5HPIA

Crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
AHLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQQDNRVSPYGMHLGNRLPAHATSTGKVLLSVLDREVQIEWIEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGVIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVLPLLRNTANELRNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p-hydroxybenzoate hydroxylase transcriptional activator
publication title A microbial sensor for organophosphate hydrolysis exploiting an engineered specificity switch in a transcription factor.
pubmed doi rcsb
source organism Acinetobacter baylyi str. adp1
molecule tags Transcription
total genus 40
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hpiA00
2W1TA 1MC0A 2W3EA 2QYBA 5TJJA 3ZQ5A 5HSQA 2VZWA 1MKMA 4Z1WA 4ETZA 2Y8HA 2KLIA 3VV4A 2K2NA 3S7OA 4IJGA 4LRZE 1TD5A 2IA2A 2O9AA 1STZA 3HCYA 4G3KA 4Y5FA 3MMHA 3KSIA 4IUHA 4EUVA 4DMZA 5L8MA 2O9CA 3OBFA 3KO6A 3IBRA 4O01A 2W3DA 4IUKA 3DBAA 3NOPC 3S7NA 2W3GA 2O0YA 2W1RA 4FOFA 2G7UA 3NOUC 4DN0A 3W2ZA 4CQHA 1ZTUA 4QPRA 4MMNA 4PAUA 1F5MA 4O0PA 4GLQA 4YNRA 2M7UA 3LFVA 4Q0IA 3S7QA 2W1TB 3D3OA 2W3FA 5AJGA 2GX5A 5I5LA 2O9BA 3S7PA 5HL6A 3R4KA 3E98A 4GW9A 5LBRA 3MF0A 4LRYC 3KSHA 5DFYA 2XSSA 4G3WA 2ZMFA 3CI6A 2B18A 4ME4A 3E0YA 3EEAA 2LB9A 2VJWA 3C2WA 4MDZA 4BWIA 3IBJA 1YKDA 5HPFA 2K31A 4O8GA 5K5BA 3RFBA 4R6LA 2KOIA 2LB5A 4Y2FA 5DFXA 5C5KA 4EU0A 2OOLA 3G6OA 3O5YA 4R70A 2M7VA 3OOVA 2XRNA 4LRXC 3MQ0A 3CITA 4MN7A 3BJNA 4ETXA 3KSFA 1YSQA 4RQ9A 4Q0JA 2W3HA 4ZRRA 3KSGA 2VEAA 3NHQA 4MCWA 4E04A 3NOTC 5HPIA 1YSPA 1TF1A 4Q0HA 2Y79A 4G3VA 4Y3IA 2O99A 3TRCA 2HGVA 2XROA 4YOFA 3K2NA 1VHMA 2VKSA
chains in the Genus database with same CATH superfamily
1U60A 1SDNA 5DJUA 2K2NA 2GZAA 2ZQDA 1JWPA 5F82A 3C30A 4LLOB 3C5AA 3NULA 1STZA 3DAVA 1BSGA 4IUHA 5A92A 5L8MA 1ESIA 1V9ZA 5GLDA 2DCFA 3IXBA 4WUJA 4D2OA 4EBLA 2M1CA 2OLVA 1PW1A 4NXFA 4DN0A 4DF6A 1GHPA 4U0XA 4MMNA 4PAUA 4PPRA 2XA7M 3N6IA 4MBFA 1TS0A 2BLSA 1P9RA 2P08A 4XT2A 4OPYA 2ZQ9A 3S7QA 3CG5A 2Y2KA 5CGSA 2VV7A 4JKTA 2ZMVA 4LCLA 2H5SA 3IS2B 4G3WA 4GB7A 3CI6A 4CJNA 4PM5A 1YLPA 4CLCB 2OWJA 5CRFA 4HIAA 1K57C 2WUQA 1FQGA 1OTEA 2PR5A 4R38A 5JYPA 2Y91A 2UV0E 3HLWA 4U3TA 2DRWA 1TS7A 3CMZA 4IVIA 3MQ0A 4KZ7A 4JPMA 3ITBA 3UE3A 5IHVA 2Y59A 4JXSA 1N9BA 3HJKA 5EPHA 3S1YA 4NK3A 1S67L 3NHQA 3NOTC 3R7WB 3C7UA 4WYYA 3UO9A 5GHYA 1VHMA 5TFQA 4BD0A 3MSHA 4ETZA 1K56D 2L4RA 2VGLM 5E2GA 3ZDJA 4HEFA 1Z6FA 4R3BA 1BYWA 2W27A 1KVMA 1Z09A 4R0QA 1W7FA 3NBLA 1LSVA 3DBAA 3Q7VA 3GTCA 3VE3A 1IELA 4DXBA 1YLYA 1P0ZA 3W8KA 3PBOA 5EVID 4O0PA 3LFVA 2W0NA 1OJGA 1T1BA 4M4XA 3WS0A 2O9BA 4LENA 3S7PA 5EVIA 2KX6A 3TJZC 1L0GA 4EV4A 4Y17A 4UA9A 3NY4A 4DE0A 3TSGA 2D02A 4IBXA 4S2NA 3UNWA 1S1YA 3H82A 2ZQ7A 1BZAA 2V8FA 3KSFA 1BTLA 4DJ3A 3S4XA 4FSFA 3C38A 3GR2A 3MZFA 4ZRRA 3IWOA 3KX0X 1MKIA 2QHKA 1K4FA 2V9AA 4ZJ3A 3E2KA 2J8YA 4Q0HA 3IHBA 4Y3IA 2WADA 2HP6A 4JGRA 2ZQAA 5CERA 4DRTA 2Y8HA 3P01A 3HLBA 2QMIA 2V0WA 1CK3A 2L1MA 1Y28A 1GA9A 4JGQA 5BOHA 1OTDA 1PNEA 2QJ5A 1KOUA 2Z6DA 2Y2PA 4Y5FA 3HLEA 3KSIA 1KVLA 5DF8A 2Y55A 3EOIA 1NJ4A 4RYEA 4FOFA 3N8RA 4H6JA 1W63M 1YPRA 