5HPEA

Phosphatase domain of pp5 bound to a phosphomimetic cdc37 substrate peptide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
346
structure length
326
Chain Sequence
EYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYAWDHIEVEDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional basis of protein phosphatase 5 substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5,Hsp90 co-chaperone Cd
total genus 119
structure length 326
sequence length 346
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5hpeA00
1OIDA 4NZVA 1S3MA 3H63A 2BQ8X 4ORBA 3RL4A 1Z2WA 1JK7A 1S70A 1UF3A 4FCXA 3E7AA 3CK2A 1USHA 3H64A 2KKNA 4G9JA 4FBQA 2WDFA 1G5BA 4H2GA 5JJTA 3H61A 3QFOA 4ORCA 4TUGA 3GVEA 2NYLC 3K7WC 1HP1A 3DW8C 3RL5A 5F3WA 2O8AA 2XMOA 4H2IA 4O43A 4ORAA 1V73A 1IT6A 4UT3A 1WAO1 3H68A 5JPEA 1S3NA 1II7A 3H66A 1S3LA 4MOVA 3IB7A 2O8GA 4J6OA 4F0ZA 4HD0A 4MOYA 4OR9A 3IVEA 2HYPA 1FJMA 1HPUA 4O5GA 4H1YP 2Z72A 1QHWA 1SU1A 2WDCA 1S95A 4MP0A 3V4YA 2WDEA 2A22A 2BDXA 3H67A 2QFPA 4ZVZA 3JYFA 3C9FA 4H2FA 1M63A 3AV0A 3THOB 5JPFA 3QG5C 4DT2A 5INBA 5EQVA 4DHLA 4LTYA 4O24A 2IE4C 4V0WA 4UWQA 1XZWA 3LL8A 4YKEA 3P71C 1Z2XA 3AUZA 1HO5A 3H69A 3KBPA 2IE3C 2NXFA 3H62B 2QFRA 5HPEA 4Q7FA 2CV9A 1UTEA 3QFNA 5B8IA 1OIEA 2ZBMA 2USHA 4XPNA 3QFKA 3PSNA 3EGHA 4H2BA 3TGHA 4ZX2A 2HYOA 3ICFA 4JA7A 3T1IA 3IVDA 4V0VA 5J28A 2BCDA 2GJUA 2NPPC 2AHDA 3H60A 3HVQA 2WDDA 4O4KA 1QFCA 2NYMC 3IB8A 2R17A 1KBPA 4UT2A 5IOHA 4I5LC 2P6BA 3RL3A 3DSCA 3ZTVA 4FBWA 4DSYA 4JA9A 2YVTA 2HY1A 4KKZA 2IAEC 3K7VC 1AUIA 3ZU0A 3EGGA 1TCOA 4IL1A 3N5UA 3RQZA 4M0VA 4WWLA 1MF8A 4B2OA 1S8EA 2Z1AA 2DFJA 1NNWA 3C5WC 3QFMA 4TUIA 4IYPC 4V0XA 5C1VA 4UT3B 1T70A 2Q8UA 4LU9A 2JOGA 5DNYA 4I5NC 4FBKA 2QJCA 1WARA 1W24A 4LACC 5GTUA 4KBPA 3E7BA 1XM7A 1OI8A 1U32A 3PSOA 3FGAC 4H1SA 3THNA 1T71A 3DSDA 2Z06A
chains in the Genus database with same CATH superfamily
