5HPIA

Crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
b'AHLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQQDNRVSPYGMHLGNRLPAHATSTGKVLLSVLDREVQIEWIEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGVIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVLPLLRNTANELRNLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p-hydroxybenzoate hydroxylase transcriptional activator
molecule tags Transcription
source organism Acinetobacter baylyi str. adp1
publication title A microbial sensor for organophosphate hydrolysis exploiting an engineered specificity switch in a transcription factor.
pubmed doi rcsb
total genus 40
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hpiA00
2IA2A 3MMHA 3E0YA 2KLIA 2M7UA 3ZQ5A 3S7QA 2VZWA 2W3GA 4MDZA 2Y8HA 2LB5A 2W3FA 4Z1WA 2XROA 5I5LA 4IJGA 4GW9A 4LRYC 4FOFA 3W2ZA 4IUHA 4O8GA 3S7OA 4G3KA 5HPFA 4Q0IA 3R4KA 4MN7A 4Y5FA 3TRCA 2XRNA 3OOVA 2W3EA 2G7UA 2HGVA 1YSPA 5TJJA 2W1TA 4DMZA 4ZRRA 4O0PA 4GLQA 4G3VA 3OBFA 5K5BA 4G3WA 4LRXC 5C5KA 2W3HA 3KSIA 3KO6A 3BJNA 4Q0JA 3MF0A 2KOIA 3NOPC 4R6LA 2VEAA 2QYBA 2W1TB 3IBRA 3KSFA 2W1RA 4MCWA 2GX5A 1TD5A 3S7PA 1YKDA 3CI6A 3G6OA 2O99A 2VKSA 4ETXA 5AJGA 4ME4A 3CITA 4Y2FA 4RQ9A 4ETZA 2W3DA 1YSQA 2Y79A 4CQHA 3NOTC 5HSQA 2O9CA 1MC0A 4PAUA 3VV4A 4DN0A 4BWIA 2XSSA 2ZMFA 4QPRA 3LFVA 2LB9A 3O5YA 4Y3IA 4E04A 4LRZE 2O0YA 4MMNA 3EEAA 3RFBA 4EU0A 3NHQA 5HPIA 4Q0HA 5LBRA 2O9BA 3IBJA 3KSHA 4IUKA 3C2WA 3KSGA 3MQ0A 3S7NA 1STZA 4R70A 1VHMA 3NOUC 1ZTUA 1F5MA 3K2NA 3HCYA 2M7VA 5DFYA 5HL6A 3D3OA 5L8MA 2K31A 1MKMA 2K2NA 3DBAA 2OOLA 5DFXA 4YOFA 3E98A 4O01A 2VJWA 2B18A 1TF1A 2O9AA 4YNRA 4EUVA
chains in the Genus database with same CATH superfamily
4HP4A 3S1YA 4DF6A 2EA9A 3BM6A 4R4RA 1NWZA 3G2YA 3MZEA 4HJ6A 3ZNTA 2FH5A 3WRTA 3HUOA 1BULA 4Q0IA 1PWCA 3T1RA 5FASA 4CLCB 4U0TA 3O88A 2W3EA 1XFQA 3HBRA 4WMCD 3V5MA 5DKKA 4E3IA 4GZBA 3VMAA 3HJKA 3VP4A 4GLQA 5K5BA 4G3WA 3LEQA 5E2FA 1ACFA 1T1BA 1NZOA 1S1ZA 4HJ3A 5A91A 1N9LA 2W1RA 2PU2A 1TEMA 1OJ5A 1PIOA 1LSVA 2WADA 5CEBA 5DVAA 2Y2JA 4EERA 1T19A 3QHYA 5HAQA 3BQAA 5J8XA 3SS3A 1CEFA 2Y2KA 4HQAA 4DN0A 3IH8A 3LFVA 2JKTM 4II7A 4KZ7A 3Q1FA 3RFBA 2VA0A 3LY3A 5HDCA 4OP5A 2R78A 2XLNA 3OPPA 4IVIA 2OAQ1 4X69A 3F1NA 3UE0A 3E2LA 3WS1A 1XGJA 4NXGA 3C4PA 3DTKA 3FG8A 2JCHA 5DF9A 3UMDA 4OONA 4HIAA 2INWA 3A3JA 1TS7A 4L9EA 1ES3A 4E3KA 1DRMA 3KYEA 1L0FA 2W3GA 2W3FA 1KE0A 2Y59A 4FH2A 1P9WA 2GJ3A 4IUHA 1NYMA 4DKIA 3FZCA 1AXBA 1KE4A 4S2IA 1HZOA 3GQZA 4MN7A 3ZCZA 3Q81A 3TRCA 3GRJA 3SH7A 3HREA 2PU4A 4ID4A 1EW0A 4I3JA 4OP8A 5TJJA 2W1TA 1KVMA 2JKRM 5TBMA 3EEHA 3ZFZA 3PBRA 1FSYA 4R4SA 4ESPA 4KUOA 1CQAA 5FDSA 2XEPA 1IYOA 2O99A 3H9WA 1GSWA 2D01A 2V1ZA 2VX8A 4YWZA 1CEGA 3LIBA 1UWPX 2P7JA 3BFGA 4N1HA 1CK3A 3FWLA 3A3FA 1XGIA 2P08A 4BBUA 2O0YA 3NIAA 4NK3A 5HPIA 2QPNA 3ZVWA 2V1BA 4U3TA 5HD3A 2HJEA 5CHMA 3CHWP 4N9LA 4RYEA 3F1NB 4R70A 1ZTUA 4P87A 5L2FA 2BG1A 4HBUA 1XJ4A 3FPWA 2L1MA 2JE5A 2XR0A 5GLDA 4OPYA 3QP8A 5CHUA 4Y0UA 5FDHA 2Y2GA 3CMZA 3IXDA 1VB6A 2J9PA 3NCKA 3O87A 1NLYA 1VM1A 1Z09A 3LIEA 4IEDA 2K7SA 2XRNA 4B93A 2PR5A 3U4LP 4KG6A 5HFOA 4Y0OA 2Z6DA 2EXBA 4UQIS 4DMZA 3H7WB 4JGRA 1EI5A 3TE8A 2QZ6A 1NRJA 4DXCA 4F94A 3ZG8B 2HF6A 5IS1A 4R1GA 1D1JA 3ULFA 4X1MA 5FQIA 3FV7A 3AGFA 5FQQA 1K0KA 2V0UA 5FQMA 4A5RA 2R9WA 1J9MA 4PM5A 4ETZA 3A3IA 1MWRA 2RL3A 3PYPA 1OTIA 2O9CA 4PAUA 2I72A 3GECA 2PD8A 1TVFA 2HP5A 2ZLYA 5HD5A 5TR7A 1IYPA 3F1OB 4MMNA 4HH3A 3NBLA 5AQ7A 3CZDA 4ZAMA 3H82B 2O9BA 5I94A 4QD4A 5CGSA 3KSGA 3S7NA 4NXBA 2OV5A 3EOIA 3S4XA 5KSHA 2ZC3B 3HCYA 4GD8A 4JBFA 4OKPA 5A93A 4K91A 1HD8A 2JBFA 2X71A 3TOIA 4YNRA 3NI9A 2WK0A 1KE3A 5KMWA 3VP1A 1XXMA 4OLGA 2J9OA 1JTGA 2I9VA 1FQGA 3V3SA 3HLGA 4FSFA 1FR1A 3W4QA 1D06A 1SKFA 4NXEA 2A3UA 1OPXA 2H0TA 3F1PB 4S2NA 4CJNA 5IT5A 4MEZA 4H6JA 4P6ZM 4LV2A 3IWOA 3P7NA 3UPOA 5AQAA 5FL3A 3NDGA 3OPLA 3A0VA 4YINA 4KUKA 3GDIA 4NEED 1LT0A 2QKPA 4Y7PA 5GL9A 2H5SA 5J3WA 2A2LA 1K55A 4RQ9A 4KZ4A 1VETA 4ZBEA 4QY6A 3SH9A 1HTZA 1TS0A 4CLCD 1CI8A 1IKGA 4KQOA 5EVID 3G30A 3HLBA 4LRZE 4C75A 3C8CA 4UHUA 3LGOA 4X1LA 3ZGAB 5GHYA 3ZG9B 2P74A 4WF0A 3NOUC 5FQ9A 2G2WA 1XA1A 4WMCA 3V50A 2AVXA 1DJBA 4JKTA 1LSWA 4GN2A 5GHZA 1K25A 5TBMB 2ZQAA 3M2JA 5HWWA 4F3LA 2W27A 2WKRA 3CJMA 3PBQA 3VE4A 3IWQA 4JF4A 1ESUA 1IEMA 1DP6A 1LL5A 5CRFA 4IBXA 4QU3A 2XF3A 1L3LA 3ICYA 4PM7A 4JGOA 1E25A 1PI5A 5FEFA 3L9KA 1GSVA 2B5RA 1P97A 2EFXA 1H5XA 4OH0A 1OT6A 4RVAA 3KYZA 1JWPA 2WKIA 3E2KA 3T4KA 3BW6A 1S66L 1YLTA 4EQIA 1D7EA 4B4XA 3SS5A 2L4RA 2BLSA 2Q9MA 3B42A 4GDBA 2PR6A 4I39A 3VV4A 4BWIA 5HAIA 4HI4A 1N9NA 1NLZA 4E3LA 3CPTB 5F83A 4JLFA 3LO7A 4WM9A 1S4RA 4Z9QA 4IHQA 1H8ZA 1RP5A 4EW7A 5LBRA 2WGVA 3JVVA 3C2WA 3SW1A 5FSRA 5FATA 3HLCA 5HAPA 1XJ2A 1L0GA 3DWKA 3P01A 1YAXA 