5HPFA

Crystal structure of the double mutant of pobr transcription factor inducer binding domain from acinetobacter
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
175
structure length
175
Chain Sequence
b'AHLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQQDNRVSPYGMHLGNRLPAHATSTGKVLLSVLDREVQIEWIEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGVIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVLPLLRNTANELRNLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p-hydroxybenzoate hydroxylase transcriptional activator
publication title A microbial sensor for organophosphate hydrolysis exploiting an engineered specificity switch in a transcription factor.
pubmed doi rcsb
source organism Acinetobacter baylyi str. adp1
molecule tags Transcription
total genus 44
structure length 175
sequence length 175
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hpfA00
2M7VA 5LBRA 2KOIA 2LB5A 2O9AA 3DBAA 4Q0JA 2IA2A 3R4KA 2HGVA 4ETXA 4EU0A 2QYBA 2W3FA 5HL6A 4MDZA 5AJGA 5L8MA 4DN0A 4R70A 4PAUA 4IUHA 2K31A 2B18A 2O0YA 4Y3IA 3OBFA 2VKSA 3S7PA 2O99A 4MN7A 2W3HA 2G7UA 3NOUC 3LFVA 4QPRA 2VJWA 3E98A 2W1TA 4LRXC 4O0PA 2XRNA 1TD5A 2W3GA 2Y8HA 3EEAA 5HPIA 4O01A 5DFXA 1YKDA 3KSGA 3CI6A 3D3OA 4G3WA 1TF1A 3KSFA 2KLIA 2O9BA 5TJJA 3KSHA 4ZRRA 3KSIA 5I5LA 4E04A 3TRCA 3S7OA 2O9CA 3IBJA 4MMNA 4GLQA 1YSPA 2W1RA 2W3EA 3NOPC 3K2NA 3NOTC 4G3KA 3C2WA 4LRYC 4ME4A 3W2ZA 4Y2FA 4O8GA 4Q0IA 3O5YA 4IUKA 4GW9A 4G3VA 5HPFA 2VEAA 4IJGA 5C5KA 4CQHA 4Q0HA 3G6OA 2Y79A 2XSSA 3IBRA 4Z1WA 3HCYA 2ZMFA 2LB9A 2W3DA 4Y5FA 3MQ0A 2XROA 4ETZA 3MMHA 3KO6A 3S7QA 2K2NA 2GX5A 4YOFA 4EUVA 3RFBA 5K5BA 4RQ9A 4DMZA 4BWIA 2W1TB 1ZTUA 1VHMA 2OOLA 2VZWA 1MKMA 4YNRA 3E0YA 5DFYA 3NHQA 3S7NA 3CITA 3OOVA 5HSQA 2M7UA 1F5MA 1MC0A 3MF0A 4MCWA 4FOFA 1YSQA 3VV4A 1STZA 4R6LA 3ZQ5A 3BJNA 4LRZE
chains in the Genus database with same CATH superfamily
4CPKA 2LB5A 3B3XA 1ESUA 3AGDA 4ETXA 3FG8A 3BLMA 4CLCE 3KYZA 3TE8A 3ULFA 4IUHA 5BOHA 3CWFA 5D3OA 2B95A 2VKSA 3S7PA 3P98A 4L0LA 3S22A 4CJNA 3BFEA 3WS1A 3W4OA 1J9MA 3S1YA 1G6OA 3UE1A 3U2AA 4ZTKA 4ZDXA 4O01A 4WZ5A 4I38A 1JWPA 3ZGAB 1PWDA 3O3VA 4L9EA 2EX2A 1TF1A 4S2MA 3OPRA 3LR0A 2AVXA 1LHYA 2E8IA 5I5LA 4DKIA 2Y2KA 4BQMA 4GD6A 3HREA 4P6ZM 1XFNA 3UB5P 4F3LB 4ME4A 4N1HA 1KGFA 1MPLA 1ACFA 2WKEA 1KVLA 1IYPA 2KDKA 3VMAA 2YKHA 2W3DA 5GLAA 3IH9A 1OT9A 1FCNA 4WEKA 3ITAA 5DTKA 3V3SA 4GNUA 5EM0A 4OP5A 1D7EA 3H82B 1AXBA 4Q8IA 4XXRA 4IBRA 3MKFA 4ARZB 1OTIA 3SS5A 1H8ZA 3CZDA 2X01A 4WBGA 2JN7A 4X25A 3F1OA 2H0YA 4MNRA 1TDGA 1Q2QA 2ZC5B 3JYIA 2L1MA 1EWZA 1K57C 4DXCA 3LIFA 4KZ9A 3TW8A 3MSHA 2EFXA 3PBTA 4MDZA 4QD4A 2QZ6A 4X68A 1D06A 1JTDA 4MBFA 4MBHA 4GDNA 5GHZA 1S67L 1SKOA 4LRXC 4LV1A 2JE5A 3D4FA 4BBVA 1DJBA 2W3GA 3G31A 4OKPA 2UWXA 2P7JA 1H3QA 3SH7A 4E04A 4A5RA 4R3AA 1PW8A 3E2KA 4RX2A 1IYOA 3CLOA 4KQOA 4RA7A 2CMNA 3LI9A 2PDRA 4NG2A 3V5MA 5KMWA 5DTTA 5L09A 4WZ5C 1H8YA 1K4EA 3IS2A 2Y79A 2Q9MA 2ZQ8A 4Z1WA 1K6SA 4B4ZA 2V0UA 1CJFA 2VX8A 3NDGA 4P6ZS 4D2OA 3MMHA 3S7QA 2K2NA 3CPTA 1MBLA 1VEUA 4DE3A 1OMEA 2XFTA 3MZFA 3ZVTA 3F1OB 4OOYA 3JPUA 4OLGA 2PBYA 5DJTA 5CHMA 1XGJA 1L0GA 1G6AA 2XEPA 3MFXA 2V8FA 5AQBA 4WZ4A 1LL9A 4EQIA 2MJ6A 1VETA 5EFWA 3HLDA 1Y28A 3QHYA 4R6LA 1BLCA 3BJNA 4QY6A 2KOIA 3DBAA 1HTZA 2IA2A 4WLAA 1CI8A 4LENA 4DE1A 1SKOB 5F69A 3A3EA 2PR6A 2Z6DA 2VV8A 5CGSA 2ZM8A 3SOIA 4O7DA 5DTSA 2QKPA 5F68A 4ZAMA 3ZG5A 4OQIA 1TS0A 1IYSA 2ZMAA 4MEZA 2WGVA 1IFQA 1SDEA 4ZRRA 3GRJA 2O9CA 1NLZA 3OZHA 1W7FA 1S1YA 5F1GA 4G3VA 5I94A 1O07A 4R23A 4EQ1A 3CPTB 5DF9A 1VEUB 3G6OA 3HUOA 2J9OA 4UA9A 3UDXA 2ZC7A 3JVVA 2LB9A 4Z9QA 3IHAA 1T1AA 2XROA 3OPPA 5A91A 1FILA 2GZAA 4S2LA 4DMZA 3T1RA 1VETB 1PI5A 4OQHA 3O87A 1NWZA 4KZ4A 1F5MA 4JPMA 3OPLA 1YLJA 3M6HA 2KX6A 3T50A 4FOFA 5FL3A 1W63Q 1XJ3A 1K56A 2WK0A 3AGFA 4D60A 4WF0A 5GL9A 1GHIA 1K55C 1ERMA 4PM6A 1YAXA 1GSVA 2B02A 3GQZA 3NOUC 3LFVA 4Y0UA 2VJWA 2XDMA 1QMEA 4Y7PA 1YLTA 5EVID 3VP2A 4NXFA 3IT9A 4UEYA 4QB8A 3C5AA 2R9XA 3IXHA 4K08A 1BLSA 2P9VA 1OT6A 1FIKA 1F9IA 2GJ3A 1ES2A 1XA1A 3GMWA 2ZC4B 3HLCA 3EWKA 4GS9A 4Q0HA 5E2HA 2V9AA 1E3UA 3BFFA 4JGQA 5FQJA 3C7VA 2BG1A 4DDYA 1NZUA 2PR5A 3UDIA 1F98A 1YLYA 3N6IA 2EX9A 3ZDJA 3RFBA 1EW0A 3QP4A 3CMZA 2A24B 4LV2A 4B9OA 3HLBA 3UE3A 1H5XA 2J80A 3HJKA 1S6RA 4X1MA 2HPBA 3DWZA 5CX7A 4HI4A 2DMWA 4EWFA 1N4OA 4HHDA 2QHKA 4UA7A 4X6TA 2M7VA 1ONHA 5LBRA 1W63M 2OSUA 3BQAA 3L7HA 4EU0A 1X0OA 4JXGA 1M40A 1HVBA 1G28A 4S2PA 1KGEA 2OWHA 3IF5A 1DJCA 3GV9A 1KE4A 2G7UA 1ES5A 2BLSA 4O0PA 4PM8A 1N9BA 1ERQA 5KIZA 3KSGA 5EPHA 2ZC3B 4IBXA 4KUOA 4G3WA 3KSFA 5HWVA 3A3FA 1YPRA 4R4SA 4FSFA 2PRFA 3NDEA 5FAPA 2V1AA 3K3DA 2Y4AA 5DKLA 3Q81A 5EVEA 1BTLA 5CGWA 2A2LA 3N4IA 1W8YA 3BYDA 3NBLA 4HBTA 4MN5A 4YINA 3VFFA 3T4LA 3MKEA 3IQAA 4HJ4A 2V20A 