1OIDA 4NZVA 3FLOA 1S3MA 3H63A 2BQ8X 4ORBA 3RL4A 1Z2WA 1JK7A 1S70A 1UF3A 4FCXA 3E7AA 3CK2A 1USHA 3H64A 2KKNA 4G9JA 4FBQA 2WDFA 1G5BA 4H2GA 5JJTA 3H61A 2ZOAA 3QFOA 4ORCA 4TUGA 3GVEA 2NYLC 3K7WC 1HP1A 3DW8C 3RL5A 5F3WA 2O8AA 2XMOA 4H2IA 4O43A 4ORAA 1V73A 1IT6A 4UT3A 1WAO1 3H68A 5JPEA 1S3NA 1II7A 3H66A 1S3LA 3E0JA 3IB7A 4MOVA 2O8GA 4J6OA 4F0ZA 4HD0A 4MOYA 4OR9A 3IVEA 2HYPA 1FJMA 1HPUA 4O5GA 4H1YP 2Z72A 1QHWA 1SU1A 2WDCA 1S95A 4MP0A 3V4YA 2WDEA 2A22A 2BDXA 3H67A 2QFPA 4ZVZA 3JYFA 3C9FA 4H2FA 1M63A 3AV0A 2DXNA 3THOB 5JPFA 3QG5C 4DT2A 5INBA 5EQVA 4DHLA 4LTYA 4O24A 2IE4C 4V0WA 4UWQA 1XZWA 3LL8A 4YKEA 3P71C 1Z2XA 3AUZA 1HO5A 3H69A 3KBPA 2IE3C 2NXFA 3H62B 2QFRA 5HPEA 4Q7FA 2CV9A 1UTEA 3QFNA 5B8IA 1OIEA 2ZBMA 2USHA 4XPNA 3QFKA 3PSNA 3EGHA 4H2BA 3TGHA 4ZX2A 2HYOA 3ICFA 4JA7A 3T1IA 3IVDA 2DXLA 4V0VA 5J28A 2BCDA 2GJUA 2NPPC 2AHDA 3H60A 3HVQA 2WDDA 4O4KA 1QFCA 2NYMC 3IB8A 2R17A 1KBPA 4UT2A 5IOHA 4I5LC 2P6BA 3D03A 3RL3A 3DSCA 3ZTVA 4FBWA 4DSYA 4JA9A 2YVTA 2HY1A 4KKZA 2IAEC 3K7VC 2ZO9B 1AUIA 3ZU0A 3EGGA 1TCOA 4IL1A 3N5UA 3RQZA 4M0VA 4WWLA 1MF8A 4B2OA 1S8EA 2Z1AA 2DFJA 1NNWA 3C5WC 3QFMA 4TUIA 4IYPC 4V0XA 5C1VA 4UT3B 1T70A 2Q8UA 4LU9A 2JOGA 5DNYA 4I5NC 4FBKA 2QJCA 1WARA 1W24A 2YEQA 4LACC 5GTUA 4KBPA 3E7BA 1XM7A 1OI8A 1U32A 3PSOA 3FGAC 4H1SA 3THNA 1T71A 3DSDA 2Z06A
chains in the Genus database with same CATH topology
1OIDA 4NZVA 3FLOA 1S3MA 3H63A 2BQ8X 4ORBA 3RL4A 1Z2WA 1JK7A 1S70A 1UF3A 4FCXA 3E7AA 3CK2A 1USHA 3H64A 2KKNA 4G9JA 4FBQA 2WDFA 1G5BA 4H2GA 5JJTA 3H61A 2ZOAA 3QFOA 4ORCA 4TUGA 3GVEA 2NYLC 3K7WC 1HP1A 3DW8C 3RL5A 5F3WA 2O8AA 2XMOA 4H2IA 4O43A 4ORAA 1V73A 1IT6A 4UT3A 1WAO1 3H68A 5JPEA 1S3NA 1II7A 3H66A 1S3LA 3E0JA 3IB7A 4MOVA 2O8GA 4J6OA 4F0ZA 4HD0A 4MOYA 4OR9A 3IVEA 2HYPA 1FJMA 1HPUA 4O5GA 4H1YP 2Z72A 1QHWA 1SU1A 2WDCA 1S95A 4MP0A 3V4YA 2WDEA 2A22A 2BDXA 3H67A 2QFPA 4ZVZA 3JYFA 3C9FA 4H2FA 1M63A 3AV0A 2DXNA 3THOB 5JPFA 3QG5C 4DT2A 5INBA 5EQVA 4DHLA 4LTYA 4O24A 2IE4C 4V0WA 4UWQA 1XZWA 3LL8A 4YKEA 3P71C 1Z2XA 3AUZA 1HO5A 3H69A 3KBPA 2IE3C 2NXFA 3H62B 2QFRA 5HPEA 4Q7FA 2CV9A 1UTEA 3QFNA 5B8IA 1OIEA 2ZBMA 2USHA 4XPNA 3QFKA 3PSNA 3EGHA 4H2BA 3TGHA 4ZX2A 2HYOA 3ICFA 4JA7A 3T1IA 3IVDA 2DXLA 4V0VA 5J28A 2BCDA 2GJUA 2NPPC 2AHDA 3H60A 3HVQA 2WDDA 4O4KA 1QFCA 2NYMC 3IB8A 2R17A 1KBPA 4UT2A 5IOHA 4I5LC 2P6BA 3D03A 3RL3A 3DSCA 3ZTVA 4FBWA 4DSYA 4JA9A 2YVTA 2HY1A 4KKZA 