2VGLM 2OOLA 4ZDXA 2O9AA 4MNRA 3A0RA 2Z6CA 3PBTA 3VFFA 1F2KA 2VZWA 1Y28A 2PDRA 5E2EA 3O86A 3QP6A 3TW8A 3WS2A 4OOYA 4XUXA 4L9FA 2PAVP 1BLSA 3UNWA 2ZMVA 1TDGA 3GMWA 3MFXA 4PM6A 2P9VB 1XKZA 4EXOA 3GTCA 5C5KA 3QP4A 1DJCA 4RX2A 1NY0A 4B9OA 3IXGA 3KSFA 4LV0A 2DCFA 3D9YA 2ZBBA 3IF6A 2WYXA 2VKSA 4WZ4A 2XD1A 5EPHA 3D4FA 3OCNA 5CXWA 4DDYA 3NOTC 2XQZA 5HZHA 3LR3A 3WS5A 2E8JA 3IF6C 3WRZA 1IELA 2XFTA 1IFQA 4EBNA 2X02A 5F5YA 1GCEA 2JN7A 4HH2A 1IOUA 3EEAA 1PWDA 3M2KA 4R3AA 4MBFA 1SZVA 3DTMA 2OWJA 3CUEA 4M4XA 4EBPA 1BTLA 2QMIA 3ZHHA 4HEFA 1BLCA 4S2KA 1BLPA 4H6JB 3RXXA 3DTEA 5F82A 1PWGA 2VV6A 1S6RA 2HP6A 3K3DA 3F1PA 3CPTA 1XFNA 3OPHA 4JXWA 4Z1WA 1K4EA 3G32A 1V9YA 1L2SA 3AGEA 1M40A 1YLPA 2J7VA 4YFMA 1W8YA 2UV0E 4NKPA 3S22A 4KG5A 4S2NC 3N6IA 2JKGA 3BECA 3CLOA 2EXAA 4JXSA 1ALQA 1PZOA 5L10A 3KO6A 3C7VA 4HP9A 4R0QA 4I3IA 1GHIA 2QYBA 3M6BA 1W79A 5DTTA 4CLCA 2QJ5A 3LI8A 4LLOB 1KGFA 3T4SA 1G5UA 3IX4A 3Q7VB 3UB5P 3UE6A 1YPRA 1WA9A 1YSQA 2BASA 1SHVA 4CPKA 5F69A 3ITBA 3T4OA 3M6HA 4HJ4A 1FILA 2EX8A 1H0MA 2LB9A 2ZC7A 2WKQA 1ONGA 3ZDJA 2ZD8A 1Y54A 4ZTKA 1G68A 3OZHA 1KOUA 1YMSA 1K6SA 4XT2B 1YLZA 2ZOHA 5HW3A 3V3RA 4QY5A 5KSCA 4ZJ1A 2M7VA 1KDWA 1NJ4A 3D3OA 2W0NA 4KZ3A 2ZC6B 4ARZA 4KZ6A 2Y91A 2JKRI 2WGWA 3DW0A 3NJAA 2PHYA 1AWIA 1L0DA 3TSGA 3A3EA 5FQKA 1MY8A 4E3JA 2JHEA 5I5LA 3SZTA 3UDFA 5F6AA 4LRYC 3W2ZA 1VETB 1JWVA 2KDKA 1FOFA 1MXOA 2RCXA 3CUEC 1OMEA 4G3KA 4MBHA 5HPFA 4S2LA 2H10A 2WKPA 2NUTC 3A0SA 1ES2A 5DJUA 3K3CA 3PAEA 1VEUA 4CLCE 2ZQ9A 4KQDA 2KX6A 2WZZA 1EWZA 1YM1A 5AQ9A 4BLMA 1A0KA 3R7WA 4K08A 1WYCA 3BJNA 4Y0TA 1J3WA 2E8IA 4X55A 2WUQA 5HL1A 4H8RA 4N1XA 3RJUA 3BQ8A 1V9ZA 2C5WB 4IBRA 4WL9A 3CAXA 2W3DA 1IKIA 3PTEA 1YLJA 1L0EA 5EVIA 3HLEA 4F3LB 5E2HA 2OSUA 3FC7A 4DRTA 4Q0HA 4P85A 4B88A 3T50A 3IBJA 1OTBA 3CWFA 2CC1A 5HDSA 3OCLA 2J3TD 2GNXA 3N8SA 3N7WA 4HY8A 4PPRA 1NXYA 4PMAA 4E3NA 3IHAA 1K38A 4OQ0A 4DE2A 3F1OA 4RA7A 1LSXA 4QWOA 4KZ8A 3EWKA 4X25A 3ZNYA 2ZMAA 1HVBA 4GHIB 4UEYA 4OPZA 3MMHA 1KDSA 3S7QA 4UA6A 5FI7A 3C7UA 1K55C 1WE4A 2ZM0A 1ZC2A 2WAEA 4IJGA 4WZ5C 4EESA 3LIFA 4BD0A 2VGLS 3BFEA 3VFHA 4QHCA 3UB8A 5G18A 2HGVA 2JKTI 5U47A 1YSPA 5KZHA 4GNUA 5J7EA 2KOIA 2QJ7A 1NZUA 1ERQA 3OPRA 2J3TC 2VK3A 2XA7S 4EETB 1FR6A 3EGXC 1PW8A 4ME4A 1E3UD 1ZKJA 3DAVA 3BWLA 3I7JA 1GA9A 5TGFA 2PYPA 1S4SA 1FSWA 4LGWA 4OLDA 4QPRA 4WEKA 1KVLA 4E04A 4LPZA 1RGYA 4LCLA 3NHQA 3T1QB 1K56A 4C3QA 1FCMA 2JKFA 1M6KA 1SCWA 1E3UA 2OLUA 3MXQA 1YT4A 1GSXA 1T18A 2EX9A 4Y13A 1TS8A 5BOHA 1KGGA 2HPBA 5L8MA 3H82A 4EBLA 1RGZA 2VJWA 3LICA 4O7DA 3LCEA 3E0YA 3LR0A 1P9RA 1ODVA 1OT9A 4HESA 4X53A 5HARA 5FAQA 3ZVTA 4EEUA 1ERMA 3TJZC 3IF6B 4BQMA 2YKFA 1JNUA 2EWWA 2HDUA 1G28A 5L09A 4BBVA 4MBKA 3BFCA 4JPMA 2QWSA 2Y55A 3ISGA 4OQGA 1H8MA 3JVUA 4DE0A 4Y17A 4LFUA 5EV0A 1SDNA 4HOIA 4MCWA 4Y15A 3TG9A 2ZQ8A 3B3XA 3IX3A 5GLAA 5CERA 1PW1A 1YMXA 4K0WA 5EM0A 3BRMA 4GS9A 4P0MA 2B95A 3Q7VA 2Y2OA 3PBNA 5AVEA 3SS4A 4EUZA 3IXHA 4QB8A 3UB7A 1QMFA 4OOMA 3DTIA 3HUMA 2XA7M 1T1CA 4PKYA 3BLSA 2K2NA 1I2SA 1GHMA 3VE3A 4JF6A 3MS6A 4GDNA 3NC8A 1CF0A 4GB7A 4OOLA 2IA2A 1Z6FA 4S2MA 5F1GA 4OVDA 3ZQ5A 2ZM2A 2HV1A 3B33A 4WZ5A 1LL9A 1OTAA 3OC2A 3S7OA 2IWBA 3EQUA 3QP2A 3NECA 3BLMA 3C4OA 2C6WB 3PR6A 1IYQA 3QNCA 3VSKA 5CHJA 3HLDA 4PKYG 2QHKA 4HNBA 1YQSA 4ZJ3A 4LCMA 1UGUA 4BL3A 4LRXC 2HDQA 5HX9A 4GD6A 3SH8A 3MKEA 5L07A 2Y2MA 3MF0A 2H0YA 2VEAA 1PNEA 4FCFA 4X56A 5AQBA 2FFFB 1YKDA 2VV7A 3G6OA 3E4PA 4FUWA 3GSGA 1UWNX 3KX0X 3V67A 1FCNA 4S2JA 4Y2FA 3NY4A 3Q82A 2XH9A 3GV9A 2Q9NA 2V0WA 2HP9A 5FAOA 1TS6A 5GLCA 3IQAA 3MSHA 4R3BA 2WZXA 3A3DA 5AVFA 2EX2A 5DKLA 5M1AA 4WUJA 2PBYA 2X01A 4WYYA 5EECA 3MQ0A 3LIDA 3GVBA 4GCZA 3UB6A 3B47A 1OTDA 5DFYA 3VSLA 1PFLA 2ZL1A 2DMWA 3DBAA 2V1AA 3PAGA 1LI9A 4EUVA 4NETA 4CLCC 4I3AA 3HVFA 4DDSA 3LUQA 2H28A 2M7UA 1O7EA 3VOLA 1G6AA 4MDZA 3IWIA 3QP1A 4KG2A 1G6OA 2Y2PA 2WGIA 4FTXA 1Y4OA 3MZFA 4EWFA 4N9KA 3T4TA 2B02A 2XFSA 1BSGA 4BJPA 4WLAA 3ZG5A 3G4PA 1KGEA 1X0OA 2HDRA 3LR4A 2ZJ9A 2FFYA 1K56D 2J80A 3IH9A 1ZG4A 2JC7A 4L0LA 5EM1A 4M3KA 1PZPA 2ZC5B 4Q0JA 3VOZA 4R6LA 3BFFA 2V2FF 4KENB 1VEUB 1PI4A 3CI6A 3CG5A 2HJ9C 4R23A 5FI6A 3T4JA 4E3MA 1OJGA 4ETXA 3UN7A 2V9AA 3BY9A 1ESIA 3HJIA 5HSQA 1MC0A 3FPVA 3BEBA 2PBDP 3VP2A 5MC7A 1K57C 2EX6A 3O5YA 1BLHA 4Y3IA 5DJTA 3LIAA 4KQRA 2Y2NA 1LI0A 4DJ2A 3PBSA 2WGWB 1N9BA 1SDEA 3G35A 4IUKA 4R38A 5CEDA 2J3WA 1VHMA 5TFQA 2ZL1B 5EUAA 4KQQA 4E6XA 2V8CA 3C38A 3P98A 1BUEA 3MZDA 4NG2A 5JYOA 1MKMA 1P0ZA 3WS4A 2G2UA 2Y2QA 1XJ6A 1CJFA 4KZ9A 3W8KA 1GA0A 4GOGA 3HLWA 3UO9A 2LB5A 3ZG0A 4BL2A 2V8FA 4GS9B 3RTYA 3WWXA 1PYYA 3MR0A 5DF7A 5HWTA 4GHIA 3U2AA 4XXRA 2L0WA 2XD5A 3UPPA 5D3OA 3T1XA 1K4FA 2G7UA 3IX8A 1HLUP 3C5AA 4FD8A 4BMWA 5E2GA 1RCJA 1QMEA 1IYSA 2J8YA 2UWXA 2W3HA 3KSIA 3MJQA 2Y2LA 4JXVA 5M19A 1DJAA 