2RL3A 3FPVA 5HW3A 1KE3A 4BL3A 3ZHHA 2Y59A 5FQ9A 1P97A 3IBRA 2HJEA 2XA7M 3UPNA 3LR3A 4BBTA 5FEFA 1XJ2A 4FH2A 3DTKA 2EFUA 5GLBA 3UPOA 5CEDA 2OLUA 3QP1A 3F1NA 4CLCA 4KZ6A 2J7VA 4K0WA 4OVDA 4GZBA 3QNBA 2OWJA 1O7EA 5DFYA 3OOVA 4F3LA 3B47A 3W8KA 2A3UA 2R9WA 3A0SA 2XD5A 4S2IA 3IF6C 4R3JA 3R7WB 1BZAA 1NYMA 4K0XA 2EXBA 5HAIA 1ODVA 3RTYA 3T12B 3H82A 3H9WA 4HJ6A 1PFLA 1PYYA 2XQZA 5FATA 3DTEA 4ARZA 2X02A 3P09A 3EEAA 1K54C 2ZM0A 1Z6FA 1MXOA 2XF3A 5G4ZA 3W4QA 1HZOA 1XJ4A 4U3TA 1GSXA 5TJJA 1I2WA 3KSHA 4K91A 3ZYTA 3RH8B 4IVKA 3HLEA 2WZZA 5FQIA 3ZCZA 1YMSA 1KDWA 3NOPC 4S2KA 3W2ZA 3UE0A 5HPFA 5GHYA 4QWOA 3VFHA 2IWCA 4IEDA 4NK3A 2WGWA 5FQQA 3F1NB 4RVAA 3IHBA 2ZMFA 4CLCB 5CRFA 1A0KA 4DE2A 3KO6A 3CG5A 3UPPA 4YOFA 1CQAA 3LEQA 3KYEA 1SDNA 3PXPA 5KSCA 3VOYA 1VHMA 3VOLA 3RXWA 5M1AA 1NLYA 5HSQA 4Y0TA 5JYPA 1D1JA 2RCXA 3MF0A 2XA7S 4ZJ2A 1H0MA 1TS6A 4KZAA 2C5WB 4DF6A 1T1CA 4YFMA 2EXAA 1YLPA 2P08A 4BMWA 4KZ3A 3PBSA 3VP3A 4NXGA 4Y15A 5L07A 4N9KA 5F5YA 4IVIA 2EWVA 1CI9A 1AWIA 1K25A 2HGVA 2QJ5A 1SZVA 1JVJA 2XR0A 5HL6A 5CXWA 1NYYA 4CLCC 4HQAA 2GDNA 1PZPA 3Q07A 2ZQCA 2V2FF 1DRMA 2NUTC 3TG9A 3BWLA 1FSYA 3DTIA 3MZDA 2GNXA 4WMCA 3ISGA 4OLDA 2H0TA 5AVFA 1NXYA 4QJGA 5KZHA 2XH9A 1S66L 1GHMA 1YQSA 3N7WA 4I3AA 1MY8A 2XGNA 1SKFA 5L10A 2EX8A 4E6XA 4BENA 5M18A 2WGWB 4G3KA 5CGXA 1GSWA 4PM5A 4GJ4A 4EW7A 5DJUA 3MXQA 3V39A 3DWKA 3CUEA 1P9RA 1VM1A 3GTCA 5FQKA 4NETA 4WL9A 3EGDC 1ESIA 3F1PA 2Y2GA 5CTNA 5KSHA 2V0WA 3NULA 3MBZA 1SCWA 2Y2LA 2ZQDA 1PRQA 3QP5A 2XD1A 3CITA 2UV0E 1XFQA 1MC0A 3SH9A 3C4OA 2XK1A 3MXRA 3D9YA 3LY4A 4BLMA 5HWWA 1ZHHB 4MCWA 3VP0A 4MN6A 3M2JA 2Q0OA 4EBNA 4OPZA 4GDBA 2XLNA 1K55A 3LGOA 1TDLA 3LICA 2QYBA 1I2SA 4HESA 3FC7A 3VE4A 3BQ8A 5DF7A 3RXXA 3Q7VA 3E4OA 4FUWA 4Y3IA 1W8QA 2J3TD 4KQRA 2H5SA 2E8JA 3ZG9B 4JXSA 5J4EA 3EGXC 2XRNA 5GHXA 2EX6A 4OQGA 5HDSA 1PNEA 2J3WA 2IWDA 1XP4A 2KLIA 3RJUA 3A3DA 3EQUA 1Z09A 4R0QA 5FI6A 3LUQA 1IKIA 1Y4OA 4OOMA 2L4RA 3GVBA 4B4XA 1BLHA 5EE8A 3NOTC 3DAVA 3IXGA 3HJIA 3F1PB 2VEAA 3MR0A 5G18A 2HZ5A 4IJGA 1K38A 4EBPA 1YLZA 4OP8A 5E43A 3LR4A 3HCYA 5J7EA 2HJ9C 3T1XA 2WKRA 2GX5A 3VP1A 5K5BA 4EETB 5FA7A 5DF8A 3UO9A 4BJPA 1ZG6A 5J8XA 3OLOA 4GN2A 5F6AA 1ZG4A 3CUEC 4HH2A 1WE4A 5FI2A 1STZA 5EVLA 3Q7VB 4HNBA 4NKPA 3HUNA 3VP4A 2HDSA 2WADA 5FI7A 5E2FA 3BY8A 1XX2A 1FR1A 1JWZA 3FPWA 3NECA 1CEGA 2WKPA 2IWBA 1I5QA 2A24A 5TBMA 3MJQA 4WEJA 3C8CA 4Y17A 1DP6A 5HPIA 1G68A 1XXMA 3IX4A 2H28A 5AQAA 3D3OA 1IOUA 1OTDA 4M3KA 3PR6A 4OPYA 3TRCA 1JWVA 1L0DA 2VLGA 3MXSA 4I5SA 1T19A 4LRYC 4EEPA 1FCMA 4M4XA 4GW9A 4H6JA 3MQOA 2W0NA 1TVFA 3E2LA 3CHWP 3TSGA 4GOGA 4PM9A 1L3LA 2PU4A 1E3UD 2ZM2A 3ZG0A 1ZKJA 3G32A 1IYQA 4P87A 5EUAA 2BASA 2W1TB 3UNWA 2Z2LB 2YKFA 3UMDA 5HFOA 3T4SA 2PD7A 4PMAA 1YMXA 3IF6A 4BL2A 3IXDA 2DNSA 3VV4A 4KENB 1K0KA 4HP4A 3PTEA 1DP9A 5TBMB 1LSXA 4KG6A 4JGPA 3FYZA 1QMFA 4LPZA 3LY3A 3OBFA 2L0WA 2O99A 5A90A 5HARA 1K54A 3LIBA 1FOFA 4DE0A 2C6WB 3WS4A 2DRWA 1LLBA 1TD5A 3G30A 5DFXA 4ZJ1A 1GA9A 1OJGA 1UWPX 3BLSA 3DTMA 3ZVWA 1L0EA 1M6KA 3NCKA 1S1ZA 3ICYA 4U0XA 3R7WA 2ACGA 4H6JB 2QWSA 1YSPA 2W1RA 3PYPA 4DJ3A 2JC7A 2JKRI 3C2WA 2Y2QA 5JYOA 4IUKA 4GCZA 3T4OA 1K6RA 2OAQ1 4HIAA 3EOIA 3OCNA 3LIDA 5IS1A 1LL5A 2ZL1A 5FDSA 3IWQA 1Y54A 3HLFA 4N1XA 4R3BA 3UB7A 4F94A 1RCJA 3H7WA 4EUVA 3G35A 4WELA 3CAXA 4FTXA 3IF6B 1H8MA 3P7NA 5CERA 2W27A 5A92A 5CHUA 3E0YA 4L9GA 3VOZA 5HDCA 4WN5A 3TOIA 5IHVA 3BY9A 3UE6A 3JVUA 3SZTA 4X56A 3UB6A 4Q0JA 4LCLA 2VA0A 3PBRA 1XPBA 1KGGA 3FZCA 3BECA 4EESA 4E3LA 4MN7A 1TS7A 4BD0A 5EOOA 5E2EA 2FFYA 3G34A 3V67A 5EVIC 1UGUA 5HWTA 1KE0A 3HL9A 3MS6A 4GHIB 2PBDP 1XGIA 1V9ZA 1Q2PA 4XUZA 2ZMVA 4EBLA 5EOEA 3KSIA 3UY6A 4OPQA 1YLWA 3B42A 4MMNA 3BEBA 2W3EA 1IEMA 4KZ7A 1JNUA 3K2NA 5HZHA 2ZL1B 4LCMA 1ALQA 4Y2FA 4Q0IA 2J9PA 2OV5A 4R38A 5A93A 2FFFB 2Q9NA 3H7WB 4KZ8A 2I72A 4B93A 3HLGA 4I39A 3PBOA 3VSLA 2V1BA 1XKZA 3FKVA 1MWTA 3MQ0A 3E4PA 1FCOA 2PAVP 4JGOA 2JKTM 2FH5A 4OH0A 1BT5A 3LCEA 3BFGA 1DP8A 3C30A 4BWIA 4PM7A 5MC7A 3BRMA 1OJ5A 5HAPA 4UA6A 3OPHA 4ZBEA 2M7UA 2CC1A 1NJ4A 3N8LA 1LL8A 4KG2A 3V3RA 4QU3A 4LGWA 3IWIA 4LRZE 1J3WA 4R4RA 4I3IA 2O9AA 4P6BA 1YM1A 4LV3A 2QMIA 2HDQA 3UB8A 3SW1A 4DN0A 4R70A 1IELA 3EEHA 2HDRA 3DW0A 1NZOA 3E4QA 1P0ZA 1LSVA 2W3HA 4KQQA 3T4QA 4Y13A 4EERA 4HBUA 5GLDA 2Y2HA 3LI8A 3QNCA 5FASA 2J8YA 2ZD8A 5G4YA 1PI4A 2Y91A 2O9BA 1MWRA 4WMCD 4HH3A 3S7OA 4GD8A 1PWCA 3OCLA 5F82A 1CEFA 2WUQA 3A3JA 5F1FA 2R78A 3ZNYA 5EECA 3T4TA 2ZJ9A 1VB6A 4KQDA 4E6WA 2WGIA 1UWNX 4X55A 3A0VA 4UAAA 1PIOA 2JHEA 3GSGA 2HF6A 3WRZA 1XJ6A 4C3QA 2G2UA 5FQMA 4X1LA 2HP6A 4N92A 4RQ9A 4HY8A 3HUMA 3KYQA 2JKGA 1BYWA 3LEZA 1GHPA 1JTGA 3PAGA 3NHQA 4HJ3A 3P01A 5L2FA 1W5DA 2XFSA 4S2NC 3O88A 1YSQA 3T1SA 4LLOB 1EI5A 1WA9A 3HLWA 3G4PA 2Y2JA 4II7A 1BULA 5J3WA 3ZNTA 3PBQA 4X69A 2Y2MA 1E4DA 3C7UA 