1NXYA 3NOUC 4DDSA 1LSWA 2K7SA 5EVEA 3ZFZA 4EBPA 3BQ8A 2W1TB 1QMEA 3IT9A 2WAFA 3H7WA 5HL6A 3ZYTA 3E98A 2HF6A 4KZ8A 4GN2A 3E4PA 4JF5A 3F1PA 3HL9A 3T12B 2ZC7A 2LB9A 4I5SA 4U0TA 2JKFA 1N4OA 3G35A 2CMNA 4E3NA 3FYZA 2LB5A 3OZHA 1GHMA 3CLOA 2OOLA 1LI9A 1UWPX 3DTEA 4L9FA 4QY5A 1SKOB 2M7VA 1S4RA 1PWCA 4LV3A 3LEQA 1CI9A 1MPLA 2HP5A 1W63Q 3GSGA 4MN7A 3B47A 2EWWA 4N9LA 3A0RA 4RQ9A 4OP8A 4OOYA 1X0OA 2Y2OA 1ES2A 2VEAA 4S2PA 3BM6A 1HVBA 1D06A 4C6YA 4I38A 1XJ3A 4WELA 2XEPA 5HAPA 4PMAA 3FV7A 5EECA 5GLAA 2KLIA 4E3OA 3EQVA 2PBDP 1SCWA 3BQAA 4LRZE 1P97A 4I3AA 4G3KA 1VEUA 3TE8A 4QJGA 3V5MA 1SDEA 3MFXA 3PYPA 2X71A 2W3GA 4DE2A 3BEBA 4EWFA 2EXAA 3FZCA 3T4SA 4Y0OA 3G31A 4HHDA 4BL3A 2M7UA 4BLMA 3HUNA 3PAEA 3F1NB 4P6ZM 1O07A 4DJ2A 5KSHA 2A2LA 1N9LA 1NLZA 2Y2NA 2ZQCA 4S2IA 2QWSA 3IBJA 1L0DA 2I72A 5FDSA 4ARZB 5K5BA 2EX2A 3GQZA 2L0WA 3LIAA 2UWXA 2HDUA 4UA7A 3DTIA 3VP4A 2XDMA 3SS4A 1K55A 5M19A 5A91A 4GJ4A 1PI4A 3GV9A 3AGFA 3CPTB 3OPHA 2RCXA 1IYOA 1D7EA 4EEPA 2DNSA 1TF1A 4KENB 2QZ6A 4X1LA 1DP9A 4HI4A 2WGWB 1S66L 3DWZA 2JC7A 4QHCA 4DE3A 1L0FA 3NCKA 1LSXA 1S6RA 1F98A 3MFDA 4KZ6A 5U47A 3JPUA 1ERQA 5DF7A 3UN7A 3HBRA 4BENA 1BULA 4KUKA 4KQQA 2BTFP 4WL9A 1VB6A 4ZDXA 1VM1A 1XFNA 4L0LA 1AWIA 3VOZA 1J3WA 3W4QA 3KYEA 2XF3A 3LO7A 3P7NA 1Q2QA 5HW3A 4HBTA 4NXGA 1IOUA 3UE6A 4B4ZA 4L9GA 2WKQA 1ZTUA 5F1FA 4KUOA 4QPRA 4CPKA 5EVLA 1PZOA 1K57A 3VMAA 1H8YA 4GD8A 4LCMA 2Y4AA 4GW9A 1F2KA 4HY8A 1E4DA 1NLYA 4LRYC 3H9WA 4XXRA 2XK1A 4NETA 1V9YA 3UB9A 5HWTA 3F1OB 1M6KA 1CF0A 2VA0A 5HFOA 1UGUA 1PRQA 4R4SA 4K0WA 2H10A 1OPXA 3G6OA 3RTYA 3SW1A 2Y2JA 3CHWP 3IX3A 1MZUA 3C8CA 1NYYA 3LICA 1ODVA 3IF5A 3U4LP 3T4OA 3FKVA 4OP5A 2Z2MB 1PIOA 4O7DA 1NRJA 4EBNA 5FATA 1ALQA 5EUAA 3MXRA 2ZJ9A 4ZBEA 3IF6A 1H8ZA 1BUEA 3E2LA 4OQIA 3MKFA 2OV5A 1LHYA 3TG9A 3IH9A 5AQAA 4E6WA 2FFFB 3C7VA 4B93A 1UWNX 1G28A 1K0KA 4C75A 1JTGA 2J9PA 3MXQA 4FUWA 3BW6A 1W8YA 3SH8A 2PU2A 1GSVA 3HUMA 3ZG0A 5EV0A 2XGNA 1TS8A 1K38A 1ZC2A 2V1ZA 3N4IA 3NJAA 1BLCA 4D60A 3DW0A 4LV1A 3UB6A 2P9VA 3QP8A 1N9OA 3BLSA 4FCFA 3G30A 1IYPA 1XP4A 4ZJ1A 2VGJA 3QNCA 3LIFA 4HP9A 1KGFA 3ZG8B 2ZOHA 2Y2MA 2WZZA 4X69A 3D9YA 3LR0A 4X56A 5DTTA 4BWIA 1HZOA 1YKDA 4BQMA 4Y2FA 3OC2A 5C5KA 5KSCA 4S2MA 3QNBA 5FAOA 5HDCA 4E3IA 2HV1A 1TDLA 4MNRA 4ZJ2A 1ZG4A 3LCEA 3OLOA 3BJNA 4UQIS 3VSLA 4GDNA 3OPPA 2W3HA 1FR6A 2PDRA 4GDBA 1W8QA 1E3UD 1QMFA 2Y2LA 3CUEC 2Y79A 1E25A 1KDWA 2JKRM 5F5YA 2JKRI 1E3UA 2H0TA 2H28A 4N1HA 1MY8A 5TJJA 1BLPA 4CLCD 5FQIA 5A90A 5HD5A 2IA2A 3KYZA 2IWDA 3MMHA 4UHUA 4OVDA 4CLCA 5FQKA 3OBFA 3MR0A 3IBRA 3HUOA 3N8SA 4Q8IA 1W5DA 1YMXA 1FSWA 2Z6CA 3HREA 2EFXA 2J7VA 3NC8A 3QP1A 4RA7A 5F1GA 3P98A 5FL3A 3M6BA 2XQZA 3W2ZA 3UDFA 2ZC3B 4IVKA 4HBUA 5J8XA 5F6AA 3BFCA 5AVEA 4BMWA 2X02A 3VP2A 1CEFA 4KZ4A 1K56A 3RH8B 3R7WA 1S4SA 5LBRA 3WRTA 1JWVA 3N8LA 5HX9A 2B18A 2RL3A 3LR5A 3E0YA 3PHYA 3C2WA 3BFEA 2XFTA 1K54A 3ICYA 3RFBA 1C3BA 3PBSA 3LYXA 4P85A 5E43A 5DF9A 4R1GA 3O5YA 2MJ6A 2WGIA 5E2HA 3VP0A 4LRXC 1PWGA 3CITA 3CZDA 5KMWA 1YSQA 1T1CA 1D1JA 5I94A 2WAEA 2HPBA 1Q2PA 3B33A 2XLNA 3H82B 5HAIA 3VFFA 3CAXA 4Y15A 2V1AA 3EGDC 3S22A 1FIKA 4QWOA 5EM1A 1A0KA 