2IAEC 3K7VC 2ZO9B 1AUIA 3ZU0A 3EGGA 1TCOA 4IL1A 3N5UA 3RQZA 4M0VA 4WWLA 1MF8A 4B2OA 1S8EA 2Z1AA 2DFJA 1NNWA 3C5WC 3QFMA 4TUIA 4IYPC 4V0XA 5C1VA 4UT3B 1T70A 2Q8UA 4LU9A 2JOGA 5DNYA 4I5NC 4FBKA 2QJCA 1WARA 1W24A 2YEQA 4LACC 5GTUA 4KBPA 3E7BA 1XM7A 1OI8A 1U32A 3PSOA 3FGAC 4H1SA 3THNA 1T71A 3DSDA 2Z06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OID A;  4NZV A;  1S3M A;  3H63 A;  2BQ8 X;  4ORB A;  3RL4 A;  1Z2W A;  1JK7 A;  1S70 A;  1UF3 A;  4FCX A;  3E7A A;  3CK2 A;  1USH A;  3H64 A;  2KKN A;  4G9J A;  4FBQ A;  2WDF A;  1G5B A;  4H2G A;  5JJT A;  3H61 A;  3QFO A;  4ORC A;  4TUG A;  3GVE A;  2NYL C;  3K7W C;  1HP1 A;  3DW8 C;  3RL5 A;  5F3W A;  2O8A A;  2XMO A;  4H2I A;  4O43 A;  4ORA A;  1V73 A;  1IT6 A;  4UT3 A;  1WAO 1;  3H68 A;  5JPE A;  1S3N A;  1II7 A;  3H66 A;  1S3L A;  4MOV A;  3IB7 A;  2O8G A;  4J6O A;  4F0Z A;  4HD0 A;  4MOY A;  4OR9 A;  3IVE A;  2HYP A;  1FJM A;  1HPU A;  4O5G A;  4H1Y P;  2Z72 A;  1QHW A;  1SU1 A;  2WDC A;  1S95 A;  4MP0 A;  3V4Y A;  2WDE A;  2A22 A;  2BDX A;  3H67 A;  2QFP A;  4ZVZ A;  3JYF A;  3C9F A;  4H2F A;  1M63 A;  3AV0 A;  3THO B;  5JPF A;  3QG5 C;  4DT2 A;  5INB A;  5EQV A;  4DHL A;  4LTY A;  4O24 A;  2IE4 C;  4V0W A;  4UWQ A;  1XZW A;  3LL8 A;  4YKE A;  3P71 C;  1Z2X A;  3AUZ A;  1HO5 A;  3H69 A;  3KBP A;  2IE3 C;  2NXF A;  3H62 B;  2QFR A;  5HPE A;  4Q7F A;  2CV9 A;  1UTE A;  3QFN A;  5B8I A;  1OIE A;  2ZBM A;  2USH A;  4XPN A;  3QFK A;  3PSN A;  3EGH A;  4H2B A;  3TGH A;  4ZX2 A;  2HYO A;  3ICF A;  4JA7 A;  3T1I A;  3IVD A;  4V0V A;  5J28 A;  2BCD A;  2GJU A;  2NPP C;  2AHD A;  3H60 A;  3HVQ A;  2WDD A;  4O4K A;  1QFC A;  2NYM C;  3IB8 A;  2R17 A;  1KBP A;  4UT2 A;  5IOH A;  4I5L C;  2P6B A;  3RL3 A;  3DSC A;  3ZTV A;  4FBW A;  4DSY A;  4JA9 A;  2YVT A;  2HY1 A;  4KKZ A;  2IAE C;  3K7V C;  1AUI A;  3ZU0 A;  3EGG A;  1TCO A;  4IL1 A;  3N5U A;  3RQZ A;  4M0V A;  4WWL A;  1MF8 A;  4B2O A;  1S8E A;  2Z1A A;  2DFJ A;  1NNW A;  3C5W C;  3QFM A;  4TUI A;  4IYP C;  4V0X A;  5C1V A;  4UT3 B;  1T70 A;  2Q8U A;  4LU9 A;  2JOG A;  5DNY A;  4I5N C;  4FBK A;  2QJC A;  1WAR A;  1W24 A;  4LAC C;  5GTU A;  4KBP A;  3E7B A;  1XM7 A;  1OI8 A;  1U32 A;  3PSO A;  3FGA C;  4H1S A;  3THN A;  1T71 A;  3DSD A;  2Z06 A; 