5DKKA 5M19A 3S4XA 3L9KA 2ZQAA 2PHYA 3K3CA 4QPRA 1KOUA 1PZOA 4EUZA 2FZ0A 2WKIA 3UDFA 4HP9A 1WYCA 2Y8HA 3MZEA 1YKDA 4S2JA 1MKIA 3SS3A 2M1CA 4RYEA 5U47A 3U4LP 1SHVA 2JCHA 3WRTA 5AQ9A 3T4JA 2HP5A 3ZFZA 2Y2NA 4KZBA 1LSWA 1MWUA 2INWA 4BBUA 3NC8A 4R1GA 1G5UA 3Q7ZA 3V50A 4KG5A 1OPXA 4JXWA 3FV7A 5EM1A 4X53A 4E3MA 3LYXA 3W4PA 3BFDA 3SS4A 5C5KA 2VGLM 1ZC2A 3BW6A 3D72A 4OONA 4I3JA 4Y5FA 5TR7A 3PHYA 2PU2A 2WZXA 4LV0A 3IH8A 3M6BA 1LT0A 5F83A 4P85A 1NY0A 1RGZA 4FD8A 4FH4A 2ZOIA 1BUEA 1GA0A 4NXEA 1S0WA 4GB7A 4E3IA 3T4KA 3GECA 2WKQA 3CJMA 5FEGA 4JF6A 3NJAA 4UQIM 2P04A 1ES4A 3IXBA 3QP2A 5DVAA 1V9YA 1LI0A 2WAEA 3ZG7B 4U0TA 1S4SA 5HD5A 2W3FA 4DXBA 5L8MA 4ID4A 1TS8A 1CF0A 4Y0OA 4PAUA 3NI9A 4JKTA 1IKGA 4PKYA 4S2OA 3IS2B 2W1TA 3AGEA 2HP9A 2JBFA 5CHJA 2VK3A 3Q1FA 3ZG8B 3WS2A 3G2YA 5FAQA 4OPRA 5GLCA 4JLFA 4RX3A 2ZBBA 1K56D 1N9LA 4FCFA 1KDSA 1W79A 4LFUA 2VV6A 2A49A 5TFQA 3NY4A 2EA9A 2Y2IA 3PBNA 4NEED 1NRFA 3IBJA 5CECA 3C38A 2HV1A 1P9WA 5TGFA 5HAQA 2PYPA 4ZJ3A 3O5YA 1MZUA 4IHQA 4DRTA 2BTFP 4WM9A 3OC2A 2VGJA 5FSRA 4UHUA 4OOLA 3BM6A 3EQVA 2G2WA 2P74A 2PT7A 4P0MA 2EWWA 1RP5A 1RGYA 2JKFA 4C75A 1YT4A 2WYXA 2Y2PA 4WUJA 1ZTUA 3FKWA 4YNRA 4C6YA 2VGLS 3UB9A 1VQQA 1KVMA 1K4FA 3WS5A 4B88A 1LI9A 1T1BA 3ZQ5A 3PAEA 4KUKA 3IWOA 1GCEA 3MFDA 3WWXA 4DDSA 1PWGA 2ZOHA 1FSWA 1CK3A 4NXBA 4GKUA 3A3IA 3G2ZA 5AJGA 2J3TC 2K31A 1HLUP 2O0YA 5EVIA 2QJ7A 1HD8A 1T18A 4UQIS 3E98A 1C3BA 3VSKA 4E3NA 3LO7A 2ZC6B 4N9LA 2I9VA 1OTAA 3LIEA 4MBKA 1EROA 1WYBA 2X71A 2QPNA 2Y55A 1DY6A 2OAP1 3HBRA 1TEMA 4O8GA 3UMEA 1MWSA 4ESPA 4QY5A 4WYYA 2HDUA 1S4RA 4CQHA 4KZ5A 2XSSA 2ZQ7A 1NRJA 4DJ2A 4QHCA 5IU1A 4GHIA 5FAOA 4ETZA 4OQ0A 1XA7A 5EV0A 4E3KA 4JF4A 5HD3A 1FR6A 2K7SA 4XT2A 4L9FA 2OOLA 2VZWA 1MKMA 2ZLYA 3S7NA 2WAFA 1E25A 3B33A 2Y2OA 1L2SA 2ZQ9A 2V1ZA 3VE3A 3GR2A 3O86A 4PHTA 3ITBA 2OLVA 5EVIB 1N9NA 2NUPC 2P9VB 2WKHA 3WS0A 3R4KA 3QP6A 3KX0X 2D02A 5FDHA 4E3OA 3I7JA 2JKRM 1OTEA 4EV4A 5HDDA 3GDIA 2B18A 4E3JA 5CEBA 4CLCD 5HX9A 4GS9B 5CTMA 3M2KA 2PYRA 4H8RA 3UN7A 3CI6A 3IX3A 2VV7A 2Z6CA 3TJZC 4EEUA 4PPRA 4YWZA 5AVEA 4GLQA 2Z2MB 1ES3A 3HVFA 3N8SA 4JF5A 3LR5A 3IX8A 4JXVA 5E2GA 3MQQA 2PD8A 4JBFA 3LIAA 3FWLA 5HL1A 1ONGA 3T1QB 3A0RA 4PKYG 5AQ7A 1FQGA 4XUXA 2H10A 1PW1A 1BLPA 5IT5A 4EXOA 4XT2B 3NIAA 4MLLA 2V8CA 1K57A 1BSGA 1L0FA 1F2KA 3Q82A 4JGRA 2DCFA 1N9OA 2D01A 2JKTI 1DJAA 4HEFA 4BD1A 5A8BA 2B5RA 4S2NA 2VGKA 3QP8A 3C4PA 4HOIA 1OTBA 3BFCA 1U60A 4AFIA 3N8RA 3SH8A
chains in the Genus database with same CATH topology
2M7VA 5LBRA 1W63M 3BQAA 4II7A 5J3WA 2LB5A 3BY8A 4ETXA 3FG8A 4EU0A 4CLCE 3KYZA 3PBQA 3TE8A 1X0OA 3FPWA 1G28A 3ULFA 4IUHA 5DKKA 3CWFA 2OWHA 2WKPA 2VKSA 3S7PA 2PHYA 2G7UA 3K3CA 4L0LA 4QPRA 2A24A 5TBMA 1KOUA 3MJQA 2FZ0A 4WEJA 3C8CA 4O0PA 1G6OA 4HP9A 3U2AA 1DP6A 2Y8HA 5HPIA 5KIZA 4O01A 4I38A 1YKDA 3KSGA 2H28A 2M1CA 4KUOA 3D3OA 4G3WA 4L9EA 1IOUA 1OTDA 1TF1A 3KSFA 3PR6A 3LR0A 5HWVA 3T4JA 4FSFA 5I5LA 3TRCA 2V1AA 1LSWA 3K3DA 2VLGA 5DKLA 4P6ZM 2INWA 4BBUA 4I5SA 1XFNA 1T19A 2A2LA 4F3LB 4MN5A 3T4LA 4LRYC 4EEPA 4ME4A 4M4XA 1OPXA 4HJ4A 4GW9A 3FPVA 3LYXA 4H6JA 3MQOA 5C5KA 2KDKA 2W0NA 2VGLM 1P97A 3BW6A 3D72A 3IBRA 2HJEA 2XA7M 2YKHA 3LR3A 4BBTA 4I3JA 2W3DA 4Y5FA 3PHYA 1OT9A 4WEKA 1XJ2A 1LT0A 1D7EA 3F1NA 3H82B 2BASA 2ZOIA 4CLCA 2W1TB 4NXEA 2OWJA 2YKFA 4ARZB 1OTIA 3UMDA 3T4KA 5DFYA 3OOVA 3GECA 2WKQA 3T4SA 2JN7A 4F3LA 3F1OA 2PD7A 3B47A 3NJAA 3A0SA 4UQIM 3VV4A 2P04A 2L1MA 4HP4A 1V9YA 3R7WB 1DP9A 5TBMB 3LIFA 1LSXA 1S4SA 5HD5A 4JGPA 3TW8A 2W3FA 1ODVA 3PBTA 4MDZA 5L8MA 1TS8A 1D06A 4LPZA 4PAUA 3RTYA 3OBFA 2L0WA 2O99A 3H82A 1S67L 3H9WA 4HJ6A 4PKYA 3IS2B 2W1TA 4LRXC 3LIBA 4ARZA 4BBVA 1TD5A 2W3GA 3EEAA 5DFXA 1OJGA 1UWPX 5G4ZA 2P7JA 1H3QA 1XJ4A 2ZBBA 1GSXA 1N9LA 1S1ZA 3ICYA 3KSHA 5TJJA 2VV6A 3ZYTA 2EA9A 4E04A 3RH8B 3R7WA 3PBNA 4NEED 3IBJA 4H6JB 2QWSA 4R3AA 1YSPA 2W1RA 3PYPA 4DJ3A 2JKRI 3C38A 3NOPC 2HV1A 1P9WA 2PYPA 3C2WA 3CLOA 4KQOA 3W2ZA 3O5YA 4IUKA 4GCZA 1MZUA 2CMNA 5HPFA 3LI9A 3T4OA 2PDRA 4IHQA 2OAQ1 4HIAA 3EOIA 3OC2A 3OCNA 3LIDA 3IS2A 4OOLA 5IS1A 2Y79A 3EQVA 3F1NB 4Z1WA 2ZMFA 4CLCB 2V0UA 2PT7A 2VX8A 4P6ZS 3MMHA 3UB7A 3KO6A 3S7QA 2K2NA 2EWWA 3H7WA 4YOFA 4EUVA 4WELA 3CAXA 3F1OB 3PXPA 4WUJA 1H8MA 3P7NA 2W27A 1ZTUA 1VHMA 5DJTA 3VOLA 4YNRA 3E0YA 1NLYA 2VGLS 4L9GA 3UB9A 5HSQA 5HDCA 3MF0A 2XA7S 3MFXA 1TS6A 4WN5A 1T1CA 2MJ6A 2P08A 5EFWA 1T1BA 1Y28A 4R6LA 4BMWA 3BY9A 3ZQ5A 3BJNA 4KUKA 3PBSA 3JVUA 3UE6A 4NXGA 5F5YA 3UB6A 2EWVA 2KOIA 2VA0A 3DBAA 3PBRA 2IA2A 4Q0JA 4WLAA 2HGVA 2ZOHA 2QJ5A 4NXBA 5HL6A 5F69A 5AJGA 2J3TC 4EESA 4CLCC 4HQAA 2K31A 2O0YA 2PR6A 2QJ7A 2Z6DA 2VV8A 4MN7A 1TS7A 1T18A 1DRMA 4UQIS 3V67A 3E98A 2NUTC 3BWLA 1UGUA 5HWTA 4GHIB 2QKPA 2GNXA 2I9VA 5F68A 1V9ZA 5AVFA 1TS0A 1OTAA 3LIEA 2ZMVA 1IFQA 1S66L 4I3AA 4ZRRA 3KSIA 2OAP1 3B42A 