4KZAA 1MKMA 2B95A 2QKPA 4NXEA 4F94A 1XA1A 3RXWA 5L09A 1ES3A 3Q81A 1BLHA 4DMZA 2Y2IA 3KYQA 3UDIA 4O01A 2PD8A 3FPVA 2ZD8A 2O0YA 4R3AA 1XPBA 5F69A 5CTMA 5GLBA 4N9KA 3Q82A 2GJ3A 3T1RA 3MQOA 5DKLA 5GHZA 4YFMA 3VP3A 2EX6A 4CLCE 2FFYA 2E8JA 1KDSA 4H6JB 3B3XA 2WZXA 3O88A 4OOMA 4PKYG 2B02A 4WEKA 5AVFA 5G18A 2INWA 4X6TA 2VJWA 1VETA 3UMEA 5L2FA 3ZG7B 3AGDA 4O8GA 4WZ5C 1DP6A 5F83A 3V50A 4R6LA 1PI5A 1XA7A 3F1PB 3K3DA 3LY3A 4RVAA 4NKPA 5J4EA 5AQ9A 1ES5A 1S1ZA 1Y54A 3HLDA 4Q0JA 5AQ7A 4KG6A 4OPRA 3VFHA 1LL9A 4MCWA 3ISGA 2XA7S 3BLMA 1I2SA 2XD5A 4L9EA 3A0VA 2HDQA 1EROA 1G68A 2Y2GA 3TRCA 2P04A 1OT9A 4LPZA 2W1TA 1S0WA 3UB7A 2PU4A 1DJBA 2IWCA 4WM9A 4X1MA 1G6OA 4QU3A 4K08A 5CEDA 1JWZA 2WKEA 3UE1A 2JKGA 4PHTA 1RGYA 4OOLA 2R9WA 5HAQA 4OLDA 2KDKA 1DRMA 4OPQA 4Y7PA 3IXDA 4IUKA 3IWIA 5FI6A 4EQ1A 1XX2A 1EI5A 5TBMB 1BLSA 1K25A 2V20A 5GLCA 2P7JA 4E3LA 4YNRA 4R23A 2Z2LB 5HDSA 3GMWA 2GNXA 2HJ9C 5G4YA 1F9IA 3W4PA 2C6WB 1EWZA 3JVUA 2IWBA 2V2FF 4QB8A 1JTDA 2EXBA 1O7EA 4WLAA 3V67A 3KSHA 5DFYA 1NY0A 1XGJA 1T18A 3PBTA 1PFLA 5F68A 5HD3A 3I7JA 4EESA 1NZUA 3LUQA 5CHUA 5DVAA 2HP9A 2ZMAA 4GS9B 1ZG6A 4S2NC 2PR6A 3VSKA 3ZVTA 2J3TC 1GHIA 4UAAA 1DJCA 1YT4A 1AXBA 5KIZA 1ZKJA 1M40A 1MWUA 3ZGAB 4F3LB 4FH2A 1MWSA 2OLUA 2B5RA 3F1NA 1MWTA 1MC0A 1YLZA 1OT6A 5IS1A 3K3CA 3FKWA 5CGWA 1FCOA 1OJ5A 5GL9A 4EERA 4X68A 3LR4A 4FTXA 3S7OA 4OKPA 4EUVA 4P6BA 4R3JA 3WS5A 4ARZA 3KO6A 4HQAA 4PM6A 2W1RA 3QP2A 2G7UA 1RCJA 5FAPA 1OTBA 3P09A 4P87A 3A3IA 1MBLA 1WYCA 4S2KA 1TEMA 2OAP1 4MN5A 2VGKA 4GLQA 4WF0A 3DTMA 5DJTA 3CPTA 4B88A 1XXMA 5HARA 1TDGA 3IQAA 3T50A 3T4JA 4Y0TA 1RP5A 4DXCA 1OTIA 3LGOA 4I3JA 4PM8A 1H3QA 3IWQA 2YKFA 4AFIA 1YAXA 5FEFA 2ZOIA 3EEAA 2G2WA 4KQRA 1L2SA 2OWHA 3PBRA 2K31A 3IH8A 3WS1A 5DFXA 4EU0A 3EQUA 3GRJA 3T1XA 2VK3A 3OOVA 4WMCD 3QP5A 3IX4A 3PBQA 1H0MA 1PWDA 1GA0A 1FSYA 3OPLA 3M6HA 4NEED 1LT0A 1OTAA 4JGOA 2I9VA 3TW8A 3PXPA 3V3RA 2A3UA 4WMCA 5D3OA 2HJEA 4BD1A 2H0YA 2ZL1A 4B9OA 4G3VA 3B42A 3SH9A 5KZHA 1G6AA 2HGVA 4HP4A 4S2OA 1YLWA 1NYMA 2VKSA 1XJ4A 2PRFA 3IF6B 5E2FA 2ZC4B 4GHIB 2A24A 1YLJA 5AQBA 4WBGA 2VLGA 3F1OA 4UA6A 3RJUA 2FZ0A 4KZ5A 1LL5A 4Y13A 5HDDA 2ZC6B 3G2ZA 3ZCZA 3GECA 3PBNA 1WE4A 5L10A 4WN5A 1DP8A 4ID4A 5A8BA 3Q07A 4KG2A 3PAGA 4JXVA 4EW7A 2PYRA 1SZVA 2E8IA 3R4KA 4HJ4A 4EQIA 5FASA 4JBFA 3UB5P 2XH9A 2ZMFA 4LGWA 3GVBA 4JF4A 5TR7A 4ME4A 3BY9A 1KE0A 2YKHA 1MWRA 4E3KA 4MDZA 1BT5A 1IFQA 2Q9NA 4B4XA 2J9OA 4GOGA 3DWKA 4Z9QA 1YM1A 4I3IA 3T4QA 2WYXA 2PYPA 4R70A 1XFQA 3MKEA 1K55C 3TOIA 1MXOA 2XRNA 2FH5A 3NDGA 4KG5A 1KGEA 3O87A 4OQHA 2VX8A 5EE8A 3KSGA 4XT2B 4YINA 5HPIA 2ZBBA 3E4OA 5FA7A 2XR0A 4P6ZS 2ZM0A 1NZOA 3W4OA 2JCHA 2O99A 3A3FA 3VOYA 4YOFA 5G4ZA 4GCZA 1OMEA 3ZQ5A 5FI2A 1LI0A 2DMWA 3BY8A 2OAQ1 5TGFA 1IYQA 4KZ9A 2O9AA 3L7HA 3UY6A 3EGXC 2C5WB 1PZPA 2O9CA 4WZ4A 1GCEA 5CEBA 3QHYA 4JLFA 3LY4A 4EETB 2XD1A 1L3LA 1K4EA 1KE4A 1SKFA 5FDHA 5HZHA 4MEZA 4WZ5A 3IS2A 2EA9A 3FWLA 2NUTC 3C4OA 2EFUA 3UE0A 2ZM2A 3IX8A 3A3EA 1J9MA 1ES4A 3M2KA 3BYDA 5FQQA 2JE5A 2BASA 2XSSA 3L9KA 3O3VA 1KGGA 3T4TA 5HPFA 4BBTA 3LIBA 1Y4OA 2P74A 3Q7VB 2X01A 3ZHHA 3ITAA 4Y0UA 1WYBA 4DDYA 5CTNA 5HL1A 1I5QA 