5CGWA 3G2ZA 3PHYA 1XPBA 1NRFA 3FKVA 4DXBA 4KZ5A 5HDDA 1W63Q 1BYWA 5FAPA 2DNSA 3E4QA 2ZQDA 3VP0A 1JVJA 3C30A 3HUNA 5EVIC 1H8YA 3IHBA 1S0WA 3LI9A 4PHTA 4LV1A 3QP5A 3BFDA 3BY8A 3RXWA 4R3JA 1F98A 5FI2A 4EV4A 3RH8B 4EU0A 1ZG6A 1ES4A 5DF8A 4Q8IA 1XX2A 4P6BA 4JXGA 5KIZA 3K2NA 1MPLA 4NXFA 4AFIA 3W4OA 1W8QA 4WELA 3T12B 3L7HA 5M18A 4K0XA 4UQIM 2P04A 1MKIA 2A49A 4UA9A 1U60A 2PRFA 4YOFA 2Z2LB 1ONHA 1T1AA 3G31A 1JWZA 2CMNA 2KLIA 4JGPA 5F68A 4DJ3A 5A8BA 5EVEA 1FIKA 2XROA 4FOFA 2WAFA 4O8GA 1O07A 4BENA 3IS2B 4Y5FA 4BBTA 5FEGA 2Y2IA 2Q0OA 2HDSA 4X68A 4I38A 4MN5A 4WN5A 3P09A 3MQQA 1K57A 4G3VA 2P9VA 1MWSA 3UE1A 5A90A 4XT2A 3H7WA 1JTDA 3N4IA 5CX7A 5E43A 3IT9A 2W1TB 3QNBA 1TD5A 3S7PA 3NDEA 5IU1A 4DE1A 3D72A 4B4ZA 3KYQA 1WYBA 1GHPA 3IS2A 3PXPA 1CI9A 4D60A 5HWVA 5EVIB 5J4EA 1ZHHB 3IF5A 2Y2HA 2IWDA 4PM9A 4IVKA 4N92A 3LEZA 2ZMFA 1XP4A 3UY6A 2PYRA 1NYYA 4X6TA 5DTSA 4MLLA 2HZ5A 3Q07A 4C6YA 3LY4A 5EE8A 3UDIA 2NUPC 2V20A 3VOYA 3ZG7B 3PBOA 2K31A 5CTNA 5DFXA 4QJGA 1I5QA 1DP9A 4O01A 4KZAA 3FKWA 4E6WA 4OQHA 2ZOIA 2DRWA 3NULA 2GZAA 2A24B 5CGXA 4L9GA 2M1CA 4GW9A 3VP3A 4DE3A 1OTEA 3R4KA 2VGJA 2WKHA 5FA7A 5EOOA 2ACGA 2OWHA 2BTFP 3FYZA 2WKEA 1W7FA 4ZRRA 4LV3A 4ARZB 3R7WB 2YKHA 5EVLA 3T1SA 1MBLA 1YLWA 4LENA 5F1FA 3HLFA 3BYDA 2EFUA 2ZM8A 3IBRA 1W5DA 3HL9A 1I2WA 2OLVA 3O3VA 5AJGA 3JPUA 2R9XA 4RX3A 2Y79A 2ZQ7A 2Y4AA 1Q2PA 1N4OA 4EEPA 3SOIA 1TDLA 2IWCA 2XSSA 1BT5A 3EQVA 4GJ4A 4XUZA 5JYPA 3DWZA 5EOEA 2ZC4B 4BD1A 1LL8A 4E3OA 3LYXA 2D02A 3IXBA 1STZA 3JYIA 3N8RA 5EFWA 4UA7A 1H3QA 2Z2MB 5HL6A 3Q7ZA 3AGDA 1FCOA 1Q2QA 3EGDC 2OAP1 3T4LA 5DTKA 4JF5A 3V39A 1DY6A 4S2PA 2VLGA 1XJ3A 4OQIA 3UPNA 3MQOA 1F9IA 5G4ZA 1MWTA 2Y8HA 3LR5A 1E4DA 1S67L 3G34A 4U0XA 4PM8A 1N9OA 5CECA 5A92A 1K54C 1MZUA 3OOVA 1C3BA 2VV8A 1PRQA 4WEJA 3UE3A 2ZQCA 3GR2A 3W4PA 4O0PA 1K6RA 2VGKA 4P6ZS 3MFDA 1MWUA 2XK1A 3OBFA 1VQQA 4MN6A 1K54A 1XA7A 3MXRA 2XGNA 3UDXA 1LLBA 4UAAA 2MJ6A 4ZJ2A 3NOPC 3MXSA 1BZAA 3N8LA 2GX5A 5FQJA 3T4QA 2PT7A 3ZYTA 4EQ1A 1ES5A 3CITA 3UB9A 3WS0A 4GKUA 4KZBA 1LHYA 4CQHA 4FH4A 2A24A 1S1YA 4JGQA 4OPQA 5GHXA 2PD7A 4S2OA 5GLBA 3MBZA 1SKOA 3E4OA 2FZ0A 2EWVA 3ITAA 5IHVA 4HBTA 5CTMA 3KSHA 4OPRA 1YLYA 1F5MA 1W63M 3OLOA 3UMEA 1DP8A 1EROA 5G4YA 2XDMA 4I5SA 3MKFA 4D2OA 2GDNA 1SKOB 4WBGA 3E98A 2B18A 1TF1A 4HHDA
chains in the Genus database with same CATH topology
3MMHA 2W27A 2WKRA 4HP4A 3S7QA 3PBQA 3VE4A 2EA9A 1NWZA 4HJ6A 2LB5A 2FH5A 4GS9B 3RTYA 4IJGA 1DP6A 3MR0A 4EESA 5HWTA 3LIFA 4GHIA 4Q0IA 2VGLS 3U2AA 3ICYA 2L0WA 4CLCB 2W3EA 4JGOA 3UB8A 1XFQA 2G7UA 2HGVA 2JKTI 5DKKA 1YSPA 1GSVA 3HJKA 1P97A 4GLQA 4BMWA 5K5BA 4G3WA 5J7EA 1OT6A 2W3HA 3KYZA 3KSIA 1T1BA 3MJQA 3T4KA 3BW6A 1S66L 2KOIA 1D7EA 1S1ZA 2QJ7A 4HJ3A 3PHYA 1N9LA 2J3TC 2W1RA 2XA7S 5HDDA 1W63Q 1BYWA 1OJ5A 4EETB 2L4RA 1LSVA 3EGXC 4EERA 4ME4A 3BWLA 3E4QA 1T19A 3B42A 3BQAA 2PYPA 2PR6A 3C30A 4I39A 1S4SA 3VV4A 3LI9A 4HQAA 4DN0A 4PHTA 4BWIA 4HI4A 1N9NA 4QPRA 3LFVA 3BY8A 2JKTM 4WEKA 1NLZA 1F98A 4E04A 4II7A 4LPZA 1S4RA 3RFBA 3RH8B 4EU0A 4IHQA 3NHQA 2VA0A 5HDCA 4EW7A 5LBRA 3JVVA 3C2WA 2R78A 3SW1A 3MXQA 1GSXA 1T18A 5KIZA 3K2NA 4NXFA 2OAQ1 4AFIA 1TS8A 3F1NA 1XJ2A 4WELA 5L8MA 3P01A 3H82A 1YAXA 4UQIM 2P04A 4NXGA 2VGLM 2OOLA 3FG8A 4YOFA 5DF9A 2VJWA 3UMDA 2O9AA 4HIAA 2INWA 3LICA 1T1AA 1TS7A 4L9EA 2CMNA 3A0RA 2Z6CA 3PBTA 1DRMA 2KLIA 3E0YA 3LR0A 1P9RA 4JGPA 5F68A 4DJ3A 5A8BA 2VZWA 1ODVA 2W3GA 1Y28A 2PDRA 1OT9A 2W3FA 2XROA 4EEUA 1P9WA 4FOFA 2GJ3A 4IUHA 3TW8A 4O8GA 3TJZC 2YKFA 1JNUA 3IS2B 4MN7A 4Y5FA 2EWWA 3TRCA 4BBTA 4L9FA 1G28A 1EW0A 4I3JA 4BBVA 4I38A 4MN5A 2ZMVA 5TJJA 4WN5A 2W1TA 2QWSA 2JKRM 5TBMA 3MQQA 3EEHA 3MFXA 3PBRA 4G3VA 4EXOA 4XT2A 3H7WA 1H8MA 3JVUA 5C5KA 5CX7A 4B9OA 4KUOA 2W1TB 3KSFA 4HOIA 4MCWA 1TD5A 3S7PA 5IU1A 3D72A 2O99A 2ZBBA 3KYQA 2VKSA 3H9WA 3OCNA 3IS2A 3PXPA 1GSWA 2D01A 2VX8A 4YWZA 5HWVA 5J4EA 1ZHHB 4GS9A 3NOTC 5HZHA 3LR3A 3LIBA 1UWPX 2P7JA 2ZMFA 3PBNA 1IFQA 5AVEA 5F5YA 2PYRA 2P08A 2JN7A 4HH2A 3UB7A 4BBUA 2O0YA 1IOUA 3EEAA 4OOMA 5HPIA 2V1BA 5HD3A 4R3AA 2HJEA 3F1NB 2OWJA 4R70A 2NUPC 3CUEA 2XA7M 1T1CA 1ZTUA 4M4XA 4PKYA 1XJ4A 3PBOA 3FPWA 2L1MA 4H6JB 2K31A 2K2NA 5DFXA 3VE3A 2VV6A 1DP9A 4O01A 3K3DA 4OOLA 2ZOIA 3F1PA 2IA2A 1XFNA 3ZQ5A 2HV1A 3B33A 4Z1WA 2GZAA 2A24B 4L9GA 2M1CA 4GW9A 1V9YA 1OTAA 3OC2A 1VB6A 3S7OA 3EQUA 1OTEA 1NLYA 3R4KA 3LIEA 2K7SA 2XRNA 4B93A 3PR6A 2PR5A 4NKPA 4PKYG 2QHKA 2Z6DA 4HNBA 2OWHA 4UQIS 4DMZA 4ZRRA 3H7WB 4JGRA 4ARZB 3CLOA 3R7WB 2YKHA 1UGUA 3TE8A 4LRXC 1NRJA 3KO6A 4HP9A 3MF0A 2HF6A 4I3IA 5IS1A 2VEAA 2QYBA 3ULFA 3IBRA 4CLCA 1YKDA 3LI8A 2QJ5A 3G6OA 2VV7A 4LLOB 3E4PA 1UWNX 3KX0X 2V0UA 5AJGA 3V67A 3T4SA 4Y2FA 4ETZA 3UE6A 1WA9A 1YSQA 2BASA 2V0WA 2Y79A 5F69A 3PYPA 4HJ4A 3T4OA 1OTIA 2O9CA 4PAUA 4EEPA 1TS6A 2XSSA 