A;  4BVT A;  1KNJ A;  3ON1 A;  1YIT F;  3HKD B;  5EYP A;  3MCQ A;  1U3L A;  5IJ9 B;  4O4J B;  1JFF B;  4YJ3 A;  1OFU A;  4G4V A;  1Q81 H;  2H8C A;  4ZHW A;  3G4S F;  4ZOL B;  4BT2 A;  3RA5 A;  5EZY A;  1CK2 A;  2CZW A;  2RHO A;  3WGJ A;  5KMG A;  1M1K H;  2L26 A;  2H6L A;  4DRX A;  4ZOL A;  5FJ4 C;  4X1I B;  2VXY A;  3S0H A;  2EWC A;  5GON A;  1W42 A;  2VGN A;  3P4E A;  2PMP A;  5LP6 C;  4NQ3 A;  3KHN A;  3PLA C;  1J7H A;  1KNK A;  3MCA B;  2Z1U A;  3CCL F;  3VYS C;  4TUY A;  1YJN F;  5EWR A;  2OTJ F;  3CB2 A;  3DC2 A;  1JD1 A;  5BMV B;  4F6R B;  1YI2 F;  5J2U A;  3J7A R;  3F0D A;  5FNV B;  4C8E A;  3P10 A;  3CD6 F;  3N2G B;  3FD5 A;  2GZL A;  5EB1 B;  3F0G A;  2IQQ A;  5GAP K;  3V4D A;  2BO1 A;  5J2T B;  3M1X A;  3CPW F;  4TV9 B;  3I56 F;  5EO3 A;  2YXZ A;  3RYC A;  1YGY A;  2GVI A;  4C8G A;  1M90 H;  3F0E A;  5EIB C;  3CYQ A;  3N2G A;  3S0W A;  5A2Q M;  4O4H B;  2P6Y A;  5HY1 A;  1VQ6 F;  1FSZ A;  3JAL A;  1SA0 A;  3M4S A;  4LNU B;  3G6E F;  3GYQ A;  3NK7 A;  3L7Q A;  3JAM M;  1PF5 A;  4X1Y A;  2AIF A;  4O4H A;  3RA6 A;  5IYZ A;  1UFY A;  2HS4 A;  3P0Z A;  5HP7 A;  1R1M A;  1YQN A;  3HTN A;  3K2X A;  4LNU A;  5JQG A;  3S03 A;  3WGN A;  2UYN B;  3HAX D;  2DT4 A;  3QUW A;  5IJ0 A;  1SZQ A;  3NK6 A;  3Q8H A;  4O2B B;  4O2A B;  1W2B F;  3RYF B;  3JAW B;  1PXW A;  3V7Q A;  2UYN A;  3M84 A;  1ONI A;  4BW0 B;  2UZH A;  2ZAU A;  2N48 A;  1IV4 A;  1IV1 A;  3RYH A;  3J80 M;  5G4U C;  3E22 A;  2ALE A;  3CPQ A;  4WBN B;  3U0O A;  4ZHV A;  4I50 B;  2FGY A;  1W58 1;  2HS0 A;  1ZWZ A;  2VAP A;  3S06 A;  5MN6 A;  3LWV C;  5LYJ A;  3UT5 A;  5GIO C;  5B8F A;  4TV8 A;  1QD9 A;  3JVH A;  4WBN A;  3CCU F;  5LXT B;  4BVS A;  5HY4 A;  1VQV A;  3CG6 A;  1H7M A;  3CCJ F;  3JAK A;  2RB9 A;  3WPX A;  2HP3 A;  1VQN F;  5EYP B;  4ZK7 A;  1NMU B;  3JCM M;  3I7T A;  2RHJ A;  2ZOV A;  1VQO F;  1OAP A;  3CMA F;  1YJ9 F;  3HKE A;  1Q86 H;  5EZY B;  2UYK A;  1VQ9 F;  1YIJ F;  3AGK A;  4B5C A;  2Z1F A;  5KMG B;  1FNK A;  2QEX F;  4DRX B;  3CCR F;  3N2K B;  1W40 A;  2QTP A;  3KE1 A;  1DT9 A;  1Z5W A;  4O4I B;  4B62 A;  3VMF B;  3J81 M;  5GON B;  1RLG A;  3LFO A;  3VIU A;  3IR9 A;  2I6R A;  3CC2 F;  3WGL A;  1Q8R A;  3N2K A;  4G88 A;  4TUY B;  4O4I A;  3N4Y A;  4X1K B;  4RQO A;  4DXD A;  3WPW A;  1K9M H;  4HNA A;  3MDO A;  3JAT A;  2YYE A;  3FFM A;  5J2U B;  2QA4 F;  1W41 A;  3S02 A;  3F0F A;  3OW2 F;  3VYU C;  5GAN K;  3C9T A;  4X1K A;  3E1Y A;  3HKC A;  3WJQ A;  2WAL A;  2LBT A;  3RYC B;  2W8B C;  4IHJ B;  1K8A H;  1X7P A;  1SDS A;  4B46 A;  3IKE A;  4ERH A;  1Q82 H;  3MQW A;  5CA0 A;  2Z1E A;  5ITZ A;  3IEW A;  2H8E A;  3JAL B;  1SA0 B;  4RHA A;  3QTY A;  4BVR A;  1TUB A;  4EI8 A;  1VQP F;  5HY2 A;  4IHJ A;  4X1Y B;  3KJK A;  3LME A;  4BT6 A;  1GX1 A;  5IYZ B;  1Z5V A;  2CHT A;  3D00 A;  