5HPEA

Phosphatase domain of pp5 bound to a phosphomimetic cdc37 substrate peptide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
346
structure length
326
Chain Sequence
EYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYAWDHIEVEDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional basis of protein phosphatase 5 substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5,Hsp90 co-chaperone Cd
total genus 119
structure length 326
sequence length 346
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5hpeA00
3DSCA 4ORAA 4F0ZA 5EQVA 4KBPA 3QFKA 3PSOA 2NYMC 3H67A 3H64A 1U32A 3RL4A 4DHLA 1NNWA 4LTYA 3N5UA 4LACC 4IL1A 3ZU0A 2WDCA 3THOB 3EGHA 4FBWA 5GTUA 4UT3A 4TUIA 2BCDA 2QFPA 4IYPC 3FGAC 4ZVZA 3PSNA 3QFMA 4KKZA 3H60A 2Z06A 1S3LA 1Z2WA 2HY1A 2HYOA 1HPUA 1XZWA 3AV0A 3C5WC 4H1YP 3T1IA 1WARA 3QG5C 3H66A 4FBQA 3KBPA 3IB7A 1OI8A 3H63A 2Z1AA 4O43A 1IT6A 3RL5A 2YVTA 1HP1A 2Z72A 4DT2A 3GVEA 4B2OA 2QFRA 4HD0A 4FCXA 3IVEA 1T70A 1S3NA 1QFCA 2WDDA 4ZX2A 4MP0A 2IE4C 1II7A 4JA9A 5F3WA 4J6OA 1T71A 4O5GA 4V0WA 3CK2A 4H2GA 3RL3A 2IAEC 3AUZA 2KKNA 4DSYA 1JK7A 5C1VA 5JPEA 2ZBMA 3H69A 1FJMA 1S95A 4I5LC 3THNA 3QFOA 1MF8A 3C9FA 1XM7A 2XMOA 2GJUA 2DFJA 2A22A 4H2FA 3P71C 4ORCA 2HYPA 1S3MA 3QFNA 5B8IA 5IOHA 3E7BA 2O8AA 3ICFA 2BQ8X 2Q8UA 3DW8C 5J28A 5DNYA 5INBA 4TUGA 1SU1A 1W24A 4YKEA 2P6BA 4O4KA 4WWLA 1S70A 4OR9A 1OIEA 3H62B 4FBKA 1TCOA 2NXFA 4JA7A 1USHA 4O24A 4XPNA 2QJCA 4V0VA 1AUIA 4MOVA 3H68A 1UTEA 4NZVA 4UT3B 4UWQA 4V0XA 1S8EA 3H61A 3RQZA 2USHA 1KBPA 3K7VC 1UF3A 4Q7FA 2NPPC 2AHDA 3K7WC 5HPEA 4I5NC 3EGGA 1WAO1 4MOYA 3JYFA 2NYLC 4LU9A 2O8GA 4ORBA 3HVQA 5JPFA 3LL8A 1M63A 4M0VA 3V4YA 1Z2XA 2WDFA 1OIDA 2IE3C 2BDXA 1QHWA 2CV9A 3IB8A 4H2BA 3E7AA 1G5BA 3DSDA 5JJTA 1V73A 4H1SA 3TGHA 3IVDA 4UT2A 2R17A 4H2IA 1HO5A 2JOGA 2WDEA 4G9JA 3ZTVA
chains in the Genus database with same CATH superfamily