2O9CA 4MMNA 2W3EA 1JNUA 1NLZA 3K2NA 5HZHA 4G3KA 4Y2FA 4O8GA 4Q0IA 1GSWA 3UMEA 4GJ4A 1S1YA 4EW7A 4G3VA 5DJUA 4R38A 3MXQA 4EQ1A 5DF9A 1S4RA 4CQHA 3H7WB 3G6OA 4B93A 3CUEA 1P9RA 2XSSA 3PBOA 4I39A 1NRJA 2V1BA 4DJ2A 3JVVA 2LB9A 4WL9A 5IU1A 3EGDC 3MQ0A 3F1PA 4GHIA 1T1AA 2XROA 4ETZA 3E4PA 5KSHA 2GZAA 2V0WA 4JGOA 2JKTM 2FH5A 5HD3A 4DMZA 1DP8A 3C30A 4BWIA 2K7SA 5MC7A 4XT2A 4L9FA 2OOLA 1NWZA 1MKMA 1OJ5A 2VZWA 3S7NA 3CITA 2M7UA 1XFQA 1F5MA 1MC0A 3B33A 5HWWA 1ZHHB 2KX6A 3T50A 3VE3A 1LL8A 4MCWA 4MN6A 4FOFA 4PHTA 5FL3A 1W63Q 4LRZE 1XJ3A 1N9NA 2NUPC 4I3IA 2O9AA 3R4KA 3KX0X 2D02A 3LICA 2QYBA 4WF0A 3VE4A 3FC7A 2JKRM 3UB8A 1OTEA 3BQ8A 4DN0A 3SW1A 5HDDA 4R70A 3GDIA 2B18A 3E4OA 3EEHA 4Y3IA 2J3TD 3E4QA 1YAXA 1GSVA 1P0ZA 4CLCD 1LSVA 2B02A 2W3HA 4GS9B 3NOUC 3LFVA 3T4QA 2VJWA 4EERA 5J4EA 3EGXC 2PYRA 2XRNA 3LI8A 4NXFA 5HDSA 3CI6A 2J3WA 4UEYA 2VV7A 5G4YA 2Z6CA 2KLIA 3TJZC 3EQUA 2O9BA 4K08A 4EEUA 3LUQA 4YWZA 4HH3A 5AVEA 3S7OA 3OCLA 1OT6A 4GLQA 4OOMA 2L4RA 3LR5A 1F9IA 2R78A 3MQQA 3NOTC 2PD8A 3T4TA 1VB6A 4KQDA 2GJ3A 3HJIA 3F1PB 3LIAA 2VEAA 3MR0A 3A0RA 1UWNX 4IJGA 4PKYG 3EWKA 4GS9A 4Q0HA 3A0VA 2V9AA 3LR4A 4JGQA 2JHEA 3HCYA 2HF6A 5J7EA 1XJ6A 5IT5A 2PR5A 4EXOA 4XT2B 2HJ9C 1F98A 2WKRA 2GX5A 3RFBA 1EW0A 5K5BA 4RQ9A 4EETB 4HY8A 2A24B 4B9OA 3KYQA 4JGRA 1BYWA 4BJPA 3UE3A 1N9OA 2D01A 3NHQA 4HJ3A 3OLOA 2JKTI 3P01A 2J80A 3HJKA 5A8BA 5CX7A 4HI4A 2DMWA 5F6AA 4HHDA 3CUEC 4HH2A 4HOIA 1OTBA 1YSQA 2QHKA 4AFIA 1STZA 4LLOB 4HNBA 4NKPA 1WA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7V A;  5LBR A;  2KOI A;  2LB5 A;  2O9A A;  3DBA A;  4Q0J A;  2IA2 A;  3R4K A;  2HGV A;  4ETX A;  4EU0 A;  2QYB A;  2W3F A;  5HL6 A;  4MDZ A;  5AJG A;  5L8M A;  4DN0 A;  4R70 A;  4PAU A;  4IUH A;  2K31 A;  2B18 A;  2O0Y A;  4Y3I A;  3OBF A;  2VKS A;  3S7P A;  2O99 A;  4MN7 A;  2W3H A;  2G7U A;  3NOU C;  3LFV A;  4QPR A;  2VJW A;  3E98 A;  2W1T A;  4LRX C;  4O0P A;  2XRN A;  1TD5 A;  2W3G A;  2Y8H A;  3EEA A;  5HPI A;  4O01 A;  5DFX A;  1YKD A;  3KSG A;  3CI6 A;  3D3O A;  4G3W A;  1TF1 A;  3KSF A;  2KLI A;  2O9B A;  5TJJ A;  3KSH A;  4ZRR A;  3KSI A;  5I5L A;  4E04 A;  3TRC A;  3S7O A;  2O9C A;  3IBJ A;  4MMN A;  4GLQ A;  1YSP A;  2W1R A;  2W3E A;  3NOP C;  3K2N A;  3NOT C;  4G3K A;  3C2W A;  4LRY C;  4ME4 A;  3W2Z A;  4Y2F A;  4O8G A;  4Q0I A;  3O5Y A;  4IUK A;  4GW9 A;  4G3V A;  5HPF A;  2VEA A;  4IJG A;  5C5K A;  4CQH A;  4Q0H A;  3G6O A;  2Y79 A;  2XSS A;  3IBR A;  4Z1W A;  3HCY A;  2ZMF A;  2LB9 A;  2W3D A;  4Y5F A;  3MQ0 A;  2XRO A;  4ETZ A;  3MMH A;  3KO6 A;  3S7Q A;  2K2N A;  2GX5 A;  4YOF A;  4EUV A;  3RFB A;  5K5B A;  4RQ9 A;  4DMZ A;  4BWI A;  2W1T B;  1ZTU A;  1VHM A;  2OOL A;  2VZW A;  1MKM A;  4YNR A;  3E0Y A;  5DFY A;  3NHQ A;  3S7N A;  3CIT A;  3OOV A;  5HSQ A;  2M7U A;  1F5M A;  1MC0 A;  3MF0 A;  4MCW A;  4FOF A;  1YSQ A;  3VV4 A;  1STZ A;  4R6L A;  3ZQ5 A;  3BJN A;  4LRZ E; 
#chains in the Genus database with same CATH topology
 4CPK A;  2LB5 A;  3B3X A;  1ESU A;  3AGD A;  4ETX A;  3FG8 A;  3BLM A;  4CLC E;  3KYZ A;  3TE8 A;  3ULF A;  4IUH A;  5BOH A;  3CWF A;  5D3O A;  2B95 A;  2VKS A;  3S7P A;  3P98 A;  4L0L A;  3S22 A;  4CJN A;  3BFE A;  3WS1 A;  3W4O A;  1J9M A;  3S1Y A;  1G6O A;  3UE1 A;  3U2A A;  4ZTK A;  4ZDX A;  4O01 A;  4WZ5 A;  4I38 A;  1JWP A;  3ZGA B;  1PWD A;  3O3V A;  4L9E A;  2EX2 A;  1TF1 A;  4S2M A;  3OPR A;  3LR0 A;  2AVX A;  1LHY A;  2E8I A;  5I5L A;  4DKI A;  2Y2K A;  4BQM A;  4GD6 A;  3HRE A;  4P6Z M;  1XFN A;  3UB5 P;  4F3L B;  4ME4 A;  4N1H A;  1KGF A;  1MPL A;  1ACF A;  2WKE A;  1KVL A;  1IYP A;  2KDK A;  3VMA A;  2YKH A;  2W3D A;  5GLA A;  3IH9 A;  1OT9 A;  1FCN A;  4WEK A;  3ITA A;  5DTK A;  3V3S A;  4GNU A;  5EM0 A;  4OP5 A;  1D7E A;  3H82 B;  1AXB A;  4Q8I A;  4XXR A;  4IBR A;  3MKF A;  4ARZ B;  1OTI A;  3SS5 A;  1H8Z A;  3CZD A;  2X01 A;  4WBG A;  2JN7 A;  4X25 A;  3F1O A;  2H0Y A;  4MNR A;  1TDG A;  1Q2Q A;  2ZC5 B;  3JYI A;  2L1M A;  1EWZ A;  1K57 C;  4DXC A;  3LIF A;  4KZ9 A;  3TW8 A;  3MSH A;  2EFX A;  3PBT A;  4MDZ A;  4QD4 A;  2QZ6 A;  4X68 A;  1D06 A;  1JTD A;  4MBF A;  4MBH A;  4GDN A;  5GHZ A;  1S67 L;  1SKO A;  4LRX C;  4LV1 A;  2JE5 A;  3D4F A;  4BBV A;  1DJB A;  2W3G A;  3G31 A;  4OKP A;  2UWX A;  2P7J A;  1H3Q A;  3SH7 A;  4E04 A;  4A5R A;  4R3A A;  1PW8 A;  3E2K A;  4RX2 A;  1IYO A;  3CLO A;  4KQO A;  4RA7 A;  2CMN A;  3LI9 A;  2PDR A;  4NG2 A;  3V5M A;  5KMW A;  5DTT A;  5L09 A;  4WZ5 C;  1H8Y A;  1K4E A;  3IS2 A;  2Y79 A;  2Q9M A;  2ZQ8 A;  4Z1W A;  1K6S A;  4B4Z A;  2V0U A;  1CJF A;  2VX8 A;  3NDG A;  4P6Z S;  4D2O A;  3MMH A;  3S7Q A;  2K2N A;  3CPT A;  1MBL A;  1VEU A;  4DE3 A;  1OME A;  2XFT A;  3MZF A;  3ZVT A;  3F1O B;  