4JXWA 4ETXA 1ERMA 3CWFA 3SZTA 5FQJA 1YSPA 5JYOA 3IF6C 2PD7A 1IKIA 5EVIB 1FOFA 3GDIA 3OPRA 5DKKA 4OLGA 1ACFA 2VZWA 3HLFA 4BBUA 4RX2A 4Z1WA 1DY6A 2CC1A 1HTZA 3LR3A 2ZC5B 4HJ6A 3BWLA 1XJ2A 1W79A 1FILA 4II7A 4N92A 5HWWA 4MBKA 5A93A 2V0UA 3CJMA 3MJQA 4HNBA 2V8CA 5CGXA 3LI9A 3NOPC 4X25A 5IT5A 3HLGA 4CQHA 1CQAA 2HDRA 1H5XA 3MZDA 1NWZA 2EX8A 2J3TD 3G32A 2J80A 4E3MA 1PYYA 3D3OA 2WKIA 3ZNTA 4QY6A 3G2YA 3A3JA 2J3WA 3HJIA 2WKHA 3MF0A 1TVFA 1LL8A 2A49A 3LIEA 1JVJA 3C4PA 3JVVA 4RX3A 1G5UA 2VV6A 4JXGA 1ESUA 1XJ6A 4EUZA 2ZQ8A 4N1XA 3D4FA 4PM7A 5FSRA 1VETB 1RGZA 3O86A 4GNUA 3UPNA 5DTSA 3H7WB 4GD6A 2GDNA 4KZ3A 4S2LA 4DKIA 3Q7ZA 2NUPC 3A3DA 3AGEA 1EW0A 2XROA 3K2NA 3PTEA 1WA9A 3QP4A 3MBZA 2HZ5A 5FEGA 4HH2A 4UEYA 4C3QA 1JNUA 4YWZA 3QP6A 3OCNA 1FR1A 3T4KA 3WS2A 3VE4A 4A5RA 3HCYA 3T1QB 3NDEA 4LV0A 4CLCC 3NECA 4R4RA 2W3DA 4KQDA 5L07A 3MZEA 3G4PA 4MLLA 3RXXA 1P9WA 2XFSA 3WRZA 1LLBA 5FAQA 2PBYA 3BRMA 2EX9A 5AJGA 3SOIA 1FCMA 2JBFA 3IHAA 4HESA 3V39A 1CJFA 1SKOA 5MC7A 1VEUB 3U2AA 2WKPA 3UDXA 1IYSA 5EFWA 1K54C 5FQMA 2WK0A 4HOIA 3V3SA 1T1AA 2HDSA 5M1AA 1GSWA 2JN7A 1ZHHB 1T19A 5EVIC 4E3JA 5EM0A 1K6RA 4FH4A 2V1BA 1YMSA 2VGLS 5TBMA 2QPNA 4JGPA 3NIAA 3FPWA 3PR6A 2OSUA 3MXSA 2QJ7A 3FC7A 2W3EA 4NG2A 5HWVA 5EOEA 1N9NA 4I39A 5DTKA 4IBRA 2BG1A 1IKGA 3BFGA 3LI8A 5M18A 3SS3A 4OONA 2R78A 3N7WA 5E2EA 3ZNYA 1FCNA 3S7NA 4FD8A 4UQIM 4GS9A 1XKZA 5EOOA 4KQOA 4X53A 4EXOA 3JYIA 2ZM8A 4H8RA 4P0MA 4BL2A 4Q0IA 4KZBA 1TS6A 5FQ9A 2GX5A 1VQQA 1K6SA 2PAVP 3UPOA 4E6XA 1L0EA 3LEZA 1I2WA 4F3LA 4MN6A 4NXBA 4PM9A 1KE3A 2AVXA 3LIDA 3MS6A 4LV2A 4OQGA 2WKRA 4OH0A 1IEMA 2Q9MA 2KOIA 4PKYA 5CHMA 3DTKA 4MBHA 1HLUP 3T4LA 5CXWA 3Q1FA 3ZVWA 1ONGA 3ZG9B 2ZLYA 1ONHA 2G2UA 2WGWA 2WGVA 1YLTA 2R9XA 3UPPA 2Q0OA 3E4QA 5FI7A 4M3KA 4X55A 3CUEA 2Y2QA 4BJPA 4DE1A 1NRFA 5CHJA 3UB8A 4JF6A 4HH3A 2JKTM 3MQQA 5CX7A 2JKTI 3WS4A 1CI8A 2Y2HA 2QYBA 5HSQA 1SHVA 4GKUA 2ZL1B 1DJAA 3UMDA 3VV4A 4IJGA 5J7EA 1TD5A 4S2JA 3FG8A 3G34A 1CEGA 3HLCA 4K0XA 1HD8A 5GHXA 1XGIA 2JHEA 3IXGA 4GZBA 3WWXA 2A24B 2D01A 3EEHA 3BFFA 5J3WA 3ULFA 2EWVA 1F5MA 4IEDA 3BECA 4ESPA 2W3FA 3A0SA 5I5LA 2ACGA 3OCLA 5CECA 3SH7A 4IHQA 4XUXA 3NI9A 1H8MA 4K91A 4QD4A 3VP1A 3M2JA 3ZG5A 3BFDA 4OQ0A 4GHIA 4ZTKA 1PW8A 4HJ3A 3HVFA 1YQSA 3SS5A 2PHYA 2P9VB 3D72A 4WEJA 3T1SA 2PT7A 2VV8A 3EWKA 1GSXA 4E04A 5IU1A 3VOLA 4LFUA 4BBVA 4EEUA 3IXHA 4OPZA 4XUZA 4ZAMA
chains in the Genus database with same CATH topology
4LPZA 2W1TA 3UB7A 1LSXA 1F98A 2VZWA 4BBUA 4Z1WA 3LR3A 1G6OA 4HJ6A 5DJUA 2K2NA 3BWLA 2GZAA 4K08A 3C30A 1XJ2A 4KUKA 4LLOB 4WL9A 1VB6A 1STZA 1XFNA 4L0LA 4PHTA 4IUHA 4II7A 4OOLA 5HWWA 2V0UA 3MJQA 2KDKA 1DRMA 4HNBA 5L8MA 1V9ZA 3P7NA 3LI9A 4IUKA 4WUJA 4NXGA 3NOPC 4EQ1A 1IOUA 5IT5A 2M1CA 3UE6A 4L9GA 4NXFA 5TBMB 4DN0A 4CQHA 2WKQA 1ZTUA 4KUOA 4QPRA 2P7JA 4MMNA 1NWZA 4PAUA 2XA7M 2J3TD 4YNRA 2J80A 5HDSA 2GNXA 1TS0A 2HJ9C 1P9RA 2P08A 4XT2A 5G4YA 3S7QA 1F9IA 3D3OA 3JVUA 2VV7A 4GW9A 2J3WA 4HY8A 3HJIA 4WLAA 2ZMVA 3MF0A 1NLYA 4LRYC 3V67A 1LL8A 3KSHA 3LIEA 5DFYA 3IS2B 3H9WA 4G3WA 3CI6A 3JVVA 1V9YA 2VV6A 3UB9A 5HWTA 1T18A 3PBTA 3F1OB 4CLCB 2VA0A 2OWJA 5F68A 