3DSCA 4ORAA 4F0ZA 5EQVA 4KBPA 3QFKA 3PSOA 2NYMC 3H67A 3H64A 1U32A 3RL4A 4DHLA 1NNWA 4LTYA 3N5UA 4LACC 4IL1A 3ZU0A 2WDCA 3THOB 3EGHA 4FBWA 5GTUA 4UT3A 4TUIA 2BCDA 2QFPA 4IYPC 3FGAC 4ZVZA 3PSNA 3QFMA 4KKZA 3H60A 2Z06A 1S3LA 1Z2WA 2DXLA 2HY1A 2HYOA 1HPUA 1XZWA 3AV0A 3C5WC 4H1YP 3T1IA 1WARA 3QG5C 3H66A 4FBQA 3KBPA 3IB7A 1OI8A 3H63A 2Z1AA 4O43A 1IT6A 3RL5A 2YVTA 1HP1A 2Z72A 4DT2A 3GVEA 4B2OA 2QFRA 4HD0A 2ZOAA 4FCXA 3IVEA 1T70A 1S3NA 1QFCA 2WDDA 4ZX2A 4MP0A 2IE4C 1II7A 4JA9A 5F3WA 4J6OA 1T71A 4O5GA 4V0WA 3CK2A 4H2GA 3RL3A 2IAEC 3AUZA 2KKNA 4DSYA 2ZO9B 1JK7A 5C1VA 5JPEA 2ZBMA 3H69A 1FJMA 1S95A 4I5LC 3THNA 3QFOA 1MF8A 3C9FA 1XM7A 2XMOA 3E0JA 2GJUA 2DFJA 2A22A 4H2FA 3P71C 4ORCA 2HYPA 1S3MA 3QFNA 5B8IA 5IOHA 3E7BA 2O8AA 3ICFA 2BQ8X 2Q8UA 3DW8C 5J28A 5DNYA 5INBA 4TUGA 1SU1A 1W24A 4YKEA 2P6BA 4O4KA 4WWLA 1S70A 4OR9A 1OIEA 3H62B 4FBKA 2DXNA 1TCOA 2NXFA 3FLOA 4JA7A 1USHA 4O24A 3D03A 4XPNA 2QJCA 4V0VA 1AUIA 4MOVA 3H68A 1UTEA 4NZVA 4UT3B 4UWQA 4V0XA 1S8EA 2YEQA 3H61A 3RQZA 2USHA 1KBPA 3K7VC 1UF3A 4Q7FA 2NPPC 2AHDA 3K7WC 5HPEA 4I5NC 3EGGA 1WAO1 4MOYA 3JYFA 2NYLC 4LU9A 2O8GA 4ORBA 3HVQA 5JPFA 3LL8A 1M63A 4M0VA 3V4YA 1Z2XA 2WDFA 1OIDA 2IE3C 2BDXA 1QHWA 2CV9A 3IB8A 4H2BA 3E7AA 1G5BA 3DSDA 5JJTA 1V73A 4H1SA 3TGHA 3IVDA 4UT2A 2R17A 4H2IA 1HO5A 2JOGA 2WDEA 4G9JA 3ZTVA
chains in the Genus database with same CATH topology
3DSCA 4ORAA 4F0ZA 5EQVA 4KBPA 3QFKA 3PSOA 2NYMC 3H67A 3H64A 1U32A 3RL4A 4DHLA 1NNWA 4LTYA 3N5UA 4LACC 4IL1A 3ZU0A 2WDCA 3THOB 3EGHA 4FBWA 5GTUA 4UT3A 4TUIA 2BCDA 2QFPA 4IYPC 3FGAC 4ZVZA 3PSNA 3QFMA 4KKZA 3H60A 2Z06A 1S3LA 1Z2WA 2DXLA 2HY1A 2HYOA 1HPUA 1XZWA 3AV0A 3C5WC 4H1YP 3T1IA 1WARA 3QG5C 3H66A 4FBQA 3KBPA 3IB7A 1OI8A 3H63A 2Z1AA 4O43A 1IT6A 3RL5A 2YVTA 1HP1A 2Z72A 4DT2A 3GVEA 4B2OA 2QFRA 4HD0A 2ZOAA 4FCXA 3IVEA 1T70A 1S3NA 1QFCA 2WDDA 4ZX2A 4MP0A 2IE4C 1II7A 4JA9A 5F3WA 4J6OA 1T71A 4O5GA 4V0WA 3CK2A 4H2GA 3RL3A 2IAEC 3AUZA 2KKNA 4DSYA 2ZO9B 1JK7A 5C1VA 5JPEA 2ZBMA 3H69A 1FJMA 1S95A 4I5LC 3THNA 3QFOA 1MF8A 3C9FA 1XM7A 2XMOA 3E0JA 2GJUA 2DFJA 2A22A 4H2FA 3P71C 4ORCA 2HYPA 1S3MA 3QFNA 5B8IA 5IOHA 3E7BA 2O8AA 3ICFA 2BQ8X 2Q8UA 3DW8C 5J28A 5DNYA 5INBA 4TUGA 1SU1A 1W24A 4YKEA 2P6BA 4O4KA 4WWLA 1S70A 4OR9A 1OIEA 3H62B 4FBKA 2DXNA 1TCOA 2NXFA 3FLOA 4JA7A 1USHA 4O24A 3D03A 4XPNA 2QJCA 4V0VA 1AUIA 4MOVA 3H68A 1UTEA 4NZVA 4UT3B 4UWQA 4V0XA 1S8EA 2YEQA 3H61A 