4OOY A;  3JPU A;  4OLG A;  2PBY A;  5DJT A;  5CHM A;  1XGJ A;  1L0G A;  1G6A A;  2XEP A;  3MFX A;  2V8F A;  5AQB A;  4WZ4 A;  1LL9 A;  4EQI A;  2MJ6 A;  1VET A;  5EFW A;  3HLD A;  1Y28 A;  3QHY A;  4R6L A;  1BLC A;  3BJN A;  4QY6 A;  2KOI A;  3DBA A;  1HTZ A;  2IA2 A;  4WLA A;  1CI8 A;  4LEN A;  4DE1 A;  1SKO B;  5F69 A;  3A3E A;  2PR6 A;  2Z6D A;  2VV8 A;  5CGS A;  2ZM8 A;  3SOI A;  4O7D A;  5DTS A;  2QKP A;  5F68 A;  4ZAM A;  3ZG5 A;  4OQI A;  1TS0 A;  1IYS A;  2ZMA A;  4MEZ A;  2WGV A;  1IFQ A;  1SDE A;  4ZRR A;  3GRJ A;  2O9C A;  1NLZ A;  3OZH A;  1W7F A;  1S1Y A;  5F1G A;  4G3V A;  5I94 A;  1O07 A;  4R23 A;  4EQ1 A;  3CPT B;  5DF9 A;  1VEU B;  3G6O A;  3HUO A;  2J9O A;  4UA9 A;  3UDX A;  2ZC7 A;  3JVV A;  2LB9 A;  4Z9Q A;  3IHA A;  1T1A A;  2XRO A;  3OPP A;  5A91 A;  1FIL A;  2GZA A;  4S2L A;  4DMZ A;  3T1R A;  1VET B;  1PI5 A;  4OQH A;  3O87 A;  1NWZ A;  4KZ4 A;  1F5M A;  4JPM A;  3OPL A;  1YLJ A;  3M6H A;  2KX6 A;  3T50 A;  4FOF A;  5FL3 A;  1W63 Q;  1XJ3 A;  1K56 A;  2WK0 A;  3AGF A;  4D60 A;  4WF0 A;  5GL9 A;  1GHI A;  1K55 C;  1ERM A;  4PM6 A;  1YAX A;  1GSV A;  2B02 A;  3GQZ A;  3NOU C;  3LFV A;  4Y0U A;  2VJW A;  2XDM A;  1QME A;  4Y7P A;  1YLT A;  5EVI D;  3VP2 A;  4NXF A;  3IT9 A;  4UEY A;  4QB8 A;  3C5A A;  2R9X A;  3IXH A;  4K08 A;  1BLS A;  2P9V A;  1OT6 A;  1FIK A;  1F9I A;  2GJ3 A;  1ES2 A;  1XA1 A;  3GMW A;  2ZC4 B;  3HLC A;  3EWK A;  4GS9 A;  4Q0H A;  5E2H A;  2V9A A;  1E3U A;  3BFF A;  4JGQ A;  5FQJ A;  3C7V A;  2BG1 A;  4DDY A;  1NZU A;  2PR5 A;  3UDI A;  1F98 A;  1YLY A;  3N6I A;  2EX9 A;  3ZDJ A;  3RFB A;  1EW0 A;  3QP4 A;  3CMZ A;  2A24 B;  4LV2 A;  4B9O A;  3HLB A;  3UE3 A;  1H5X A;  2J80 A;  3HJK A;  1S6R A;  4X1M A;  2HPB A;  3DWZ A;  5CX7 A;  4HI4 A;  2DMW A;  4EWF A;  1N4O A;  4HHD A;  2QHK A;  4UA7 A;  4X6T A;  2M7V A;  1ONH A;  5LBR A;  1W63 M;  2OSU A;  3BQA A;  3L7H A;  4EU0 A;  1X0O A;  4JXG A;  1M40 A;  1HVB A;  1G28 A;  4S2P A;  1KGE A;  2OWH A;  3IF5 A;  1DJC A;  3GV9 A;  1KE4 A;  2G7U A;  1ES5 A;  2BLS A;  4O0P A;  4PM8 A;  1N9B A;  1ERQ A;  5KIZ A;  3KSG A;  5EPH A;  2ZC3 B;  4IBX A;  4KUO A;  4G3W A;  3KSF A;  5HWV A;  3A3F A;  1YPR A;  4R4S A;  4FSF A;  2PRF A;  3NDE A;  5FAP A;  2V1A A;  3K3D A;  2Y4A A;  5DKL A;  3Q81 A;  5EVE A;  1BTL A;  5CGW A;  2A2L A;  3N4I A;  1W8Y A;  3BYD A;  3NBL A;  4HBT A;  4MN5 A;  4YIN A;  3VFF A;  3T4L A;  3MKE A;  3IQA A;  4HJ4 A;  2V20 A;  2RL3 A;  3FPV A;  5HW3 A;  1KE3 A;  4BL3 A;  3ZHH A;  2Y59 A;  5FQ9 A;  1P97 A;  3IBR A;  2HJE A;  2XA7 M;  3UPN A;  3LR3 A;  4BBT A;  5FEF A;  1XJ2 A;  4FH2 A;  3DTK A;  2EFU A;  5GLB A;  3UPO A;  5CED A;  2OLU A;  3QP1 A;  3F1N A;  4CLC A;  4KZ6 A;  2J7V A;  4K0W A;  4OVD A;  4GZB A;  3QNB A;  2OWJ A;  1O7E A;  5DFY A;  3OOV A;  4F3L A;  3B47 A;  3W8K A;  2A3U A;  2R9W A;  3A0S A;  2XD5 A;  4S2I A;  3IF6 C;  4R3J A;  3R7W B;  1BZA A;  1NYM A;  4K0X A;  2EXB A;  5HAI A;  1ODV A;  3RTY A;  3T12 B;  3H82 A;  3H9W A;  4HJ6 A;  1PFL A;  1PYY A;  2XQZ A;  5FAT A;  3DTE A;  4ARZ A;  2X02 A;  3P09 A;  3EEA A;  1K54 C;  2ZM0 A;  1Z6F A;  1MXO A;  2XF3 A;  5G4Z A;  3W4Q A;  1HZO A;  1XJ4 A;  4U3T A;  1GSX A;  5TJJ A;  1I2W A;  3KSH A;  4K91 A;  3ZYT A;  3RH8 B;  4IVK A;  3HLE A;  2WZZ A;  5FQI A;  3ZCZ A;  1YMS A;  1KDW A;  3NOP C;  4S2K A;  3W2Z A;  3UE0 A;  5HPF A;  5GHY A;  4QWO A;  3VFH A;  2IWC A;  4IED A;  4NK3 A;  2WGW A;  5FQQ A;  3F1N B;  4RVA A;  3IHB A;  2ZMF A;  4CLC B;  5CRF A;  1A0K A;  4DE2 A;  3KO6 A;  3CG5 A;  3UPP A;  4YOF A;  1CQA A;  3LEQ A;  3KYE A;  1SDN A;  3PXP A;  5KSC A;  3VOY A;  1VHM A;  3VOL A;  3RXW A;  5M1A A;  1NLY A;  5HSQ A;  4Y0T A;  5JYP A;  1D1J A;  2RCX A;  3MF0 A;  2XA7 S;  4ZJ2 A;  1H0M A;  1TS6 A;  4KZA A;  2C5W B;  4DF6 A;  1T1C A;  4YFM A;  2EXA A;  1YLP A;  2P08 A;  4BMW A;  4KZ3 A;  3PBS A;  3VP3 A;  4NXG A;  4Y15 A;  5L07 A;  4N9K A;  5F5Y A;  4IVI A;  2EWV A;  1CI9 A;  1AWI A;  1K25 A;  2HGV A;  2QJ5 A;  1SZV A;  1JVJ A;  2XR0 A;  5HL6 A;  5CXW A;  1NYY A;  4CLC C;  4HQA A;  2GDN A;  1PZP A;  3Q07 A;  2ZQC A;  2V2F F;  1DRM A;  2NUT C;  3TG9 A;  3BWL A;  1FSY A;  3DTI A;  3MZD A;  2GNX A;  4WMC A;  3ISG A;  4OLD A;  2H0T A;  5AVF A;  1NXY A;  4QJG A;  5KZH A;  2XH9 A;  1S66 L;  1GHM A;  1YQS A;  3N7W A;  4I3A A;  1MY8 A;  2XGN A;  1SKF A;  5L10 A;  2EX8 A;  4E6X A;  4BEN A;  5M18 A;  2WGW B;  4G3K A;  5CGX A;  1GSW A;  4PM5 A;  4GJ4 A;  4EW7 A;  5DJU A;  3MXQ A;  3V39 A;  3DWK A;  3CUE A;  1P9R A;  1VM1 A;  3GTC A;  5FQK A;  4NET A;  4WL9 A;  3EGD C;  1ESI A;  3F1P A;  2Y2G A;  5CTN A;  5KSH A;  2V0W A;  3NUL A;  3MBZ A;  1SCW A;  2Y2L A;  2ZQD A;  1PRQ A;  3QP5 A;  2XD1 A;  