1UGUA 5HD3A 4HIAA 1XJ6A 1OTEA 2PR5A 4R38A 4EESA 1OPXA 3LUQA 3G6OA 3RTYA 3SW1A 4GS9B 1TS7A 1MZUA 3C8CA 3LICA 2PR6A 3MQ0A 2J3TC 1ODVA 3T4OA 3UE3A 1NRJA 3HJKA 1S67L 3H7WB 3NHQA 3NOTC 5KIZA 3R7WB 2NUPC 4F3LB 1EW0A 2XROA 3K2NA 1WA9A 1VHMA 3F1NA 1MC0A 1OT6A 5IS1A 3K3CA 4ETZA 4HH2A 4UEYA 1OJ5A 1JNUA 4EERA 2L4RA 4YWZA 3LR4A 3OCNA 4B93A 3T4KA 1UWNX 3S7OA 2VGLM 1G28A 3VE4A 3MXQA 3HCYA 3BW6A 4EUVA 1BYWA 2W27A 4ARZA 4CLCC 1GSVA 3KO6A 4HQAA 1TS8A 2W3DA 1LSVA 3DBAA 4KQDA 2W1RA 2G7UA 3VE3A 3NJAA 1P0ZA 1OTBA 3UB6A 3PBOA 1P9WA 2OAP1 4MN5A 1N9OA 4O0PA 4GLQA 3LFVA 4WF0A 2W0NA 1OJGA 5DJTA 1T1BA 4M4XA 5AJGA 2O9BA 3S7PA 3T50A 3T4JA 1OTIA 4I3JA 2KX6A 1H3QA 3LIFA 4HP9A 3TJZC 2YKFA 4AFIA 2ZOHA 1YAXA 2ZOIA 3LR0A 3EEAA 5MC7A 3U2AA 2WKPA 2OWHA 4BWIA 5EFWA 1YKDA 3PBRA 2K31A 4HOIA 5DFXA 4Y2FA 3OC2A 5C5KA 4EU0A 3EQUA 2D02A 1T1AA 1GSWA 1S1YA 2JN7A 1ZHHB 3H82A 3OOVA 5HDCA 2HV1A 3PBQA 1T19A 3OLOA 3BJNA 4UQIS 3KSFA 4NEED 4DJ3A 1LT0A 1OTAA 4JGOA 3C38A 2I9VA 4FSFA 2W3HA 4ZRRA 3KX0X 2PDRA 2V1BA 2QHKA 3PXPA 3TW8A 2V9AA 2VGLS 5TBMA 2HJEA 4Q0HA 3CUEC 4B9OA 2Y79A 4G3VA 4Y3IA 3B42A 2JKRM 4JGPA 5F5YA 4JGRA 3FPWA 2HGVA 2JKRI 3PR6A 4HP4A 2QJ7A 2VKSA 1XJ4A 2H28A 3FC7A 2W3EA 5TJJA 5HWVA 2Y8HA 3P01A 4CLCD 2V0WA 1N9NA 2L1MA 1Y28A 4JGQA 4GHIB 2A24A 1OTDA 4I39A 5HD5A 2IA2A 3KYZA 2QJ5A 1KOUA 2VLGA 2Z6DA 4Y5FA 3MMHA 3KSIA 3LI8A 3F1OA 4CLCA 3OBFA 3EOIA 3MR0A 2FZ0A 2R78A 3IBRA 3S7NA 2Z6CA 5HDDA 4FOFA 4H6JA 1W63M 4UQIM 4GS9A 3GECA 4KQOA 3NOUC 5FL3A 3W2ZA 1LSWA 3PBNA 4EXOA 4WN5A 1DP8A 2K7SA 5A8BA 5F6AA 5AVEA 4Q0IA 4BMWA 4EW7A 1TS6A 2W1TB 2PYRA 3BQ8A 2GX5A 3RH8B 3H7WA 5HL6A 3R7WA 3ZYTA 3R4KA 1S4SA 4HJ4A 3E98A 5LBRA 2HF6A 4F3LA 3E4PA 3F1PA 4MN6A 2ZMFA 4NXBA 2B18A 4ME4A 3LR5A 3E0YA 3BY9A 3PHYA 2LB9A 2YKHA 4I5SA 3C2WA 3LIDA 4MDZA 1IFQA 2WKRA 3ICYA 2CMNA 3RFBA 3PBSA 4I3IA 3LYXA 3T4QA 2KOIA 2LB5A 4PKYA 3CLOA 2OOLA 1UWPX 3T4LA 2PYPA 5DF9A 3O5YA 1XFQA 4L9FA 2MJ6A 4R70A 2M7VA 1S4RA 2XRNA 4LRXC 2FH5A 1W63Q 3CITA 4MN7A 3B47A 1YSQA 2EWWA 3A0RA 4RQ9A 1T1CA 3E4QA 2VX8A 3KSGA 4XT2B 1X0OA 2VEAA 5HPIA 2ZBBA 3CUEA 3E4OA 3B33A 3H82B 4P6ZS 4BJPA 3CAXA 1D06A 2O99A 2V1AA 4I38A 1XJ3A 3EGDC 3UB8A 4HH3A 4YOFA 4GCZA 2JKTM 5G4ZA 3MQQA 5CX7A 2JKTI 4WELA 3ZQ5A 2QYBA 5HSQA 1MKMA 2QKPA 4NXEA 2KLIA 2DMWA 3BY8A 2OAQ1 3EQVA 3UMDA 3VV4A 3BQAA 4IJGA 4LRZE 1TD5A 5J7EA 3FG8A 1P97A 4I3AA 2O9AA 3EGXC 4G3KA 3TE8A 4DMZA 2JHEA 3KYQA 2O9CA 3MFXA 3PYPA 4O01A 2PD8A 3FPVA 2W3GA 2O0YA 2A24B 2D01A 3EEHA 4R3AA 4EETB 5J3WA 5F69A 3ULFA 2EWVA 3T4SA 2GJ3A 5HZHA 1F5MA 3IS2A 4HHDA 3MQOA 5DKLA 2M7UA 3F1NB 4P6ZM 2EA9A 4CLCE 2NUTC 2W3FA 3A0SA 4H6JB 5I5LA 3OCLA 4DJ2A 5KSHA 4OOMA 2A2LA 4IHQA 4PKYG 2B02A 4WEKA 5AVFA 1N9LA 1NLZA 1H8MA 2BASA 2XSSA 2INWA 2QWSA 2VJWA 3T4TA 3UMEA 3IBJA 4ARZB 5HPFA 4O8GA 4BBTA 1DP6A 5K5BA 4R6LA 2L0WA 3LIBA 4GHIA 3LIAA 3F1PB 4HJ3A 3K3DA 4NKPA 2PHYA 4GJ4A 5J4EA 3D72A 4WEJA 4ETXA 2PT7A 1S1ZA 4Q0JA 3CWFA 2VV8A 3EWKA 1GSXA 4MCWA 4E04A 1D7EA 2XA7S 5IU1A 1YSPA 3VOLA 1TF1A 4EEPA 2PD7A 1DP9A 4BBVA 4HI4A 4EEUA 4L9EA 3A0VA 3TRCA 2P04A 1S66L 3GDIA 1OT9A 5DKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1T