3RQZA 2USHA 1KBPA 3K7VC 1UF3A 4Q7FA 2NPPC 2AHDA 3K7WC 5HPEA 4I5NC 3EGGA 1WAO1 4MOYA 3JYFA 2NYLC 4LU9A 2O8GA 4ORBA 3HVQA 5JPFA 3LL8A 1M63A 4M0VA 3V4YA 1Z2XA 2WDFA 1OIDA 2IE3C 2BDXA 1QHWA 2CV9A 3IB8A 4H2BA 3E7AA 1G5BA 3DSDA 5JJTA 1V73A 4H1SA 3TGHA 3IVDA 4UT2A 2R17A 4H2IA 1HO5A 2JOGA 2WDEA 4G9JA 3ZTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSC A;  4ORA A;  4F0Z A;  5EQV A;  4KBP A;  3QFK A;  3PSO A;  2NYM C;  3H67 A;  3H64 A;  1U32 A;  3RL4 A;  4DHL A;  1NNW A;  4LTY A;  3N5U A;  4LAC C;  4IL1 A;  3ZU0 A;  2WDC A;  3THO B;  3EGH A;  4FBW A;  5GTU A;  4UT3 A;  4TUI A;  2BCD A;  2QFP A;  4IYP C;  3FGA C;  4ZVZ A;  3PSN A;  3QFM A;  4KKZ A;  3H60 A;  2Z06 A;  1S3L A;  1Z2W A;  2HY1 A;  2HYO A;  1HPU A;  1XZW A;  3AV0 A;  3C5W C;  4H1Y P;  3T1I A;  1WAR A;  3QG5 C;  3H66 A;  4FBQ A;  3KBP A;  3IB7 A;  1OI8 A;  3H63 A;  2Z1A A;  4O43 A;  1IT6 A;  3RL5 A;  2YVT A;  1HP1 A;  2Z72 A;  4DT2 A;  3GVE A;  4B2O A;  2QFR A;  4HD0 A;  4FCX A;  3IVE A;  1T70 A;  1S3N A;  1QFC A;  2WDD A;  4ZX2 A;  4MP0 A;  2IE4 C;  1II7 A;  4JA9 A;  5F3W A;  4J6O A;  1T71 A;  4O5G A;  4V0W A;  3CK2 A;  4H2G A;  3RL3 A;  2IAE C;  3AUZ A;  2KKN A;  4DSY A;  1JK7 A;  5C1V A;  5JPE A;  2ZBM A;  3H69 A;  1FJM A;  1S95 A;  4I5L C;  3THN A;  3QFO A;  1MF8 A;  3C9F A;  1XM7 A;  2XMO A;  2GJU A;  2DFJ A;  2A22 A;  4H2F A;  3P71 C;  4ORC A;  2HYP A;  1S3M A;  3QFN A;  5B8I A;  5IOH A;  3E7B A;  2O8A A;  3ICF A;  2BQ8 X;  2Q8U A;  3DW8 C;  5J28 A;  5DNY A;  5INB A;  4TUG A;  1SU1 A;  1W24 A;  4YKE A;  2P6B A;  4O4K A;  4WWL A;  1S70 A;  4OR9 A;  1OIE A;  3H62 B;  4FBK A;  1TCO A;  2NXF A;  4JA7 A;  1USH A;  4O24 A;  4XPN A;  2QJC A;  4V0V A;  1AUI A;  4MOV A;  3H68 A;  1UTE A;  4NZV A;  4UT3 B;  4UWQ A;  4V0X A;  1S8E A;  3H61 A;  3RQZ A;  2USH A;  1KBP A;  3K7V C;  1UF3 A;  4Q7F A;  2NPP C;  2AHD A;  3K7W C;  5HPE A;  4I5N C;  3EGG A;  1WAO 1;  4MOY A;  3JYF A;  2NYL C;  4LU9 A;  2O8G A;  4ORB A;  3HVQ A;  5JPF A;  3LL8 A;  1M63 A;  4M0V A;  3V4Y A;  1Z2X A;  2WDF A;  1OID A;  2IE3 C;  2BDX A;  1QHW A;  2CV9 A;  3IB8 A;  4H2B A;  3E7A A;  1G5B A;  3DSD A;  5JJT A;  1V73 A;  4H1S A;  3TGH A;  3IVD A;  4UT2 A;  2R17 A;  4H2I A;  1HO5 A;  2JOG A;  2WDE A;  4G9J A;  3ZTV A; 