#chains in the Genus database with same CATH topology
 1OID A;  4NZV A;  3FLO A;  1S3M A;  3H63 A;  2BQ8 X;  4ORB A;  3RL4 A;  1Z2W A;  1JK7 A;  1S70 A;  1UF3 A;  4FCX A;  3E7A A;  3CK2 A;  1USH A;  3H64 A;  2KKN A;  4G9J A;  4FBQ A;  2WDF A;  1G5B A;  4H2G A;  5JJT A;  3H61 A;  2ZOA A;  3QFO A;  4ORC A;  4TUG A;  3GVE A;  2NYL C;  3K7W C;  1HP1 A;  3DW8 C;  3RL5 A;  5F3W A;  2O8A A;  2XMO A;  4H2I A;  4O43 A;  4ORA A;  1V73 A;  1IT6 A;  4UT3 A;  1WAO 1;  3H68 A;  5JPE A;  1S3N A;  1II7 A;  3H66 A;  1S3L A;  3E0J A;  3IB7 A;  4MOV A;  2O8G A;  4J6O A;  4F0Z A;  4HD0 A;  4MOY A;  4OR9 A;  3IVE A;  2HYP A;  1FJM A;  1HPU A;  4O5G A;  4H1Y P;  2Z72 A;  1QHW A;  1SU1 A;  2WDC A;  1S95 A;  4MP0 A;  3V4Y A;  2WDE A;  2A22 A;  2BDX A;  3H67 A;  2QFP A;  4ZVZ A;  3JYF A;  3C9F A;  4H2F A;  1M63 A;  3AV0 A;  2DXN A;  3THO B;  5JPF A;  3QG5 C;  4DT2 A;  5INB A;  5EQV A;  4DHL A;  4LTY A;  4O24 A;  2IE4 C;  4V0W A;  4UWQ A;  1XZW A;  3LL8 A;  4YKE A;  3P71 C;  1Z2X A;  3AUZ A;  1HO5 A;  3H69 A;  3KBP A;  2IE3 C;  2NXF A;  3H62 B;  2QFR A;  5HPE A;  4Q7F A;  2CV9 A;  1UTE A;  3QFN A;  5B8I A;  1OIE A;  2ZBM A;  2USH A;  4XPN A;  3QFK A;  3PSN A;  3EGH A;  4H2B A;  3TGH A;  4ZX2 A;  2HYO A;  3ICF A;  4JA7 A;  3T1I A;  3IVD A;  2DXL A;  4V0V A;  5J28 A;  2BCD A;  2GJU A;  2NPP C;  2AHD A;  3H60 A;  3HVQ A;  2WDD A;  4O4K A;  1QFC A;  2NYM C;  3IB8 A;  2R17 A;  1KBP A;  4UT2 A;  5IOH A;  4I5L C;  2P6B A;  3D03 A;  3RL3 A;  3DSC A;  3ZTV A;  4FBW A;  4DSY A;  4JA9 A;  2YVT A;  2HY1 A;  4KKZ A;  2IAE C;  3K7V C;  2ZO9 B;  1AUI A;  3ZU0 A;  3EGG A;  1TCO A;  4IL1 A;  3N5U A;  3RQZ A;  4M0V A;  4WWL A;  1MF8 A;  4B2O A;  1S8E A;  2Z1A A;  2DFJ A;  1NNW A;  3C5W C;  3QFM A;  4TUI A;  4IYP C;  4V0X A;  5C1V A;  4UT3 B;  1T70 A;  2Q8U A;  4LU9 A;  2JOG A;  5DNY A;  4I5N C;  4FBK A;  2QJC A;  1WAR A;  1W24 A;  2YEQ A;  4LAC C;  5GTU A;  4KBP A;  3E7B A;  1XM7 A;  1OI8 A;  1U32 A;  3PSO A;  3FGA C;  4H1S A;  3THN A;  1T71 A;  3DSD A;  2Z06 A; 