2PD8A 3EQVA 3GECA 4GJ4A 2LB9A 5HD5A 2WKQA 5AVFA 3F1OB 4MMNA 4HH3A 5DKLA 1LL8A 4WUJA 3H82B 3LYXA 2D02A 2O9BA 1KOUA 3KSGA 3MQ0A 3LIDA 1STZA 4NXBA 3S7NA 4XT2B 5EFWA 2ZOHA 3EOIA 5KSHA 4GCZA 3UB6A 1H3QA 3B47A 1OTDA 3HCYA 5DFYA 5HL6A 2M7VA 3D3OA 2W0NA 2DMWA 4ARZA 2JKRI 3DBAA 2V1AA 3EGDC 2OAP1 3T4LA 3NJAA 4YNRA 4EUVA 4CLCC 2PHYA 4I3AA 2VLGA 1XJ3A 3LUQA 2H28A 3MQOA 2M7UA 1F9IA 3VOLA 5G4ZA 4MDZA 2JHEA 2Y8HA 3LR5A 1G6OA 5I5LA 2I9VA 1S67L 5F6AA 4LRYC 3W2ZA 4FSFA 2KDKA 3CUEC 4G3KA 5HPFA 1D06A 4NXEA 1N9OA 3T4TA 1OPXA 1MZUA 2B02A 3F1PB 2WKPA 2NUTC 3A0SA 3OOVA 2VV8A 5DJUA 3K3CA 4WEJA 3UE3A 4BJPA 4WLAA 5IT5A 4H6JA 1X0OA 4CLCE 4KQDA 2KX6A 3LR4A 4O0PA 4P6ZS 4P6ZM 3OBFA 2J80A 4MN6A 3P7NA 5FL3A 4L0LA 3A0VA 3R7WA 4K08A 3BJNA 2MJ6A 4Q0JA 3NOPC 4R6LA 4KUKA 3GDIA 2GX5A 3T4QA 2PT7A 4NEED 3CI6A 1LT0A 2HJ9C 3T4JA 3ZYTA 2QKPA 3BQ8A 1V9ZA 4EQ1A 1OJGA 4ETXA 5J3WA 2A2LA 3CITA 4RQ9A 4WL9A 3UB9A 2V9AA 3CAXA 2W3DA 3BY9A 4CQHA 3HJIA 5HSQA 1TS0A 1MC0A 4CLCD 2A24A 1S1YA 3FPVA 4JGQA 5MC7A 2PD7A 4KQOA 4F3LB 3O5YA 5DJTA 4Y3IA 3LIAA 3FC7A 4LRZE 3C8CA 3E4OA 2FZ0A 4Q0HA 4DJ2A 2EWVA 3PBSA 3T50A 3IBJA 3KSHA 4IUKA 4R38A 2J3WA 1OTBA 3CWFA 4WF0A 3NOUC 1VHMA 5HDSA 1F5MA 3OCLA 2J3TD 2GNXA 1W63M 3OLOA 3C38A 3UMEA 4HY8A 1DP8A 1LSWA 5G4YA 1MKMA 4I5SA 5TBMB 1P0ZA 3F1OA 3E98A 1LSXA 2B18A 1TF1A 5HWWA 3EWKA 4F3LA 4HHDA 1XJ6A 4GHIB 4UEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA2 A;  3MMH A;  3E0Y A;  2KLI A;  2M7U A;  3ZQ5 A;  3S7Q A;  2VZW A;  2W3G A;  4MDZ A;  2Y8H A;  2LB5 A;  2W3F A;  4Z1W A;  2XRO A;  5I5L A;  4IJG A;  4GW9 A;  4LRY C;  4FOF A;  3W2Z A;  4IUH A;  4O8G A;  3S7O A;  4G3K A;  5HPF A;  4Q0I A;  3R4K A;  4MN7 A;  4Y5F A;  3TRC A;  2XRN A;  3OOV A;  2W3E A;  2G7U A;  2HGV A;  1YSP A;  5TJJ A;  2W1T A;  4DMZ A;  4ZRR A;  4O0P A;  4GLQ A;  4G3V A;  3OBF A;  5K5B A;  4G3W A;  4LRX C;  5C5K A;  2W3H A;  3KSI A;  3KO6 A;  3BJN A;  4Q0J A;  3MF0 A;  2KOI A;  3NOP C;  4R6L A;  2VEA A;  2QYB A;  2W1T B;  3IBR A;  3KSF A;  2W1R A;  4MCW A;  2GX5 A;  1TD5 A;  3S7P A;  1YKD A;  3CI6 A;  3G6O A;  2O99 A;  2VKS A;  4ETX A;  5AJG A;  4ME4 A;  3CIT A;  4Y2F A;  4RQ9 A;  4ETZ A;  2W3D A;  1YSQ A;  2Y79 A;  4CQH A;  3NOT C;  5HSQ A;  2O9C A;  1MC0 A;  4PAU A;  3VV4 A;  4DN0 A;  4BWI A;  2XSS A;  2ZMF A;  4QPR A;  3LFV A;  2LB9 A;  3O5Y A;  4Y3I A;  4E04 A;  4LRZ E;  2O0Y A;  4MMN A;  3EEA A;  3RFB A;  4EU0 A;  3NHQ A;  5HPI A;  4Q0H A;  5LBR A;  2O9B A;  3IBJ A;  3KSH A;  4IUK A;  3C2W A;  3KSG A;  3MQ0 A;  3S7N A;  1STZ A;  4R70 A;  1VHM A;  3NOU C;  1ZTU A;  1F5M A;  3K2N A;  3HCY A;  2M7V A;  5DFY A;  5HL6 A;  3D3O A;  5L8M A;  2K31 A;  1MKM A;  2K2N A;  3DBA A;  2OOL A;  5DFX A;  4YOF A;  3E98 A;  4O01 A;  2VJW A;  2B18 A;  1TF1 A;  2O9A A;  4YNR A;  4EUV A; 
#chains in the Genus database with same CATH topology
 4HP4 A;  3S1Y A;  4DF6 A;  2EA9 A;  3BM6 A;  4R4R A;  1NWZ A;  3G2Y A;  3MZE A;  4HJ6 A;  3ZNT A;  2FH5 A;  3WRT A;  3HUO A;  1BUL A;  4Q0I A;  1PWC A;  3T1R A;  5FAS A;  4CLC B;  4U0T A;  3O88 A;  2W3E A;  1XFQ A;  3HBR A;  4WMC D;  3V5M A;  5DKK A;  4E3I A;  4GZB A;  3VMA A;  3HJK A;  3VP4 A;  4GLQ A;  5K5B A;  4G3W A;  3LEQ A;  5E2F A;  1ACF A;  1T1B A;  1NZO A;  1S1Z A;  4HJ3 A;  5A91 A;  1N9L A;  2W1R A;  2PU2 A;  1TEM A;  1OJ5 A;  1PIO A;  1LSV A;  2WAD A;  5CEB A;  5DVA A;  2Y2J A;  4EER A;  1T19 A;  3QHY A;  5HAQ A;  3BQA A;  5J8X A;  3SS3 A;  1CEF A;  2Y2K A;  4HQA A;  4DN0 A;  3IH8 A;  3LFV A;  2JKT M;  4II7 A;  4KZ7 A;  3Q1F A;  3RFB A;  2VA0 A;  3LY3 A;  5HDC A;  4OP5 A;  2R78 A;  2XLN A;  3OPP A;  4IVI A;  2OAQ 1;  4X69 A;  3F1N A;  3UE0 A;  3E2L A;  3WS1 A;  1XGJ A;  4NXG A;  3C4P A;  3DTK A;  3FG8 A;  2JCH A;  5DF9 A;  3UMD A;  4OON A;  4HIA A;  2INW A;  3A3J A;  1TS7 A;  4L9E A;  1ES3 A;  4E3K A;  1DRM A;  3KYE A;  1L0F A;  2W3G A;  2W3F A;  1KE0 A;  2Y59 A;  4FH2 A;  1P9W A;  2GJ3 A;  4IUH A;  1NYM A;  4DKI A;  3FZC A;  1AXB A;  1KE4 A;  4S2I A;  1HZO A;  3GQZ A;  4MN7 A;  3ZCZ A;  3Q81 A;  3TRC A;  3GRJ A;  3SH7 A;  3HRE A;  2PU4 A;  4ID4 A;  1EW0 A;  4I3J A;  4OP8 A;  5TJJ A;  2W1T A;  1KVM A;  2JKR M;  5TBM A;  3EEH A;  3ZFZ A;  3PBR A;  1FSY A;  4R4S A;  4ESP A;  4KUO A;  1CQA A;  5FDS A;  2XEP A;  1IYO A;  2O99 A;  3H9W A;  1GSW A;  2D01 A;  2V1Z A;  2VX8 A;  4YWZ A;  1CEG A;  3LIB A;  1UWP X;  2P7J A;  3BFG A;  4N1H A;  1CK3 A;  3FWL A;  3A3F A;  1XGI A;  2P08 A;  4BBU A;  2O0Y A;  3NIA A;  4NK3 A;  5HPI A;  2QPN A;  3ZVW A;  2V1B A;  4U3T A;  5HD3 A;  2HJE A;  5CHM A;  3CHW P;  4N9L A;  4RYE A;  3F1N B;  4R70 A;  1ZTU A;  4P87 A;  5L2F A;  2BG1 A;  4HBU A;  1XJ4 A;  3FPW A;  2L1M A;  2JE5 A;  2XR0 A;  5GLD A;  4OPY