A;  1MC0 A;  2W3E A;  2QYB A;  5TJJ A;  3ZQ5 A;  5HSQ A;  2VZW A;  1MKM A;  4Z1W A;  4ETZ A;  2Y8H A;  2KLI A;  3VV4 A;  2K2N A;  3S7O A;  4IJG A;  4LRZ E;  1TD5 A;  2IA2 A;  2O9A A;  1STZ A;  3HCY A;  4G3K A;  4Y5F A;  3MMH A;  3KSI A;  4IUH A;  4EUV A;  4DMZ A;  5L8M A;  2O9C A;  3OBF A;  3KO6 A;  3IBR A;  4O01 A;  2W3D A;  4IUK A;  3DBA A;  3NOP C;  3S7N A;  2W3G A;  2O0Y A;  2W1R A;  4FOF A;  2G7U A;  3NOU C;  4DN0 A;  3W2Z A;  4CQH A;  1ZTU A;  4QPR A;  4MMN A;  4PAU A;  1F5M A;  4O0P A;  4GLQ A;  4YNR A;  2M7U A;  3LFV A;  4Q0I A;  3S7Q A;  2W1T B;  3D3O A;  2W3F A;  5AJG A;  2GX5 A;  5I5L A;  2O9B A;  3S7P A;  5HL6 A;  3R4K A;  3E98 A;  4GW9 A;  5LBR A;  3MF0 A;  4LRY C;  3KSH A;  5DFY A;  2XSS A;  4G3W A;  2ZMF A;  3CI6 A;  2B18 A;  4ME4 A;  3E0Y A;  3EEA A;  2LB9 A;  2VJW A;  3C2W A;  4MDZ A;  4BWI A;  3IBJ A;  1YKD A;  5HPF A;  2K31 A;  4O8G A;  5K5B A;  3RFB A;  4R6L A;  2KOI A;  2LB5 A;  4Y2F A;  5DFX A;  5C5K A;  4EU0 A;  2OOL A;  3G6O A;  3O5Y A;  4R70 A;  2M7V A;  3OOV A;  2XRN A;  4LRX C;  3MQ0 A;  3CIT A;  4MN7 A;  3BJN A;  4ETX A;  3KSF A;  1YSQ A;  4RQ9 A;  4Q0J A;  2W3H A;  4ZRR A;  3KSG A;  2VEA A;  3NHQ A;  4MCW A;  4E04 A;  3NOT C;  5HPI A;  1YSP A;  1TF1 A;  4Q0H A;  2Y79 A;  4G3V A;  4Y3I A;  2O99 A;  3TRC A;  2HGV A;  2XRO A;  4YOF A;  3K2N A;  1VHM A;  2VKS A; 
#chains in the Genus database with same CATH topology
 1U60 A;  1SDN A;  5DJU A;  2K2N A;  2GZA A;  2ZQD A;  1JWP A;  5F82 A;  3C30 A;  4LLO B;  3C5A A;  3NUL A;  1STZ A;  3DAV A;  1BSG A;  4IUH A;  5A92 A;  5L8M A;  1ESI A;  1V9Z A;  5GLD A;  2DCF A;  3IXB A;  4WUJ A;  4D2O A;  4EBL A;  2M1C A;  2OLV A;  1PW1 A;  4NXF A;  4DN0 A;  4DF6 A;  1GHP A;  4U0X A;  4MMN A;  4PAU A;  4PPR A;  2XA7 M;  3N6I A;  4MBF A;  1TS0 A;  2BLS A;  1P9R A;  2P08 A;  4XT2 A;  4OPY A;  2ZQ9 A;  3S7Q A;  3CG5 A;  2Y2K A;  5CGS A;  2VV7 A;  4JKT A;  2ZMV A;  4LCL A;  2H5S A;  3IS2 B;  4G3W A;  4GB7 A;  3CI6 A;  4CJN A;  4PM5 A;  1YLP A;  4CLC B;  2OWJ A;  5CRF A;  4HIA A;  1K57 C;  2WUQ A;  1FQG A;  1OTE A;  2PR5 A;  4R38 A;  5JYP A;  2Y91 A;  2UV0 E;  3HLW A;  4U3T A;  2DRW A;  1TS7 A;  3CMZ A;  4IVI A;  3MQ0 A;  4KZ7 A;  4JPM A;  3ITB A;  3UE3 A;  5IHV A;  2Y59 A;  4JXS A;  1N9B A;  3HJK A;  5EPH A;  3S1Y A;  4NK3 A;  1S67 L;  3NHQ A;  3NOT C;  3R7W B;  3C7U A;  4WYY A;  3UO9 A;  5GHY A;  1VHM A;  5TFQ A;  4BD0 A;  3MSH A;  4ETZ A;  1K56 D;  2L4R A;  2VGL M;  5E2G A;  3ZDJ A;  4HEF A;  1Z6F A;  4R3B A;  1BYW A;  2W27 A;  1KVM A;  1Z09 A;  4R0Q A;  1W7F A;  3NBL A;  1LSV A;  3DBA A;  3Q7V A;  3GTC A;  3VE3 A;  1IEL A;  4DXB A;  1YLY A;  1P0Z A;  3W8K A;  3PBO A;  5EVI D;  4O0P A;  3LFV A;  2W0N A;  1OJG A;  1T1B A;  4M4X A;  3WS0 A;  2O9B A;  4LEN A;  3S7P A;  5EVI A;  2KX6 A;  3TJZ C;  1L0G A;  4EV4 A;  4Y17 A;  4UA9 A;  3NY4 A;  4DE0 A;  3TSG A;  2D02 A;  4IBX A;  4S2N A;  3UNW A;  1S1Y A;  3H82 A;  2ZQ7 A;  1BZA A;  2V8F A;  3KSF A;  1BTL A;  4DJ3 A;  3S4X A;  4FSF A;  3C38 A;  3GR2 A;  3MZF A;  4ZRR A;  3IWO A;  3KX0 X;  1MKI A;  2QHK A;  1K4F