#chains in the Genus database with same CATH topology
 3DSC A;  4ORA A;  4F0Z A;  5EQV A;  4KBP A;  3QFK A;  3PSO A;  2NYM C;  3H67 A;  3H64 A;  1U32 A;  3RL4 A;  4DHL A;  1NNW A;  4LTY A;  3N5U A;  4LAC C;  4IL1 A;  3ZU0 A;  2WDC A;  3THO B;  3EGH A;  4FBW A;  5GTU A;  4UT3 A;  4TUI A;  2BCD A;  2QFP A;  4IYP C;  3FGA C;  4ZVZ A;  3PSN A;  3QFM A;  4KKZ A;  3H60 A;  2Z06 A;  1S3L A;  1Z2W A;  2DXL A;  2HY1 A;  2HYO A;  1HPU A;  1XZW A;  3AV0 A;  3C5W C;  4H1Y P;  3T1I A;  1WAR A;  3QG5 C;  3H66 A;  4FBQ A;  3KBP A;  3IB7 A;  1OI8 A;  3H63 A;  2Z1A A;  4O43 A;  1IT6 A;  3RL5 A;  2YVT A;  1HP1 A;  2Z72 A;  4DT2 A;  3GVE A;  4B2O A;  2QFR A;  4HD0 A;  2ZOA A;  4FCX A;  3IVE A;  1T70 A;  1S3N A;  1QFC A;  2WDD A;  4ZX2 A;  4MP0 A;  2IE4 C;  1II7 A;  4JA9 A;  5F3W A;  4J6O A;  1T71 A;  4O5G A;  4V0W A;  3CK2 A;  4H2G A;  3RL3 A;  2IAE C;  3AUZ A;  2KKN A;  4DSY A;  2ZO9 B;  1JK7 A;  5C1V A;  5JPE A;  2ZBM A;  3H69 A;  1FJM A;  1S95 A;  4I5L C;  3THN A;  3QFO A;  1MF8 A;  3C9F A;  1XM7 A;  2XMO A;  3E0J A;  2GJU A;  2DFJ A;  2A22 A;  4H2F A;  3P71 C;  4ORC A;  2HYP A;  1S3M A;  3QFN A;  5B8I A;  5IOH A;  3E7B A;  2O8A A;  3ICF A;  2BQ8 X;  2Q8U A;  3DW8 C;  5J28 A;  5DNY A;  5INB A;  4TUG A;  1SU1 A;  1W24 A;  4YKE A;  2P6B A;  4O4K A;  4WWL A;  1S70 A;  4OR9 A;  1OIE A;  3H62 B;  4FBK A;  2DXN A;  1TCO A;  2NXF A;  3FLO A;  4JA7 A;  1USH A;  4O24 A;  3D03 A;  4XPN A;  2QJC A;  4V0V A;  1AUI A;  4MOV A;  3H68 A;  1UTE A;  4NZV A;  4UT3 B;  4UWQ A;  4V0X A;  1S8E A;  2YEQ A;  3H61 A;  3RQZ A;  2USH A;  1KBP A;  3K7V C;  1UF3 A;  4Q7F A;  2NPP C;  2AHD A;  3K7W C;  5HPE A;  4I5N C;  3EGG A;  1WAO 1;  4MOY A;  3JYF A;  2NYL C;  4LU9 A;  2O8G A;  4ORB A;  3HVQ A;  5JPF A;  3LL8 A;  1M63 A;  4M0V A;  3V4Y A;  1Z2X A;  2WDF A;  1OID A;  2IE3 C;  2BDX A;  1QHW A;  2CV9 A;  3IB8 A;  4H2B A;  3E7A A;  1G5B A;  3DSD A;  5JJT A;  1V73 A;  4H1S A;  3TGH A;  3IVD A;  4UT2 A;  2R17 A;  4H2I A;  1HO5 A;  2JOG A;  2WDE A;  4G9J A;  3ZTV A; 