#chains in the Genus database with same CATH homology
 1OID A;  4NZV A;  3FLO A;  1S3M A;  3H63 A;  2BQ8 X;  4ORB A;  3RL4 A;  1Z2W A;  1JK7 A;  1S70 A;  1UF3 A;  4FCX A;  3E7A A;  3CK2 A;  1USH A;  3H64 A;  2KKN A;  4G9J A;  4FBQ A;  2WDF A;  1G5B A;  4H2G A;  5JJT A;  3H61 A;  2ZOA A;  3QFO A;  4ORC A;  4TUG A;  3GVE A;  2NYL C;  3K7W C;  1HP1 A;  3DW8 C;  3RL5 A;  5F3W A;  2O8A A;  2XMO A;  4H2I A;  4O43 A;  4ORA A;  1V73 A;  1IT6 A;  4UT3 A;  1WAO 1;  3H68 A;  5JPE A;  1S3N A;  1II7 A;  3H66 A;  1S3L A;  3E0J A;  3IB7 A;  4MOV A;  2O8G A;  4J6O A;  4F0Z A;  4HD0 A;  4MOY A;  4OR9 A;  3IVE A;  2HYP A;  1FJM A;  1HPU A;  4O5G A;  4H1Y P;  2Z72 A;  1QHW A;  1SU1 A;  2WDC A;  1S95 A;  4MP0 A;  3V4Y A;  2WDE A;  2A22 A;  2BDX A;  3H67 A;  2QFP A;  4ZVZ A;  3JYF A;  3C9F A;  4H2F A;  1M63 A;  3AV0 A;  2DXN A;  3THO B;  5JPF A;  3QG5 C;  4DT2 A;  5INB A;  5EQV A;  4DHL A;  4LTY A;  4O24 A;  2IE4 C;  4V0W A;  4UWQ A;  1XZW A;  3LL8 A;  4YKE A;  3P71 C;  1Z2X A;  3AUZ A;  1HO5 A;  3H69 A;  3KBP A;  2IE3 C;  2NXF A;  3H62 B;  2QFR A;  5HPE A;  4Q7F A;  2CV9 A;  1UTE A;  3QFN A;  5B8I A;  1OIE A;  2ZBM A;  2USH A;  4XPN A;  3QFK A;  3PSN A;  3EGH A;  4H2B A;  3TGH A;  4ZX2 A;  2HYO A;  3ICF A;  4JA7 A;  3T1I A;  3IVD A;  2DXL A;  4V0V A;  5J28 A;  2BCD A;  2GJU A;  2NPP C;  2AHD A;  3H60 A;  3HVQ A;  2WDD A;  4O4K A;  1QFC A;  2NYM C;  3IB8 A;  2R17 A;  1KBP A;  4UT2 A;  5IOH A;  4I5L C;  2P6B A;  3D03 A;  3RL3 A;  3DSC A;  3ZTV A;  4FBW A;  4DSY A;  4JA9 A;  2YVT A;  2HY1 A;  4KKZ A;  2IAE C;  3K7V C;  2ZO9 B;  1AUI A;  3ZU0 A;  3EGG A;  1TCO A;  4IL1 A;  3N5U A;  3RQZ A;  4M0V A;  4WWL A;  1MF8 A;  4B2O A;  1S8E A;  2Z1A A;  2DFJ A;  1NNW A;  3C5W C;  3QFM A;  4TUI A;  4IYP C;  4V0X A;  5C1V A;  4UT3 B;  1T70 A;  2Q8U A;  4LU9 A;  2JOG A;  5DNY A;  4I5N C;  4FBK A;  2QJC A;  1WAR A;  1W24 A;  2YEQ A;  4LAC C;  5GTU A;  4KBP A;  3E7B A;  1XM7 A;  1OI8 A;  1U32 A;  3PSO A;  3FGA C;  4H1S A;  3THN A;  1T71 A;  3DSD A;  2Z06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...