A;  2V9A A;  4ZJ3 A;  3E2K A;  2J8Y A;  4Q0H A;  3IHB A;  4Y3I A;  2WAD A;  2HP6 A;  4JGR A;  2ZQA A;  5CER A;  4DRT A;  2Y8H A;  3P01 A;  3HLB A;  2QMI A;  2V0W A;  1CK3 A;  2L1M A;  1Y28 A;  1GA9 A;  4JGQ A;  5BOH A;  1OTD A;  1PNE A;  2QJ5 A;  1KOU A;  2Z6D A;  2Y2P A;  4Y5F A;  3HLE A;  3KSI A;  1KVL A;  5DF8 A;  2Y55 A;  3EOI A;  1NJ4 A;  4RYE A;  4FOF A;  3N8R A;  4H6J A;  1W63 M;  1YPR A;  1NXY A;  3NOU C;  4DDS A;  1LSW A;  2K7S A;  5EVE A;  3ZFZ A;  4EBP A;  3BQ8 A;  2W1T B;  1QME A;  3IT9 A;  2WAF A;  3H7W A;  5HL6 A;  3ZYT A;  3E98 A;  2HF6 A;  4KZ8 A;  4GN2 A;  3E4P A;  4JF5 A;  3F1P A;  3HL9 A;  3T12 B;  2ZC7 A;  2LB9 A;  4I5S A;  4U0T A;  2JKF A;  1N4O A;  3G35 A;  2CMN A;  4E3N A;  3FYZ A;  2LB5 A;  3OZH A;  1GHM A;  3CLO A;  2OOL A;  1LI9 A;  1UWP X;  3DTE A;  4L9F A;  4QY5 A;  1SKO B;  2M7V A;  1S4R A;  1PWC A;  4LV3 A;  3LEQ A;  1CI9 A;  1MPL A;  2HP5 A;  1W63 Q;  3GSG A;  4MN7 A;  3B47 A;  2EWW A;  4N9L A;  3A0R A;  4RQ9 A;  4OP8 A;  4OOY A;  1X0O A;  2Y2O A;  1ES2 A;  2VEA A;  4S2P A;  3BM6 A;  1HVB A;  1D06 A;  4C6Y A;  4I38 A;  1XJ3 A;  4WEL A;  2XEP A;  5HAP A;  4PMA A;  3FV7 A;  5EEC A;  5GLA A;  2KLI A;  4E3O A;  3EQV A;  2PBD P;  1SCW A;  3BQA A;  4LRZ E;  1P97 A;  4I3A A;  4G3K A;  1VEU A;  3TE8 A;  4QJG A;  3V5M A;  1SDE A;  3MFX A;  3PYP A;  2X71 A;  2W3G A;  4DE2 A;  3BEB A;  4EWF A;  2EXA A;  3FZC A;  3T4S A;  4Y0O A;  3G31 A;  4HHD A;  4BL3 A;  2M7U A;  4BLM A;  3HUN A;  3PAE A;  3F1N B;  4P6Z M;  1O07 A;  4DJ2 A;  5KSH A;  2A2L A;  1N9L A;  1NLZ A;  2Y2N A;  2ZQC A;  4S2I A;  2QWS A;  3IBJ A;  1L0D A;  2I72 A;  5FDS A;  4ARZ B;  5K5B A;  2EX2 A;  3GQZ A;  2L0W A;  3LIA A;  2UWX A;  2HDU A;  4UA7 A;  3DTI A;  3VP4 A;  2XDM A;  3SS4 A;  1K55 A;  5M19 A;  5A91 A;  4GJ4 A;  1PI4 A;  3GV9 A;  3AGF A;  3CPT B;  3OPH A;  2RCX A;  1IYO A;  1D7E A;  4EEP A;  2DNS A;  1TF1 A;  4KEN B;  2QZ6 A;  4X1L A;  1DP9 A;  4HI4 A;  2WGW B;  1S66 L;  3DWZ A;  2JC7 A;  4QHC A;  4DE3 A;  1L0F A;  3NCK A;  1LSX A;  1S6R A;  1F98 A;  3MFD A;  4KZ6 A;  5U47 A;  3JPU A;  1ERQ A;  5DF7 A;  3UN7 A;  3HBR A;  4BEN A;  1BUL A;  4KUK A;  4KQQ A;  2BTF P;  4WL9 A;  1VB6 A;  4ZDX A;  1VM1 A;  1XFN A;  4L0L A;  1AWI A;  3VOZ A;  1J3W A;  3W4Q A;  3KYE A;  2XF3 A;  3LO7 A;  3P7N A;  1Q2Q A;  5HW3 A;  4HBT A;  4NXG A;  1IOU A;  3UE6 A;  4B4Z A;  4L9G A;  2WKQ A;  1ZTU A;  5F1F A;  4KUO A;  4QPR A;  4CPK A;  5EVL A;  1PZO A;  1K57 A;  3VMA A;  1H8Y A;  4GD8 A;  4LCM A;  2Y4A A;  4GW9 A;  1F2K A;  4HY8 A;  1E4D A;  1NLY A;  4LRY C;  3H9W A;  4XXR A;  2XK1 A;  4NET A;  1V9Y A;  3UB9 A;  5HWT A;  3F1O B;  1M6K A;  1CF0 A;  2VA0 A;  5HFO A;  1UGU A;  1PRQ A;  4R4S A;  4K0W A;  2H10 A;  1OPX A;  3G6O A;  3RTY A;  3SW1 A;  2Y2J A;  3CHW P;  3IX3 A;  1MZU A;  3C8C A;  1NYY A;  3LIC A;  1ODV A;  3IF5 A;  3U4L P;  3T4O A;  3FKV A;  4OP5 A;  2Z2M B;  1PIO A;  4O7D A;  1NRJ A;  4EBN A;  5FAT A;  1ALQ A;  5EUA A;  3MXR A;  2ZJ9 A;  4ZBE A;  3IF6 A;  1H8Z A;  1BUE A;  3E2L A;  4OQI A;  3MKF A;  2OV5 A;  1LHY A;  3TG9 A;  3IH9 