#chains in the Genus database with same CATH homology
 3DSC A;  4ORA A;  4F0Z A;  5EQV A;  4KBP A;  3QFK A;  3PSO A;  2NYM C;  3H67 A;  3H64 A;  1U32 A;  3RL4 A;  4DHL A;  1NNW A;  4LTY A;  3N5U A;  4LAC C;  4IL1 A;  3ZU0 A;  2WDC A;  3THO B;  3EGH A;  4FBW A;  5GTU A;  4UT3 A;  4TUI A;  2BCD A;  2QFP A;  4IYP C;  3FGA C;  4ZVZ A;  3PSN A;  3QFM A;  4KKZ A;  3H60 A;  2Z06 A;  1S3L A;  1Z2W A;  2DXL A;  2HY1 A;  2HYO A;  1HPU A;  1XZW A;  3AV0 A;  3C5W C;  4H1Y P;  3T1I A;  1WAR A;  3QG5 C;  3H66 A;  4FBQ A;  3KBP A;  3IB7 A;  1OI8 A;  3H63 A;  2Z1A A;  4O43 A;  1IT6 A;  3RL5 A;  2YVT A;  1HP1 A;  2Z72 A;  4DT2 A;  3GVE A;  4B2O A;  2QFR A;  4HD0 A;  2ZOA A;  4FCX A;  3IVE A;  1T70 A;  1S3N A;  1QFC A;  2WDD A;  4ZX2 A;  4MP0 A;  2IE4 C;  1II7 A;  4JA9 A;  5F3W A;  4J6O A;  1T71 A;  4O5G A;  4V0W A;  3CK2 A;  4H2G A;  3RL3 A;  2IAE C;  3AUZ A;  2KKN A;  4DSY A;  2ZO9 B;  1JK7 A;  5C1V A;  5JPE A;  2ZBM A;  3H69 A;  1FJM A;  1S95 A;  4I5L C;  3THN A;  3QFO A;  1MF8 A;  3C9F A;  1XM7 A;  2XMO A;  3E0J A;  2GJU A;  2DFJ A;  2A22 A;  4H2F A;  3P71 C;  4ORC A;  2HYP A;  1S3M A;  3QFN A;  5B8I A;  5IOH A;  3E7B A;  2O8A A;  3ICF A;  2BQ8 X;  2Q8U A;  3DW8 C;  5J28 A;  5DNY A;  5INB A;  4TUG A;  1SU1 A;  1W24 A;  4YKE A;  2P6B A;  4O4K A;  4WWL A;  1S70 A;  4OR9 A;  1OIE A;  3H62 B;  4FBK A;  2DXN A;  1TCO A;  2NXF A;  3FLO A;  4JA7 A;  1USH A;  4O24 A;  3D03 A;  4XPN A;  2QJC A;  4V0V A;  1AUI A;  4MOV A;  3H68 A;  1UTE A;  4NZV A;  4UT3 B;  4UWQ A;  4V0X A;  1S8E A;  2YEQ A;  3H61 A;  3RQZ A;  2USH A;  1KBP A;  3K7V C;  1UF3 A;  4Q7F A;  2NPP C;  2AHD A;  3K7W C;  5HPE A;  4I5N C;  3EGG A;  1WAO 1;  4MOY A;  3JYF A;  2NYL C;  4LU9 A;  2O8G A;  4ORB A;  3HVQ A;  5JPF A;  3LL8 A;  1M63 A;  4M0V A;  3V4Y A;  1Z2X A;  2WDF A;  1OID A;  2IE3 C;  2BDX A;  1QHW A;  2CV9 A;  3IB8 A;  4H2B A;  3E7A A;  1G5B A;  3DSD A;  5JJT A;  1V73 A;  4H1S A;  3TGH A;  3IVD A;  4UT2 A;  2R17 A;  4H2I A;  1HO5 A;  2JOG A;  2WDE A;  4G9J A;  3ZTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...