A;  3QP8 A;  5CHU A;  4Y0U A;  5FDH A;  2Y2G A;  3CMZ A;  3IXD A;  1VB6 A;  2J9P A;  3NCK A;  3O87 A;  1NLY A;  1VM1 A;  1Z09 A;  3LIE A;  4IED A;  2K7S A;  2XRN A;  4B93 A;  2PR5 A;  3U4L P;  4KG6 A;  5HFO A;  4Y0O A;  2Z6D A;  2EXB A;  4UQI S;  4DMZ A;  3H7W B;  4JGR A;  1EI5 A;  3TE8 A;  2QZ6 A;  1NRJ A;  4DXC A;  4F94 A;  3ZG8 B;  2HF6 A;  5IS1 A;  4R1G A;  1D1J A;  3ULF A;  4X1M A;  5FQI A;  3FV7 A;  3AGF A;  5FQQ A;  1K0K A;  2V0U A;  5FQM A;  4A5R A;  2R9W A;  1J9M A;  4PM5 A;  4ETZ A;  3A3I A;  1MWR A;  2RL3 A;  3PYP A;  1OTI A;  2O9C A;  4PAU A;  2I72 A;  3GEC A;  2PD8 A;  1TVF A;  2HP5 A;  2ZLY A;  5HD5 A;  5TR7 A;  1IYP A;  3F1O B;  4MMN A;  4HH3 A;  3NBL A;  5AQ7 A;  3CZD A;  4ZAM A;  3H82 B;  2O9B A;  5I94 A;  4QD4 A;  5CGS A;  3KSG A;  3S7N A;  4NXB A;  2OV5 A;  3EOI A;  3S4X A;  5KSH A;  2ZC3 B;  3HCY A;  4GD8 A;  4JBF A;  4OKP A;  5A93 A;  4K91 A;  1HD8 A;  2JBF A;  2X71 A;  3TOI A;  4YNR A;  3NI9 A;  2WK0 A;  1KE3 A;  5KMW A;  3VP1 A;  1XXM A;  4OLG A;  2J9O A;  1JTG A;  2I9V A;  1FQG A;  3V3S A;  3HLG A;  4FSF A;  1FR1 A;  3W4Q A;  1D06 A;  1SKF A;  4NXE A;  2A3U A;  1OPX A;  2H0T A;  3F1P B;  4S2N A;  4CJN A;  5IT5 A;  4MEZ A;  4H6J A;  4P6Z M;  4LV2 A;  3IWO A;  3P7N A;  3UPO A;  5AQA A;  5FL3 A;  3NDG A;  3OPL A;  3A0V A;  4YIN A;  4KUK A;  3GDI A;  4NEE D;  1LT0 A;  2QKP A;  4Y7P A;  5GL9 A;  2H5S A;  5J3W A;  2A2L A;  1K55 A;  4RQ9 A;  4KZ4 A;  1VET A;  4ZBE A;  4QY6 A;  3SH9 A;  1HTZ A;  1TS0 A;  4CLC D;  1CI8 A;  1IKG A;  4KQO A;  5EVI D;  3G30 A;  3HLB A;  4LRZ E;  4C75 A;  3C8C A;  4UHU A;  3LGO A;  4X1L A;  3ZGA B;  5GHY A;  3ZG9 B;  2P74 A;  4WF0 A;  3NOU C;  5FQ9 A;  2G2W A;  1XA1 A;  4WMC A;  3V50 A;  2AVX A;  1DJB A;  4JKT A;  1LSW A;  4GN2 A;  5GHZ A;  1K25 A;  5TBM B;  2ZQA A;  3M2J A;  5HWW A;  4F3L A;  2W27 A;  2WKR A;  3CJM A;  3PBQ A;  3VE4 A;  3IWQ A;  4JF4 A;  1ESU A;  1IEM A;  1DP6 A;  1LL5 A;  5CRF A;  4IBX A;  4QU3 A;  2XF3 A;  1L3L A;  3ICY A;  4PM7 A;  4JGO A;  1E25 A;  1PI5 A;  5FEF A;  3L9K A;  1GSV A;  2B5R A;  1P97 A;  2EFX A;  1H5X A;  4OH0 A;  1OT6 A;  4RVA A;  3KYZ A;  1JWP A;  2WKI A;  3E2K A;  3T4K A;  3BW6 A;  1S66 L;  1YLT A;  4EQI A;  1D7E A;  4B4X A;  3SS5 A;  2L4R A;  2BLS A;  2Q9M A;  3B42 A;  4GDB A;  2PR6 A;  4I39 A;  3VV4 A;  4BWI A;  5HAI A;  4HI4 A;  1N9N A;  1NLZ A;  4E3L A;  3CPT B;  5F83 A;  4JLF A;  3LO7 A;  4WM9 A;  1S4R A;  4Z9Q A;  4IHQ A;  1H8Z A;  1RP5 A;  4EW7 A;  5LBR A;  2WGV A;  3JVV A;  3C2W A;  3SW1 A;  5FSR A;  5FAT A;  3HLC A;  5HAP A;  1XJ2 A;  1L0G A;  3DWK A;  3P01 A;  1YAX A;  2VGL M;  2OOL A;  4ZDX A;  2O9A A;  4MNR A;  3A0R A;  2Z6C A;  3PBT A;  3VFF A;  1F2K A;  2VZW A;  1Y28 A;  2PDR A;  5E2E A;  3O86 A;  3QP6 A;  3TW8 A;  3WS2 A;  4OOY A;  4XUX A;  4L9F A;  2PAV P;  1BLS A;  3UNW A;  2ZMV A;  1TDG A;  3GMW A;  3MFX A;  4PM6 A;  2P9V B;  1XKZ A;  4EXO A;  3GTC A;  5C5K A;  3QP4 A;  1DJC A;  4RX2 A;  1NY0 A;  4B9O A;  3IXG A;  3KSF A;  4LV0 A;  2DCF A;  3D9Y A;  2ZBB A;  3IF6 A;  2WYX A;  2VKS A;  4WZ4 A;  2XD1 A;  5EPH A;  3D4F A;  3OCN A;  5CXW A;  4DDY A;  3NOT C;  2XQZ A;  5HZH A;  3LR3 A;  3WS5 A;  2E8J A;  3IF6 C;  3WRZ A;  1IEL A;  2XFT A;  1IFQ A;  4EBN A;  2X02 A;  5F5Y A;  1GCE A;  2JN7 A;  4HH2 A;  1IOU A;  3EEA A;  1PWD A;  3M2K A;  4R3A A;  4MBF A;  1SZV A;  3DTM A;  2OWJ A;  3CUE A;  4M4X A;  4EBP A;  1BTL A;  2QMI A;  3ZHH A;  4HEF A;  1BLC A;  4S2K A;  1BLP A;  4H6J B;  3RXX A;  3DTE A;  5F82 A;  1PWG A;  2VV6 A;  1S6R A;  2HP6 A;  3K3D A;  3F1P A;  3CPT A;  1XFN A;  3OPH A;  4JXW A;  4Z1W A;  1K4E A;  3G32 A;  1V9Y A;  1L2S A;  3AGE A;  1M40 A;  1YLP A;  2J7V A;  4YFM A;  1W8Y A;  2UV0 E;  4NKP A;  3S22 A;  4KG5 A;  4S2N C;  3N6I A;  2JKG A;  3BEC A;  3CLO A;  2EXA A;  4JXS A;  1ALQ A;  1PZO A;  5L10 A;  3KO6 A;  3C7V A;  4HP9 A;  4R0Q A;  4I3I A;  1GHI A;  2QYB A;  3M6B A;  1W79 A;  5DTT A;  4CLC A;  2QJ5 A;  3LI8 A;  4LLO B;  1KGF A;  3T4S A;  1G5U A;  3IX4 A;  3Q7V B;  3UB5 P;  3UE6 A;  1YPR A;  1WA9 A;  1YSQ A;  2BAS A;  1SHV A;  4CPK A;  5F69 A;  3ITB A;  3T4O A;  3M6H A;  4HJ4 A;  1FIL A;  2EX8 A;  1H0M A;  2LB9 A;  2ZC7 A;  2WKQ A;  1ONG A;  3ZDJ A;  2ZD8 A;  1Y54 A;  4ZTK A;  1G68 A;  3OZH A;  1KOU A;  1YMS A;  1K6S A;  4XT2 B;  1YLZ A;  2ZOH A;  5HW3 A;  3V3R A;  4QY5 A;  5KSC A;  4ZJ1 A;  2M7V A;  1KDW A;  1NJ4 A;  3D3O A;  2W0N A;  4KZ3 A;  2ZC6 B;  4ARZ A;  4KZ6 A;  2Y91 A;  2JKR I;  2WGW A;  3DW0 A;  3NJA A;  2PHY A;  1AWI A;  1L0D A;  3TSG A;  3A3E A;  5FQK A;  1MY8 A;  4E3J A;  2JHE A;  5I5L A;  3SZT A;  3UDF A;  5F6A A;  4LRY C;  3W2Z A;  1VET B;  1JWV A;  2KDK A;  1FOF A;  1MXO