3CIT A;  2UV0 E;  1XFQ A;  1MC0 A;  3SH9 A;  3C4O A;  2XK1 A;  3MXR A;  3D9Y A;  3LY4 A;  4BLM A;  5HWW A;  1ZHH B;  4MCW A;  3VP0 A;  4MN6 A;  3M2J A;  2Q0O A;  4EBN A;  4OPZ A;  4GDB A;  2XLN A;  1K55 A;  3LGO A;  1TDL A;  3LIC A;  2QYB A;  1I2S A;  4HES A;  3FC7 A;  3VE4 A;  3BQ8 A;  5DF7 A;  3RXX A;  3Q7V A;  3E4O A;  4FUW A;  4Y3I A;  1W8Q A;  2J3T D;  4KQR A;  2H5S A;  2E8J A;  3ZG9 B;  4JXS A;  5J4E A;  3EGX C;  2XRN A;  5GHX A;  2EX6 A;  4OQG A;  5HDS A;  1PNE A;  2J3W A;  2IWD A;  1XP4 A;  2KLI A;  3RJU A;  3A3D A;  3EQU A;  1Z09 A;  4R0Q A;  5FI6 A;  3LUQ A;  1IKI A;  1Y4O A;  4OOM A;  2L4R A;  3GVB A;  4B4X A;  1BLH A;  5EE8 A;  3NOT C;  3DAV A;  3IXG A;  3HJI A;  3F1P B;  2VEA A;  3MR0 A;  5G18 A;  2HZ5 A;  4IJG A;  1K38 A;  4EBP A;  1YLZ A;  4OP8 A;  5E43 A;  3LR4 A;  3HCY A;  5J7E A;  2HJ9 C;  3T1X A;  2WKR A;  2GX5 A;  3VP1 A;  5K5B A;  4EET B;  5FA7 A;  5DF8 A;  3UO9 A;  4BJP A;  1ZG6 A;  5J8X A;  3OLO A;  4GN2 A;  5F6A A;  1ZG4 A;  3CUE C;  4HH2 A;  1WE4 A;  5FI2 A;  1STZ A;  5EVL A;  3Q7V B;  4HNB A;  4NKP A;  3HUN A;  3VP4 A;  2HDS A;  2WAD A;  5FI7 A;  5E2F A;  3BY8 A;  1XX2 A;  1FR1 A;  1JWZ A;  3FPW A;  3NEC A;  1CEG A;  2WKP A;  2IWB A;  1I5Q A;  2A24 A;  5TBM A;  3MJQ A;  4WEJ A;  3C8C A;  4Y17 A;  1DP6 A;  5HPI A;  1G68 A;  1XXM A;  3IX4 A;  2H28 A;  5AQA A;  3D3O A;  1IOU A;  1OTD A;  4M3K A;  3PR6 A;  4OPY A;  3TRC A;  1JWV A;  1L0D A;  2VLG A;  3MXS A;  4I5S A;  1T19 A;  4LRY C;  4EEP A;  1FCM A;  4M4X A;  4GW9 A;  4H6J A;  3MQO A;  2W0N A;  1TVF A;  3E2L A;  3CHW P;  3TSG A;  4GOG A;  4PM9 A;  1L3L A;  2PU4 A;  1E3U D;  2ZM2 A;  3ZG0 A;  1ZKJ A;  3G32 A;  1IYQ A;  4P87 A;  5EUA A;  2BAS A;  2W1T B;  3UNW A;  2Z2L B;  2YKF A;  3UMD A;  5HFO A;  3T4S A;  2PD7 A;  4PMA A;  1YMX A;  3IF6 A;  4BL2 A;  3IXD A;  2DNS A;  3VV4 A;  4KEN B;  1K0K A;  4HP4 A;  3PTE A;  1DP9 A;  5TBM B;  1LSX A;  4KG6 A;  4JGP A;  3FYZ A;  1QMF A;  4LPZ A;  3LY3 A;  3OBF A;  2L0W A;  2O99 A;  5A90 A;  5HAR A;  1K54 A;  3LIB A;  1FOF A;  4DE0 A;  2C6W B;  3WS4 A;  2DRW A;  1LLB A;  1TD5 A;  3G30 A;  5DFX A;  4ZJ1 A;  1GA9 A;  1OJG A;  1UWP X;  3BLS A;  3DTM A;  3ZVW A;  1L0E A;  1M6K A;  3NCK A;  1S1Z A;  3ICY A;  4U0X A;  3R7W A;  2ACG A;  4H6J B;  2QWS A;  1YSP A;  2W1R A;  3PYP A;  4DJ3 A;  2JC7 A;  2JKR I;  3C2W A;  2Y2Q A;  5JYO A;  4IUK A;  4GCZ A;  3T4O A;  1K6R A;  2OAQ 1;  4HIA A;  3EOI A;  3OCN A;  3LID A;  5IS1 A;  1LL5 A;  2ZL1 A;  5FDS A;  3IWQ A;  1Y54 A;  3HLF A;  4N1X A;  4R3B A;  3UB7 A;  4F94 A;  1RCJ A;  3H7W A;  4EUV A;  3G35 A;  4WEL A;  3CAX A;  4FTX A;  3IF6 B;  1H8M A;  3P7N A;  5CER A;  2W27 A;  5A92 A;  5CHU A;  3E0Y A;  4L9G A;  3VOZ A;  5HDC A;  4WN5 A;  3TOI A;  5IHV A;  3BY9 A;  3UE6 A;  3JVU A;  3SZT A;  4X56 A;  3UB6 A;  4Q0J A;  4LCL A;  2VA0 A;  3PBR A;  1XPB A;  1KGG A;  3FZC A;  3BEC A;  4EES A;  4E3L A;  4MN7 A;  1TS7 A;  4BD0 A;  5EOO A;  5E2E A;  2FFY A;  3G34 A;  3V67 A;  5EVI C;  1UGU A;  5HWT A;  1KE0 A;  3HL9 A;  3MS6 A;  4GHI B;  2PBD P;  1XGI A;  1V9Z A;  1Q2P A;  4XUZ A;  2ZMV A;  4EBL A;  5EOE A;  3KSI A;  3UY6 A;  4OPQ A;  1YLW A;  3B42 A;  4MMN A;  3BEB A;  2W3E A;  1IEM A;  4KZ7 A;  1JNU A;  3K2N A;  5HZH A;  2ZL1 B;  4LCM A;  1ALQ A;  4Y2F A;  4Q0I A;  2J9P A;  2OV5 A;  4R38 A;  5A93 A;  2FFF B;  2Q9N A;  3H7W B;  4KZ8 A;  2I72 A;  4B93 A;  3HLG A;  4I39 A;  3PBO A;  3VSL A;  2V1B A;  1XKZ A;  3FKV A;  1MWT A;  3MQ0 A;  3E4P A;  1FCO A;  2PAV P;  4JGO A;  2JKT M;  2FH5 A;  4OH0 A;  1BT5 A;  3LCE A;  3BFG A;  1DP8 A;  3C30 A;  4BWI A;  4PM7 A;  5MC7 A;  3BRM A;  1OJ5 A;  5HAP A;  4UA6 A;  3OPH A;  4ZBE A;  2M7U A;  2CC1 A;  1NJ4 A;  3N8L A;  1LL8 A;  4KG2 A;  3V3R A;  4QU3 A;  4LGW A;  3IWI A;  4LRZ E;  1J3W A;  4R4R A;  4I3I A;  2O9A A;  4P6B A;  1YM1 A;  4LV3 A;  2QMI A;  2HDQ A;  3UB8 A;  3SW1 A;  4DN0 A;  4R70 A;  1IEL A;  3EEH A;  2HDR A;  3DW0 A;  1NZO A;  3E4Q A;  1P0Z A;  1LSV A;  2W3H A;  4KQQ A;  3T4Q A;  4Y13 A;  4EER A;  4HBU A;  5GLD A;  2Y2H A;  3LI8 A;  3QNC A;  5FAS A;  2J8Y A;  2ZD8 A;  5G4Y A;  1PI4 A;  2Y91 A;  2O9B A;  1MWR A;  4WMC D;  4HH3 A;  3S7O A;  4GD8 A;  1PWC A;  3OCL A;  5F82 A;  1CEF A;  2WUQ A;  3A3J A;  5F1F A;  2R78 A;  3ZNY A;  5EEC A;  3T4T A;  2ZJ9 A;  1VB6 A;  4KQD A;  4E6W A;  2WGI A;  1UWN X;  4X55 A;  3A0V A;  4UAA A;  1PIO A;  2JHE A;  3GSG A;  2HF6 A;  3WRZ A;  1XJ6 A;  4C3Q A;  2G2U A;  5FQM A;  4X1L A;  2HP6 A;  4N92 A;  4RQ9 A;  4HY8 A;  3HUM A;  3KYQ A;  2JKG A;  1BYW A;  3LEZ A;  1GHP A;  1JTG A;  3PAG A;  3NHQ A;  4HJ3 A;  3P01 A;  5L2F A;  1W5D A;  2XFS A;  4S2N C;  3O88 A;  1YSQ A;  3T1S A;  4LLO B;  1EI5 A;  1WA9 A;  3HLW A;  