2HRU A;  3HWU A;  4G4Y A;  5AVM A;  5JQG B;  3ESJ A;  4YJ2 A;  1KQS F;  2LCA A;  4X20 A;  3RYI A;  1CN7 A;  1NQ3 A;  1VK3 A;  3IEQ A;  4O4L A;  5IJ0 B;  3CCV F;  3TD5 A;  2OTL F;  1W57 A;  3VCZ A;  1W59 A;  1QVG F;  5JH7 A;  1IPA A;  5JVD A;  1X52 A;  3VYT C;  3RYH B;  4FFB A;  3CXC F;  3NMU C;  3E22 B;  5LOV A;  5G4V C;  3R0P A;  3WGM A;  4TZZ A;  1QVF F;  2MQE A;  3FPI A;  4NUT A;  3S0Y A;  1JN1 A;  5LYJ B;  4U3J A;  2ZOD A;  3UT5 B;  4U39 A;  1T0A A;  3VOB A;  3GTZ A;  4M8I A;  3K12 A;  5HXU A;  4EI9 A;  4NWO B;  4TV8 B;  2BTQ B;  2HP0 A;  3GHZ A;  5KX5 A;  3KJJ A;  4B45 A;  1KD1 H;  4I55 A;  4E6E A;  1H48 A;  4EI7 A;  3ZOP A;  3CC7 F;  5LP6 A;  3JAK B;  2LBX A;  2VGM A;  4EB6 B;  3E20 B;  4ZHQ B;  3EOR A;  2ZF8 A;  2HVY D;  1X25 A;  3ZP4 A;  2JNB A;  2RHL A;  3VI6 A;  5EB0 A;  3LWO C;  1RQ2 A;  3HKE B;  3HKB A;  3O85 A;  5MN4 A;  1W55 A;  1VQM F;  1XV2 A;  5HWE A;  3CCS F;  4EB6 A;  4ZHQ A;  1RQ7 A;  1N8R H;  2ZVY A;  3FD6 A;  2HRY A;  3CCE F;  2BTU A;  3NVI B;  1TVK A;  1VQ5 F;  1W5B A;  2R75 1;  1GO0 A;  3TD3 A;  2HX0 A;  2K1S A;  5C8Y A;  3WXM B;  3LWR C;  1FNJ A;  3FBA A;  1VQ7 F;  2Q1X A;  1VQK F;  5CA1 A;  1FFX B;  2BTO A;  1K73 H;  3JAR A;  2KGW A;  1RA4 A;  4G4X A;  5CB4 A;  4ZI7 A;  1JJ2 F;  4HNA B;  3JAT B;  1COM A;  5EAZ A;  1W3E X;  3G71 F;  1UI9 A;  2FC3 A;  1FFX A;  3C8L A;  3QHD A;  3CCM F;  4C81 A;  3VO8 A;  3HKC B;  2CVL A;  2IAF A;  2GLZ A;  4KWE A;  4X3L A;  2KG4 A;  3F6M A;  2RHH A;  3C9U A;  5JCO C;  2V9Y A;  3HKD A;  2Z01 A;  5FLX M;  5CA0 B;  5ITZ B;  5IJ9 A;  4O4J A;  3LWP C;  3I55 F;  1JFF A;  3TD4 A;  1TUB B;  1IV3 A;  2R6R 1;  2OHW A;  1CLI A;  3LDT A;  4XCQ A;  3LWQ C;  2DYY A;  1ODE A;  3KIZ A;  3OBY A;  1NJI H;  3C9R A;  3ELC A;  5MN5 A;  3BYQ A;  2AIZ P;  4YJ2 B;  2VAM A;  3ZP7 A;  1H47 A;  4X20 B;  3RYI B;  4BT4 A;  1W5A A;  2IG8 A;  3NVK E;  3WGK A;  4BT5 A;  2KTV A;  4O4L B;  2ZVZ A;  4X1I A;  3WJP A;  3PAF A;  3C9S A;  3IMP A;  3OBW A;  3LYB A;  1VQ4 F;  3CCQ F;  2CSL A;  2UYJ A;  5JH7 B;  2NMU A;  5JVD B;  3V7E A;  3VTI C;  1VHA A;  1GZ0 A;  4FFB B;  5LOV B;  5BMV A;  4F6R A;  4BY9 D; 
#chains in the Genus database with same CATH homology
 1XHO A;  1QAH A;  2EWC A;  3ZOP A;  3VCZ A;  3ZO8 A;  2UYN B;  2CHS A;  2UYK A;  1J7H A;  2CVL A;  3ZP7 A;  2B33 A;  2UYP A;  2CWJ A;  1FNK A;  3QUW A;  1DBF A;  1QD9 A;  2IG8 A;  3KJK A;  3LME A;  1FNJ A;  1X25 A;  2CHT A;  3R0P A;  3ZP4 A;  1JD1 A;  3M4S A;  3LYB A;  3M1X A;  3D01 A;  2UYN A;  2OTM A;  1ONI A;  3L7Q A;  1PF5 A;  2CSL A;  3I3F A;  3K0T A;  2UYJ A;  4ZK7 A;  3GTZ A;  3I7T A;  1COM A;  1QU9 A;  3K12 A;  4NWO B;  1NQ3 A;  5HP8 A;  2CW4 A;  1UFY A;  1XRG A;  1UI9 A;  5HP7 A;  3KJJ A;  3MQW A;  3V4D A;  2DYY A;  1ODE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...