A;  2RCX A;  3CUE C;  1OME A;  4G3K A;  4MBH A;  5HPF A;  4S2L A;  2H10 A;  2WKP A;  2NUT C;  3A0S A;  1ES2 A;  5DJU A;  3K3C A;  3PAE A;  1VEU A;  4CLC E;  2ZQ9 A;  4KQD A;  2KX6 A;  2WZZ A;  1EWZ A;  1YM1 A;  5AQ9 A;  4BLM A;  1A0K A;  3R7W A;  4K08 A;  1WYC A;  3BJN A;  4Y0T A;  1J3W A;  2E8I A;  4X55 A;  2WUQ A;  5HL1 A;  4H8R A;  4N1X A;  3RJU A;  3BQ8 A;  1V9Z A;  2C5W B;  4IBR A;  4WL9 A;  3CAX A;  2W3D A;  1IKI A;  3PTE A;  1YLJ A;  1L0E A;  5EVI A;  3HLE A;  4F3L B;  5E2H A;  2OSU A;  3FC7 A;  4DRT A;  4Q0H A;  4P85 A;  4B88 A;  3T50 A;  3IBJ A;  1OTB A;  3CWF A;  2CC1 A;  5HDS A;  3OCL A;  2J3T D;  2GNX A;  3N8S A;  3N7W A;  4HY8 A;  4PPR A;  1NXY A;  4PMA A;  4E3N A;  3IHA A;  1K38 A;  4OQ0 A;  4DE2 A;  3F1O A;  4RA7 A;  1LSX A;  4QWO A;  4KZ8 A;  3EWK A;  4X25 A;  3ZNY A;  2ZMA A;  1HVB A;  4GHI B;  4UEY A;  4OPZ A;  3MMH A;  1KDS A;  3S7Q A;  4UA6 A;  5FI7 A;  3C7U A;  1K55 C;  1WE4 A;  2ZM0 A;  1ZC2 A;  2WAE A;  4IJG A;  4WZ5 C;  4EES A;  3LIF A;  4BD0 A;  2VGL S;  3BFE A;  3VFH A;  4QHC A;  3UB8 A;  5G18 A;  2HGV A;  2JKT I;  5U47 A;  1YSP A;  5KZH A;  4GNU A;  5J7E A;  2KOI A;  2QJ7 A;  1NZU A;  1ERQ A;  3OPR A;  2J3T C;  2VK3 A;  2XA7 S;  4EET B;  1FR6 A;  3EGX C;  1PW8 A;  4ME4 A;  1E3U D;  1ZKJ A;  3DAV A;  3BWL A;  3I7J A;  1GA9 A;  5TGF A;  2PYP A;  1S4S A;  1FSW A;  4LGW A;  4OLD A;  4QPR A;  4WEK A;  1KVL A;  4E04 A;  4LPZ A;  1RGY A;  4LCL A;  3NHQ A;  3T1Q B;  1K56 A;  4C3Q A;  1FCM A;  2JKF A;  1M6K A;  1SCW A;  1E3U A;  2OLU A;  3MXQ A;  1YT4 A;  1GSX A;  1T18 A;  2EX9 A;  4Y13 A;  1TS8 A;  5BOH A;  1KGG A;  2HPB A;  5L8M A;  3H82 A;  4EBL A;  1RGZ A;  2VJW A;  3LIC A;  4O7D A;  3LCE A;  3E0Y A;  3LR0 A;  1P9R A;  1ODV A;  1OT9 A;  4HES A;  4X53 A;  5HAR A;  5FAQ A;  3ZVT A;  4EEU A;  1ERM A;  3TJZ C;  3IF6 B;  4BQM A;  2YKF A;  1JNU A;  2EWW A;  2HDU A;  1G28 A;  5L09 A;  4BBV A;  4MBK A;  3BFC A;  4JPM A;  2QWS A;  2Y55 A;  3ISG A;  4OQG A;  1H8M A;  3JVU A;  4DE0 A;  4Y17 A;  4LFU A;  5EV0 A;  1SDN A;  4HOI A;  4MCW A;  4Y15 A;  3TG9 A;  2ZQ8 A;  3B3X A;  3IX3 A;  5GLA A;  5CER A;  1PW1 A;  1YMX A;  4K0W A;  5EM0 A;  3BRM A;  4GS9 A;  4P0M A;  2B95 A;  3Q7V A;  2Y2O A;  3PBN A;  5AVE A;  3SS4 A;  4EUZ A;  3IXH A;  4QB8 A;  3UB7 A;  1QMF A;  4OOM A;  3DTI A;  3HUM A;  2XA7 M;  1T1C A;  4PKY A;  3BLS A;  2K2N A;  1I2S A;  1GHM A;  3VE3 A;  4JF6 A;  3MS6 A;  4GDN A;  3NC8 A;  1CF0 A;  4GB7 A;  4OOL A;  2IA2 A;  1Z6F A;  4S2M A;  5F1G A;  4OVD A;  3ZQ5 A;  2ZM2 A;  2HV1 A;  3B33 A;  4WZ5 A;  1LL9 A;  1OTA A;  3OC2 A;  3S7O A;  2IWB A;  3EQU A;  3QP2 A;  3NEC A;  3BLM A;  3C4O A;  2C6W B;  3PR6 A;  1IYQ A;  3QNC A;  3VSK A;  5CHJ A;  3HLD A;  4PKY G;  2QHK A;  4HNB A;  1YQS A;  4ZJ3 A;  4LCM A;  1UGU A;  4BL3 A;  4LRX C;  2HDQ A;  5HX9 A;  4GD6 A;  3SH8 A;  3MKE A;  5L07 A;  2Y2M A;  3MF0 A;  2H0Y A;  2VEA A;  1PNE A;  4FCF A;  4X56 A;  5AQB A;  2FFF B;  1YKD A;  2VV7 A;  3G6O A;  3E4P A;  4FUW A;  3GSG A;  1UWN X;  3KX0 X;  3V67 A;  1FCN A;  4S2J A;  4Y2F A;  3NY4 A;  3Q82 A;  2XH9 A;  3GV9 A;  2Q9N A;  2V0W A;  2HP9 A;  5FAO A;  1TS6 A;  5GLC A;  3IQA A;  3MSH A;  4R3B A;  2WZX A;  3A3D A;  5AVF A;  2EX2 A;  5DKL A;  5M1A A;  4WUJ A;  2PBY A;  2X01 A;  4WYY A;  5EEC A;  3MQ0 A;  3LID A;  3GVB A;  4GCZ A;  3UB6 A;  3B47 A;  1OTD A;  5DFY A;  3VSL A;  1PFL A;  2ZL1 A;  2DMW A;  3DBA A;  2V1A A;  3PAG A;  1LI9 A;  4EUV A;  4NET A;  4CLC C;  4I3A A;  3HVF A;  4DDS A;  3LUQ A;  2H28 A;  2M7U A;  1O7E A;  3VOL A;  1G6A A;  4MDZ A;  3IWI A;  3QP1 A;  4KG2 A;  1G6O A;  2Y2P A;  2WGI A;  4FTX A;  1Y4O A;  3MZF A;  4EWF A;  4N9K A;  3T4T A;  2B02 A;  2XFS A;  1BSG A;  4BJP A;  4WLA A;  3ZG5 A;  3G4P A;  1KGE A;  1X0O A;  2HDR A;  3LR4 A;  2ZJ9 A;  2FFY A;  1K56 D;  2J80 A;  3IH9 A;  1ZG4 A;  2JC7 A;  4L0L A;  5EM1 A;  4M3K A;  1PZP A;  2ZC5 B;  4Q0J A;  3VOZ A;  4R6L A;  3BFF A;  2V2F F;  4KEN B;  1VEU B;  1PI4 A;  3CI6 A;  3CG5 A;  2HJ9 C;  4R23 A;  5FI6 A;  3T4J A;  4E3M A;  1OJG A;  4ETX A;  3UN7 A;  2V9A A;  3BY9 A;  1ESI A;  3HJI A;  5HSQ A;  1MC0 A;  3FPV A;  3BEB A;  2PBD P;  3VP2 A;  5MC7 A;  1K57 C;  2EX6 A;  3O5Y A;  1BLH A;  4Y3I A;  5DJT A;  3LIA A;  4KQR A;  2Y2N A;  1LI0 A;  4DJ2 A;  3PBS A;  2WGW B;  1N9B A;  1SDE A;  3G35 A;  4IUK A;  4R38 A;  5CED A;  2J3W A;  1VHM A;  5TFQ A;  2ZL1 B;  5EUA A;  4KQQ A;  4E6X A;  2V8C A;  3C38 A;  3P98 A;  1BUE A;  3MZD A;  4NG2 A;  5JYO A;  1MKM A;  1P0Z A;  3WS4 A;  2G2U A;  2Y2Q A;  1XJ6 A;  1CJF A;  4KZ9 A;  3W8K A;  1GA0 A;  4GOG A;  3HLW A;  3UO9 A;  2LB5 A;  3ZG0 A;  4BL2 A;  2V8F A;  4GS9 B;  3RTY A;  3WWX A;  1PYY A;  3MR0 A;  