3G4P A;  2Y2J A;  4II7 A;  1BUL A;  5J3W A;  3ZNT A;  3PBQ A;  4X69 A;  2Y2M A;  1E4D A;  3C7U A;  5DKK A;  5M19 A;  3S4X A;  3L9K A;  2ZQA A;  2PHY A;  3K3C A;  4QPR A;  1KOU A;  1PZO A;  4EUZ A;  2FZ0 A;  2WKI A;  3UDF A;  4HP9 A;  1WYC A;  2Y8H A;  3MZE A;  1YKD A;  4S2J A;  1MKI A;  3SS3 A;  2M1C A;  4RYE A;  5U47 A;  3U4L P;  1SHV A;  2JCH A;  3WRT A;  5AQ9 A;  3T4J A;  2HP5 A;  3ZFZ A;  2Y2N A;  4KZB A;  1LSW A;  1MWU A;  2INW A;  4BBU A;  3NC8 A;  4R1G A;  1G5U A;  3Q7Z A;  3V50 A;  4KG5 A;  1OPX A;  4JXW A;  3FV7 A;  5EM1 A;  4X53 A;  4E3M A;  3LYX A;  3W4P A;  3BFD A;  3SS4 A;  5C5K A;  2VGL M;  1ZC2 A;  3BW6 A;  3D72 A;  4OON A;  4I3J A;  4Y5F A;  5TR7 A;  3PHY A;  2PU2 A;  2WZX A;  4LV0 A;  3IH8 A;  3M6B A;  1LT0 A;  5F83 A;  4P85 A;  1NY0 A;  1RGZ A;  4FD8 A;  4FH4 A;  2ZOI A;  1BUE A;  1GA0 A;  4NXE A;  1S0W A;  4GB7 A;  4E3I A;  3T4K A;  3GEC A;  2WKQ A;  3CJM A;  5FEG A;  4JF6 A;  3NJA A;  4UQI M;  2P04 A;  1ES4 A;  3IXB A;  3QP2 A;  5DVA A;  1V9Y A;  1LI0 A;  2WAE A;  3ZG7 B;  4U0T A;  1S4S A;  5HD5 A;  2W3F A;  4DXB A;  5L8M A;  4ID4 A;  1TS8 A;  1CF0 A;  4Y0O A;  4PAU A;  3NI9 A;  4JKT A;  1IKG A;  4PKY A;  4S2O A;  3IS2 B;  2W1T A;  3AGE A;  2HP9 A;  2JBF A;  5CHJ A;  2VK3 A;  3Q1F A;  3ZG8 B;  3WS2 A;  3G2Y A;  5FAQ A;  4OPR A;  5GLC A;  4JLF A;  4RX3 A;  2ZBB A;  1K56 D;  1N9L A;  4FCF A;  1KDS A;  1W79 A;  4LFU A;  2VV6 A;  2A49 A;  5TFQ A;  3NY4 A;  2EA9 A;  2Y2I A;  3PBN A;  4NEE D;  1NRF A;  3IBJ A;  5CEC A;  3C38 A;  2HV1 A;  1P9W A;  5TGF A;  5HAQ A;  2PYP A;  4ZJ3 A;  3O5Y A;  1MZU A;  4IHQ A;  4DRT A;  2BTF P;  4WM9 A;  3OC2 A;  2VGJ A;  5FSR A;  4UHU A;  4OOL A;  3BM6 A;  3EQV A;  2G2W A;  2P74 A;  2PT7 A;  4P0M A;  2EWW A;  1RP5 A;  1RGY A;  2JKF A;  4C75 A;  1YT4 A;  2WYX A;  2Y2P A;  4WUJ A;  1ZTU A;  3FKW A;  4YNR A;  4C6Y A;  2VGL S;  3UB9 A;  1VQQ A;  1KVM A;  1K4F A;  3WS5 A;  4B88 A;  1LI9 A;  1T1B A;  3ZQ5 A;  3PAE A;  4KUK A;  3IWO A;  1GCE A;  3MFD A;  3WWX A;  4DDS A;  1PWG A;  2ZOH A;  1FSW A;  1CK3 A;  4NXB A;  4GKU A;  3A3I A;  3G2Z A;  5AJG A;  2J3T C;  2K31 A;  1HLU P;  2O0Y A;  5EVI A;  2QJ7 A;  1HD8 A;  1T18 A;  4UQI S;  3E98 A;  1C3B A;  3VSK A;  4E3N A;  3LO7 A;  2ZC6 B;  4N9L A;  2I9V A;  1OTA A;  3LIE A;  4MBK A;  1ERO A;  1WYB A;  2X71 A;  2QPN A;  2Y55 A;  1DY6 A;  2OAP 1;  3HBR A;  1TEM A;  4O8G A;  3UME A;  1MWS A;  4ESP A;  4QY5 A;  4WYY A;  2HDU A;  1S4R A;  4CQH A;  4KZ5 A;  2XSS A;  2ZQ7 A;  1NRJ A;  4DJ2 A;  4QHC A;  5IU1 A;  4GHI A;  5FAO A;  4ETZ A;  4OQ0 A;  1XA7 A;  5EV0 A;  4E3K A;  4JF4 A;  5HD3 A;  1FR6 A;  2K7S A;  4XT2 A;  4L9F A;  2OOL A;  2VZW A;  1MKM A;  2ZLY A;  3S7N A;  2WAF A;  1E25 A;  3B33 A;  2Y2O A;  1L2S A;  2ZQ9 A;  2V1Z A;  3VE3 A;  3GR2 A;  3O86 A;  4PHT A;  3ITB A;  2OLV A;  5EVI B;  1N9N A;  2NUP C;  2P9V B;  2WKH A;  3WS0 A;  3R4K A;  3QP6 A;  3KX0 X;  2D02 A;  5FDH A;  4E3O A;  3I7J A;  2JKR M;  1OTE A;  4EV4 A;  5HDD A;  3GDI A;  2B18 A;  4E3J A;  5CEB A;  4CLC D;  5HX9 A;  4GS9 B;  5CTM A;  3M2K A;  2PYR A;  4H8R A;  3UN7 A;  3CI6 A;  3IX3 A;  2VV7 A;  2Z6C A;  3TJZ C;  4EEU A;  4PPR A;  4YWZ A;  5AVE A;  4GLQ A;  2Z2M B;  1ES3 A;  3HVF A;  3N8S A;  4JF5 A;  3LR5 A;  3IX8 A;  4JXV A;  5E2G A;  3MQQ A;  2PD8 A;  4JBF A;  3LIA A;  3FWL A;  5HL1 A;  1ONG A;  3T1Q B;  3A0R A;  4PKY G;  5AQ7 A;  1FQG A;  4XUX A;  2H10 A;  1PW1 A;  1BLP A;  5IT5 A;  4EXO A;  4XT2 B;  3NIA A;  4MLL A;  2V8C A;  1K57 A;  1BSG A;  1L0F A;  1F2K A;  3Q82 A;  4JGR A;  2DCF A;  1N9O A;  2D01 A;  2JKT I;  1DJA A;  4HEF A;  4BD1 A;  5A8B A;  2B5R A;  4S2N A;  2VGK A;  3QP8 A;  3C4P A;  4HOI A;  1OTB A;  3BFC A;  1U60 A;  4AFI A;  3N8R A;  3SH8 A; 
#chains in the Genus database with same CATH homology
 2M7V A;  5LBR A;  1W63 M;  3BQA A;  4II7 A;  5J3W A;  2LB5 A;  3BY8 A;  4ETX A;  3FG8 A;  4EU0 A;  4CLC E;  3KYZ A;  3PBQ A;  3TE8 A;  1X0O A;  3FPW A;  1G28 A;  3ULF A;  4IUH A;  5DKK A;  3CWF A;  2OWH A;  2WKP A;  2VKS A;  3S7P A;  2PHY A;  2G7U A;  3K3C A;  4L0L A;  4QPR A;  2A24 A;  5TBM A;  1KOU A;  3MJQ A;  2FZ0 A;  4WEJ A;  3C8C A;  4O0P A;  1G6O A;  4HP9 A;  3U2A A;  1DP6 A;  2Y8H A;  5HPI A;  5KIZ A;  4O01 A;  4I38 A;  1YKD A;  3KSG A;  2H28 A;  2M1C A;  4KUO A;  3D3O A;  4G3W A;  4L9E A;  1IOU A;  1OTD A;  1TF1 A;  3KSF A;  3PR6 A;  3LR0 A;  5HWV A;  3T4J A;  4FSF A;  5I5L A;  3TRC A;  2V1A A;  1LSW A;  3K3D A;  2VLG A;  5DKL A;  4P6Z M;  2INW A;  4BBU A;  4I5S A;  1XFN A;  1T19 A;  2A2L A;  4F3L B;  4MN5 A;  3T4L A;  4LRY C;  4EEP A;  4ME4 A;  4M4X A;  1OPX A;  4HJ4 A;  4GW9 A;  3FPV A;  3LYX A;  4H6J A;  3MQO A;  5C5K A;  2KDK A;  2W0N A;  2VGL M;  1P97 