5DF7 A;  5HWT A;  4GHI A;  3U2A A;  4XXR A;  2L0W A;  2XD5 A;  3UPP A;  5D3O A;  3T1X A;  1K4F A;  2G7U A;  3IX8 A;  1HLU P;  3C5A A;  4FD8 A;  4BMW A;  5E2G A;  1RCJ A;  1QME A;  1IYS A;  2J8Y A;  2UWX A;  2W3H A;  3KSI A;  3MJQ A;  2Y2L A;  4JXV A;  5M19 A;  1DJA A;  5CGW A;  3G2Z A;  3PHY A;  1XPB A;  1NRF A;  3FKV A;  4DXB A;  4KZ5 A;  5HDD A;  1W63 Q;  1BYW A;  5FAP A;  2DNS A;  3E4Q A;  2ZQD A;  3VP0 A;  1JVJ A;  3C30 A;  3HUN A;  5EVI C;  1H8Y A;  3IHB A;  1S0W A;  3LI9 A;  4PHT A;  4LV1 A;  3QP5 A;  3BFD A;  3BY8 A;  3RXW A;  4R3J A;  1F98 A;  5FI2 A;  4EV4 A;  3RH8 B;  4EU0 A;  1ZG6 A;  1ES4 A;  5DF8 A;  4Q8I A;  1XX2 A;  4P6B A;  4JXG A;  5KIZ A;  3K2N A;  1MPL A;  4NXF A;  4AFI A;  3W4O A;  1W8Q A;  4WEL A;  3T12 B;  3L7H A;  5M18 A;  4K0X A;  4UQI M;  2P04 A;  1MKI A;  2A49 A;  4UA9 A;  1U60 A;  2PRF A;  4YOF A;  2Z2L B;  1ONH A;  1T1A A;  3G31 A;  1JWZ A;  2CMN A;  2KLI A;  4JGP A;  5F68 A;  4DJ3 A;  5A8B A;  5EVE A;  1FIK A;  2XRO A;  4FOF A;  2WAF A;  4O8G A;  1O07 A;  4BEN A;  3IS2 B;  4Y5F A;  4BBT A;  5FEG A;  2Y2I A;  2Q0O A;  2HDS A;  4X68 A;  4I38 A;  4MN5 A;  4WN5 A;  3P09 A;  3MQQ A;  1K57 A;  4G3V A;  2P9V A;  1MWS A;  3UE1 A;  5A90 A;  4XT2 A;  3H7W A;  1JTD A;  3N4I A;  5CX7 A;  5E43 A;  3IT9 A;  2W1T B;  3QNB A;  1TD5 A;  3S7P A;  3NDE A;  5IU1 A;  4DE1 A;  3D72 A;  4B4Z A;  3KYQ A;  1WYB A;  1GHP A;  3IS2 A;  3PXP A;  1CI9 A;  4D60 A;  5HWV A;  5EVI B;  5J4E A;  1ZHH B;  3IF5 A;  2Y2H A;  2IWD A;  4PM9 A;  4IVK A;  4N92 A;  3LEZ A;  2ZMF A;  1XP4 A;  3UY6 A;  2PYR A;  1NYY A;  4X6T A;  5DTS A;  4MLL A;  2HZ5 A;  3Q07 A;  4C6Y A;  3LY4 A;  5EE8 A;  3UDI A;  2NUP C;  2V20 A;  3VOY A;  3ZG7 B;  3PBO A;  2K31 A;  5CTN A;  5DFX A;  4QJG A;  1I5Q A;  1DP9 A;  4O01 A;  4KZA A;  3FKW A;  4E6W A;  4OQH A;  2ZOI A;  2DRW A;  3NUL A;  2GZA A;  2A24 B;  5CGX A;  4L9G A;  2M1C A;  4GW9 A;  3VP3 A;  4DE3 A;  1OTE A;  3R4K A;  2VGJ A;  2WKH A;  5FA7 A;  5EOO A;  2ACG A;  2OWH A;  2BTF P;  3FYZ A;  2WKE A;  1W7F A;  4ZRR A;  4LV3 A;  4ARZ B;  3R7W B;  2YKH A;  5EVL A;  3T1S A;  1MBL A;  1YLW A;  4LEN A;  5F1F A;  3HLF A;  3BYD A;  2EFU A;  2ZM8 A;  3IBR A;  1W5D A;  3HL9 A;  1I2W A;  2OLV A;  3O3V A;  5AJG A;  3JPU A;  2R9X A;  4RX3 A;  2Y79 A;  2ZQ7 A;  2Y4A A;  1Q2P A;  1N4O A;  4EEP A;  3SOI A;  1TDL A;  2IWC A;  2XSS A;  1BT5 A;  3EQV A;  4GJ4 A;  4XUZ A;  5JYP A;  3DWZ A;  5EOE A;  2ZC4 B;  4BD1 A;  1LL8 A;  4E3O A;  3LYX A;  2D02 A;  3IXB A;  1STZ A;  3JYI A;  3N8R A;  5EFW A;  4UA7 A;  1H3Q A;  2Z2M B;  5HL6 A;  3Q7Z A;  3AGD A;  1FCO A;  1Q2Q A;  3EGD C;  2OAP 1;  3T4L A;  5DTK A;  4JF5 A;  3V39 A;  1DY6 A;  4S2P A;  2VLG A;  1XJ3 A;  4OQI A;  3UPN A;  3MQO A;  1F9I A;  5G4Z A;  1MWT A;  2Y8H A;  3LR5 A;  1E4D A;  1S67 L;  3G34 A;  4U0X A;  4PM8 A;  1N9O A;  5CEC A;  5A92 A;  1K54 C;  1MZU A;  3OOV A;  1C3B A;  2VV8 A;  1PRQ A;  4WEJ A;  3UE3 A;  2ZQC A;  3GR2 A;  3W4P A;  4O0P A;  1K6R A;  2VGK A;  4P6Z S;  3MFD A;  1MWU A;  2XK1 A;  3OBF A;  1VQQ A;  4MN6 A;  1K54 A;  1XA7 A;  3MXR A;  2XGN A;  3UDX A;  1LLB A;  4UAA A;  2MJ6 A;  4ZJ2 A;  3NOP C;  3MXS A;  1BZA A;  3N8L A;  2GX5 A;  5FQJ A;  3T4Q A;  2PT7 A;  3ZYT A;  4EQ1 A;  1ES5 A;  3CIT A;  3UB9 A;  3WS0 A;  4GKU A;  4KZB A;  1LHY A;  4CQH A;  4FH4 A;  2A24 A;  1S1Y A;  4JGQ A;  4OPQ A;  5GHX A;  2PD7 A;  4S2O A;  5GLB A;  3MBZ A;  1SKO A;  3E4O A;  2FZ0 A;  2EWV A;  3ITA A;  5IHV A;  4HBT A;  5CTM A;  3KSH A;  4OPR A;  1YLY A;  1F5M A;  1W63 M;  3OLO A;  3UME A;  1DP8 A;  1ERO A;  5G4Y A;  2XDM A;  4I5S A;  3MKF A;  4D2O A;  2GDN A;  1SKO B;  4WBG A;  3E98 A;  2B18 A;  1TF1 A;  4HHD A; 
#chains in the Genus database with same CATH homology
 3MMH A;  2W27 A;  2WKR A;  4HP4 A;  3S7Q A;  3PBQ A;  3VE4 A;  2EA9 A;  1NWZ A;  4HJ6 A;  2LB5 A;  2FH5 A;  4GS9 B;  3RTY A;  4IJG A;  1DP6 A;  3MR0 A;  4EES A;  5HWT A;  3LIF A;  4GHI A;  4Q0I A;  2VGL S;  3U2A A;  3ICY A;  2L0W A;  4CLC B;  2W3E A;  4JGO A;  3UB8 A;  1XFQ A;  2G7U A;  2HGV A;  2JKT I;  5DKK A;  1YSP A;  1GSV A;  3HJK A;  1P97 A;  4GLQ A;  4BMW A;  5K5B A;  4G3W A;  5J7E A;  1OT6 A;  2W3H A;  3KYZ A;  3KSI A;  1T1B A;  3MJQ A;  3T4K A;  3BW6 A;  1S66 L;  2KOI A;  1D7E A;  1S1Z A;  2QJ7 A;  4HJ3 A;  3PHY A;  1N9L A;  2J3T C;  2W1R A;  2XA7 S;  5HDD A;  1W63 Q;  1BYW A;  1OJ5 A;  4EET B;  2L4R A;  1LSV A;  3EGX C;  4EER A;  4ME4 A;  3BWL A;  3E4Q A;  1T19 A;  3B42 A;  3BQA A;  2PYP A;  2PR6 A;  3C30 A;  4I39 A;  1S4S A;  3VV4 A;  3LI9 A;  4HQA A;  4DN0 A;  4PHT A;  4BWI A;  4HI4 A;  1N9N A;  4QPR A;  3LFV A;  3BY8 A;  2JKT M;  4WEK A;  1NLZ A;  1F98 A;  4E04 A;  4II7 A;  4LPZ A;  1S4R A;  3RFB A;  3RH8 B;  4EU0 A;  4IHQ A;  3NHQ A;  2VA0 A;  5HDC A;  4EW7 A;  5LBR A;  3JVV A;  3C2W A;  2R78 A;  3SW1 A;  3MXQ A;  1GSX A;  1T18 A;  5KIZ A;  3K2N A;  4NXF A;  2OAQ 1;  4AFI A;  1TS8 A;  3F1N A;  1XJ2 A;  4WEL A;  5L8M A;  3P01 A;  3H82 A;  1YAX A;  4UQI M;  2P04 A;  4NXG A;  2VGL M;  2OOL A;  3FG8 A;  4YOF A;  5DF9 A;  2VJW A;  3UMD A;  2O9A A;  4HIA A;  2INW A;  3LIC A;  1T1A A;  1TS7 A;  4L9E A;  2CMN A;  3A0R A;  2Z6C A;  3PBT A;  1DRM A;  2KLI A;  3E0Y A;  3LR0 A;  1P9R A;  4JGP A;  5F68 A;  4DJ3 A;  5A8B A;  2VZW A;  1ODV A;  2W3G A;  1Y28 A;  2PDR A;  1OT9 A;  2W3F A;  2XRO A;  4EEU A;  1P9W A;  4FOF A;  2GJ3 A;  4IUH A;  3TW8 A;  4O8G A;  3TJZ C;  2YKF A;  1JNU A;  3IS2 B;  4MN7 A;  4Y5F A;  2EWW A;  3TRC A;  4BBT A;  4L9F A;  1G28 A;  1EW0 A;  4I3J A;  4BBV A;  4I38 A;  4MN5 A;  2ZMV A;  5TJJ A;  4WN5 A;  2W1T A;  2QWS A;  2JKR M;  5TBM A;  3MQQ A;  3EEH A;  3MFX A;  3PBR A;  4G3V A;  4EXO A;  4XT2 A;  3H7W A;  1H8M A;  3JVU A;  5C5K A;  5CX7 A;  4B9O A;  4KUO A;  2W1T B;  3KSF A;  4HOI A;  4MCW A;  1TD5 A;  3S7P A;  5IU1 A;  3D72 A;  2O99 A;  2ZBB A;  3KYQ A;  2VKS A;  3H9W A;  3OCN A;  3IS2 A;  3PXP A;  1GSW A;  2D01 A;  2VX8 A;  4YWZ A;  5HWV A;  5J4E A;  1ZHH B;  4GS9 A;  3NOT C;  5HZH A;  3LR3 A;  3LIB A;  1UWP X;  2P7J A;  2ZMF A;  3PBN A;  1IFQ A;  5AVE A;  5F5Y A;  2PYR A;  2P08 A;  2JN7 A;  4HH2 A;  3UB7 A;  4BBU A;  2O0Y A;  1IOU A;  3EEA A;  4OOM A;  5HPI A;  2V1B A;  5HD3 A;  4R3A A;  2HJE A;  3F1N B;  2OWJ A;  4R70 A;  2NUP C;  3CUE A;  2XA7 M;  1T1C A;  1ZTU A;  4M4X A;  4PKY A;  1XJ4 A;  3PBO A;  3FPW A;  2L1M A;  4H6J B;  2K31 A;  2K2N A;  5DFX A;  3VE3 A;  2VV6 A;  1DP9 A;  4O01 A;  3K3D A;  4OOL A;  2ZOI A;  3F1P A;  2IA2 A;  1XFN A;  3ZQ5 A;  2HV1 A;  3B33 A;  4Z1W A;  2GZA A;  2A24 B;  4L9G A;  2M1C A;  4GW9 A;  1V9Y A;  1OTA A;  3OC2 A;  1VB6 A;  3S7O A;  3EQU A;  1OTE A;  1NLY A;  3R4K A;  3LIE A;  2K7S A;  2XRN A;  4B93 A;  3PR6 A;  2PR5 A;  4NKP A;  4PKY G;  2QHK A;  2Z6D A;  4HNB A;  2OWH A;  4UQI S;  4DMZ A;  4ZRR A;  3H7W B;  4JGR A;  4ARZ B;  3CLO A;  3R7W B;  2YKH A;  1UGU A;  3TE8 A;  4LRX C;  1NRJ A;  3KO6 A;  4HP9 A;  3MF0 A;  2HF6 A;  4I3I A;  5IS1 A;  2VEA A;  2QYB A;  3ULF A;  3IBR A;  4CLC A;  1YKD A;  3LI8 A;  2QJ5 A;  3G6O A;  2VV7 A;  4LLO B;  3E4P A;  1UWN X;  3KX0 X;  2V0U A;  5AJG A;  3V67 A;  3T4S A;  4Y2F A;  4ETZ A;  3UE6 A;  1WA9 A;  1YSQ A;  2BAS A;  2V0W A;  2Y79 A;  5F69 A;  3PYP A;  4HJ4 A;  3T4O A;  1OTI A;  2O9C A;  4PAU A;  4EEP A;  1TS6 A;  2XSS A;  2PD8 A;  3EQV A;  3GEC A;  4GJ4 A;  2LB9 A;  5HD5 A;  2WKQ A;  5AVF A;  3F1O B;  4MMN A;  4HH3 A;  5DKL A;  1LL8 A;  4WUJ A;  3H82 B;  3LYX A;  2D02 A;  2O9B A;  1KOU A;  3KSG A;  3MQ0 A;  3LID A;  1STZ A;  4NXB A;  3S7N A;  4XT2 B;  5EFW A;  2ZOH A;  3EOI A;  5KSH A;  4GCZ A;  3UB6 A;  1H3Q A;  3B47 A;  1OTD A;  3HCY A;  5DFY A;  5HL6 A;  2M7V A;  3D3O A;  2W0N A;  2DMW A;  4ARZ A;  2JKR I;  3DBA A;  2V1A A;  3EGD C;  2OAP 1;  3T4L A;  3NJA A;  4YNR A;  4EUV A;  4CLC C;  2PHY A;  4I3A A;  2VLG A;  1XJ3 A;  3LUQ A;  2H28 A;  3MQO A;  2M7U A;  1F9I A;  3VOL A;  5G4Z A;  4MDZ A;  2JHE A;  2Y8H A;  3LR5 A;  1G6O A;  5I5L A;  2I9V A;  1S67 L;  5F6A A;  4LRY C;  3W2Z A;  4FSF A;  2KDK A;  3CUE C;  4G3K A;  5HPF A;  1D06 A;  4NXE A;  1N9O A;  3T4T A;  1OPX A;  1MZU A;  2B02 A;  3F1P B;  2WKP A;  2NUT C;  3A0S A;  3OOV A;  2VV8 A;  5DJU A;  3K3C A;  4WEJ A;  3UE3 A;  4BJP A;  4WLA A;  5IT5 A;  4H6J A;  1X0O A;  4CLC E;  4KQD A;  2KX6 A;  3LR4 A;  4O0P A;  4P6Z S;  4P6Z M;  3OBF A;  2J80 A;  4MN6 A;  3P7N A;  5FL3 A;  4L0L A;  3A0V A;  3R7W A;  4K08 A;  3BJN A;  2MJ6 A;  4Q0J A;  3NOP C;  4R6L A;  4KUK A;  3GDI A;  2GX5 A;  3T4Q A;  2PT7 A;  4NEE D;  3CI6 A;  1LT0 A;  2HJ9 C;  3T4J A;  3ZYT A;  2QKP A;  3BQ8 A;  1V9Z A;  4EQ1 A;  1OJG A;  4ETX A;  5J3W A;  2A2L A;  3CIT A;  4RQ9 A;  4WL9 A;  3UB9 A;  2V9A A;  3CAX A;  2W3D A;  3BY9 A;  4CQH A;  3HJI A;  5HSQ A;  1TS0 A;  1MC0 A;  4CLC D;  2A24 A;  1S1Y A;  3FPV A;  4JGQ A;  5MC7 A;  2PD7 A;  4KQO A;  4F3L B;  3O5Y A;  5DJT A;  4Y3I A;  3LIA A;  3FC7 A;  4LRZ E;  3C8C A;  3E4O A;  2FZ0 A;  4Q0H A;  4DJ2 A;  2EWV A;  3PBS A;  3T50 A;  3IBJ A;  3KSH A;  4IUK A;  4R38 A;  2J3W A;  1OTB A;  3CWF A;  4WF0 A;  3NOU C;  1VHM A;  5HDS A;  1F5M A;  3OCL A;  2J3T D;  2GNX A;  1W63 M;  3OLO A;  3C38 A;  3UME A;  4HY8 A;  1DP8 A;  1LSW A;  5G4Y A;  1MKM A;  4I5S A;  5TBM B;  1P0Z A;  3F1O A;  3E98 A;  1LSX A;  2B18 A;  1TF1 A;  5HWW A;  3EWK A;  4F3L A;  4HHD A;  1XJ6 A;  4GHI B;  4UEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...