A;  3BW6 A;  3D72 A;  3IBR A;  2HJE A;  2XA7 M;  2YKH A;  3LR3 A;  4BBT A;  4I3J A;  2W3D A;  4Y5F A;  3PHY A;  1OT9 A;  4WEK A;  1XJ2 A;  1LT0 A;  1D7E A;  3F1N A;  3H82 B;  2BAS A;  2ZOI A;  4CLC A;  2W1T B;  4NXE A;  2OWJ A;  2YKF A;  4ARZ B;  1OTI A;  3UMD A;  3T4K A;  5DFY A;  3OOV A;  3GEC A;  2WKQ A;  3T4S A;  2JN7 A;  4F3L A;  3F1O A;  2PD7 A;  3B47 A;  3NJA A;  3A0S A;  4UQI M;  3VV4 A;  2P04 A;  2L1M A;  4HP4 A;  1V9Y A;  3R7W B;  1DP9 A;  5TBM B;  3LIF A;  1LSX A;  1S4S A;  5HD5 A;  4JGP A;  3TW8 A;  2W3F A;  1ODV A;  3PBT A;  4MDZ A;  5L8M A;  1TS8 A;  1D06 A;  4LPZ A;  4PAU A;  3RTY A;  3OBF A;  2L0W A;  2O99 A;  3H82 A;  1S67 L;  3H9W A;  4HJ6 A;  4PKY A;  3IS2 B;  2W1T A;  4LRX C;  3LIB A;  4ARZ A;  4BBV A;  1TD5 A;  2W3G A;  3EEA A;  5DFX A;  1OJG A;  1UWP X;  5G4Z A;  2P7J A;  1H3Q A;  1XJ4 A;  2ZBB A;  1GSX A;  1N9L A;  1S1Z A;  3ICY A;  3KSH A;  5TJJ A;  2VV6 A;  3ZYT A;  2EA9 A;  4E04 A;  3RH8 B;  3R7W A;  3PBN A;  4NEE D;  3IBJ A;  4H6J B;  2QWS A;  4R3A A;  1YSP A;  2W1R A;  3PYP A;  4DJ3 A;  2JKR I;  3C38 A;  3NOP C;  2HV1 A;  1P9W A;  2PYP A;  3C2W A;  3CLO A;  4KQO A;  3W2Z A;  3O5Y A;  4IUK A;  4GCZ A;  1MZU A;  2CMN A;  5HPF A;  3LI9 A;  3T4O A;  2PDR A;  4IHQ A;  2OAQ 1;  4HIA A;  3EOI A;  3OC2 A;  3OCN A;  3LID A;  3IS2 A;  4OOL A;  5IS1 A;  2Y79 A;  3EQV A;  3F1N B;  4Z1W A;  2ZMF A;  4CLC B;  2V0U A;  2PT7 A;  2VX8 A;  4P6Z S;  3MMH A;  3UB7 A;  3KO6 A;  3S7Q A;  2K2N A;  2EWW A;  3H7W A;  4YOF A;  4EUV A;  4WEL A;  3CAX A;  3F1O B;  3PXP A;  4WUJ A;  1H8M A;  3P7N A;  2W27 A;  1ZTU A;  1VHM A;  5DJT A;  3VOL A;  4YNR A;  3E0Y A;  1NLY A;  2VGL S;  4L9G A;  3UB9 A;  5HSQ A;  5HDC A;  3MF0 A;  2XA7 S;  3MFX A;  1TS6 A;  4WN5 A;  1T1C A;  2MJ6 A;  2P08 A;  5EFW A;  1T1B A;  1Y28 A;  4R6L A;  4BMW A;  3BY9 A;  3ZQ5 A;  3BJN A;  4KUK A;  3PBS A;  3JVU A;  3UE6 A;  4NXG A;  5F5Y A;  3UB6 A;  2EWV A;  2KOI A;  2VA0 A;  3DBA A;  3PBR A;  2IA2 A;  4Q0J A;  4WLA A;  2HGV A;  2ZOH A;  2QJ5 A;  4NXB A;  5HL6 A;  5F69 A;  5AJG A;  2J3T C;  4EES A;  4CLC C;  4HQA A;  2K31 A;  2O0Y A;  2PR6 A;  2QJ7 A;  2Z6D A;  2VV8 A;  4MN7 A;  1TS7 A;  1T18 A;  1DRM A;  4UQI S;  3V67 A;  3E98 A;  2NUT C;  3BWL A;  1UGU A;  5HWT A;  4GHI B;  2QKP A;  2GNX A;  2I9V A;  5F68 A;  1V9Z A;  5AVF A;  1TS0 A;  1OTA A;  3LIE A;  2ZMV A;  1IFQ A;  1S66 L;  4I3A A;  4ZRR A;  3KSI A;  2OAP 1;  3B42 A;  2O9C A;  4MMN A;  2W3E A;  1JNU A;  1NLZ A;  3K2N A;  5HZH A;  4G3K A;  4Y2F A;  4O8G A;  4Q0I A;  1GSW A;  3UME A;  4GJ4 A;  1S1Y A;  4EW7 A;  4G3V A;  5DJU A;  4R38 A;  3MXQ A;  4EQ1 A;  5DF9 A;  1S4R A;  4CQH A;  3H7W B;  3G6O A;  4B93 A;  3CUE A;  1P9R A;  2XSS A;  3PBO A;  4I39 A;  1NRJ A;  2V1B A;  4DJ2 A;  3JVV A;  2LB9 A;  4WL9 A;  5IU1 A;  3EGD C;  3MQ0 A;  3F1P A;  4GHI A;  1T1A A;  2XRO A;  4ETZ A;  3E4P A;  5KSH A;  2GZA A;  2V0W A;  4JGO A;  2JKT M;  2FH5 A;  5HD3 A;  4DMZ A;  1DP8 A;  3C30 A;  4BWI A;  2K7S A;  5MC7 A;  4XT2 A;  4L9F A;  2OOL A;  1NWZ A;  1MKM A;  1OJ5 A;  2VZW A;  3S7N A;  3CIT A;  2M7U A;  1XFQ A;  1F5M A;  1MC0 A;  3B33 A;  5HWW A;  1ZHH B;  2KX6 A;  3T50 A;  3VE3 A;  1LL8 A;  4MCW A;  4MN6 A;  4FOF A;  4PHT A;  5FL3 A;  1W63 Q;  4LRZ E;  1XJ3 A;  1N9N A;  2NUP C;  4I3I A;  2O9A A;  3R4K A;  3KX0 X;  2D02 A;  3LIC A;  2QYB A;  4WF0 A;  3VE4 A;  3FC7 A;  2JKR M;  3UB8 A;  1OTE A;  3BQ8 A;  4DN0 A;  3SW1 A;  5HDD A;  4R70 A;  3GDI A;  2B18 A;  3E4O A;  3EEH A;  4Y3I A;  2J3T D;  3E4Q A;  1YAX A;  1GSV A;  1P0Z A;  4CLC D;  1LSV A;  2B02 A;  2W3H A;  4GS9 B;  3NOU C;  3LFV A;  3T4Q A;  2VJW A;  4EER A;  5J4E A;  3EGX C;  2PYR A;  2XRN A;  3LI8 A;  4NXF A;  5HDS A;  3CI6 A;  2J3W A;  4UEY A;  2VV7 A;  5G4Y A;  2Z6C A;  2KLI A;  3TJZ C;  3EQU A;  2O9B A;  4K08 A;  4EEU A;  3LUQ A;  4YWZ A;  4HH3 A;  5AVE A;  3S7O A;  3OCL A;  1OT6 A;  4GLQ A;  4OOM A;  2L4R A;  3LR5 A;  1F9I A;  2R78 A;  3MQQ A;  3NOT C;  2PD8 A;  3T4T A;  1VB6 A;  4KQD A;  2GJ3 A;  3HJI A;  3F1P B;  3LIA A;  2VEA A;  3MR0 A;  3A0R A;  1UWN X;  4IJG A;  4PKY G;  3EWK A;  4GS9 A;  4Q0H A;  3A0V A;  2V9A A;  3LR4 A;  4JGQ A;  2JHE A;  3HCY A;  2HF6 A;  5J7E A;  1XJ6 A;  5IT5 A;  2PR5 A;  4EXO A;  4XT2 B;  2HJ9 C;  1F98 A;  2WKR A;  2GX5 A;  3RFB A;  1EW0 A;  5K5B A;  4RQ9 A;  4EET B;  4HY8 A;  2A24 B;  4B9O A;  3KYQ A;  4JGR A;  1BYW A;  4BJP A;  3UE3 A;  1N9O A;  2D01 A;  3NHQ A;  4HJ3 A;  3OLO A;  2JKT I;  3P01 A;  2J80 A;  3HJK A;  5A8B A;  5CX7 A;  4HI4 A;  2DMW A;  5F6A A;  4HHD A;  3CUE C;  4HH2 A;  4HOI A;  1OTB A;  1YSQ A;  2QHK A;  4AFI A;  1STZ A;  4LLO B;  4HNB A;  4NKP A;  1WA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...