A;  5AQA A;  4E6W A;  2FFF B;  3C7V A;  4B93 A;  1UWN X;  1G28 A;  1K0K A;  4C75 A;  1JTG A;  2J9P A;  3MXQ A;  4FUW A;  3BW6 A;  1W8Y A;  3SH8 A;  2PU2 A;  1GSV A;  3HUM A;  3ZG0 A;  5EV0 A;  2XGN A;  1TS8 A;  1K38 A;  1ZC2 A;  2V1Z A;  3N4I A;  3NJA A;  1BLC A;  4D60 A;  3DW0 A;  4LV1 A;  3UB6 A;  2P9V A;  3QP8 A;  1N9O A;  3BLS A;  4FCF A;  3G30 A;  1IYP A;  1XP4 A;  4ZJ1 A;  2VGJ A;  3QNC A;  3LIF A;  4HP9 A;  1KGF A;  3ZG8 B;  2ZOH A;  2Y2M A;  2WZZ A;  4X69 A;  3D9Y A;  3LR0 A;  4X56 A;  5DTT A;  4BWI A;  1HZO A;  1YKD A;  4BQM A;  4Y2F A;  3OC2 A;  5C5K A;  5KSC A;  4S2M A;  3QNB A;  5FAO A;  5HDC A;  4E3I A;  2HV1 A;  1TDL A;  4MNR A;  4ZJ2 A;  1ZG4 A;  3LCE A;  3OLO A;  3BJN A;  4UQI S;  3VSL A;  4GDN A;  3OPP A;  2W3H A;  1FR6 A;  2PDR A;  4GDB A;  1W8Q A;  1E3U D;  1QMF A;  2Y2L A;  3CUE C;  2Y79 A;  1E25 A;  1KDW A;  2JKR M;  5F5Y A;  2JKR I;  1E3U A;  2H0T A;  2H28 A;  4N1H A;  1MY8 A;  5TJJ A;  1BLP A;  4CLC D;  5FQI A;  5A90 A;  5HD5 A;  2IA2 A;  3KYZ A;  2IWD A;  3MMH A;  4UHU A;  4OVD A;  4CLC A;  5FQK A;  3OBF A;  3MR0 A;  3IBR A;  3HUO A;  3N8S A;  4Q8I A;  1W5D A;  1YMX A;  1FSW A;  2Z6C A;  3HRE A;  2EFX A;  2J7V A;  3NC8 A;  3QP1 A;  4RA7 A;  5F1G A;  3P98 A;  5FL3 A;  3M6B A;  2XQZ A;  3W2Z A;  3UDF A;  2ZC3 B;  4IVK A;  4HBU A;  5J8X A;  5F6A A;  3BFC A;  5AVE A;  4BMW A;  2X02 A;  3VP2 A;  1CEF A;  4KZ4 A;  1K56 A;  3RH8 B;  3R7W A;  1S4S A;  5LBR A;  3WRT A;  1JWV A;  3N8L A;  5HX9 A;  2B18 A;  2RL3 A;  3LR5 A;  3E0Y A;  3PHY A;  3C2W A;  3BFE A;  2XFT A;  1K54 A;  3ICY A;  3RFB A;  1C3B A;  3PBS A;  3LYX A;  4P85 A;  5E43 A;  5DF9 A;  4R1G A;  3O5Y A;  2MJ6 A;  2WGI A;  5E2H A;  3VP0 A;  4LRX C;  1PWG A;  3CIT A;  3CZD A;  5KMW A;  1YSQ A;  1T1C A;  1D1J A;  5I94 A;  2WAE A;  2HPB A;  1Q2P A;  3B33 A;  2XLN A;  3H82 B;  5HAI A;  3VFF A;  3CAX A;  4Y15 A;  2V1A A;  3EGD C;  3S22 A;  1FIK A;  4QWO A;  5EM1 A;  1A0K A;  4KZA A;  1MKM A;  2B95 A;  2QKP A;  4NXE A;  4F94 A;  1XA1 A;  3RXW A;  5L09 A;  1ES3 A;  3Q81 A;  1BLH A;  4DMZ A;  2Y2I A;  3KYQ A;  3UDI A;  4O01 A;  2PD8 A;  3FPV A;  2ZD8 A;  2O0Y A;  4R3A A;  1XPB A;  5F69 A;  5CTM A;  5GLB A;  4N9K A;  3Q82 A;  2GJ3 A;  3T1R A;  3MQO A;  5DKL A;  5GHZ A;  4YFM A;  3VP3 A;  2EX6 A;  4CLC E;  2FFY A;  2E8J A;  1KDS A;  4H6J B;  3B3X A;  2WZX A;  3O88 A;  4OOM A;  4PKY G;  2B02 A;  4WEK A;  5AVF A;  5G18 A;  2INW A;  4X6T A;  2VJW A;  1VET A;  3UME A;  5L2F A;  3ZG7 B;  3AGD A;  4O8G A;  4WZ5 C;  1DP6 A;  5F83 A;  3V50 A;  4R6L A;  1PI5 A;  1XA7 A;  3F1P B;  3K3D A;  3LY3 A;  4RVA A;  4NKP A;  5J4E A;  5AQ9 A;  1ES5 A;  1S1Z A;  1Y54 A;  3HLD A;  4Q0J A;  5AQ7 A;  4KG6 A;  4OPR A;  3VFH A;  1LL9 A;  4MCW A;  3ISG A;  2XA7 S;  3BLM A;  1I2S A;  2XD5 A;  4L9E A;  3A0V A;  2HDQ A;  1ERO A;  1G68 A;  2Y2G A;  3TRC A;  2P04 A;  1OT9 A;  4LPZ A;  2W1T A;  1S0W A;  3UB7 A;  2PU4 A;  1DJB A;  2IWC A;  4WM9 A;  4X1M A;  1G6O A;  4QU3 A;  4K08 A;  5CED A;  1JWZ A;  2WKE A;  3UE1 A;  2JKG A;  4PHT A;  1RGY A;  4OOL A;  2R9W A;  5HAQ A;  4OLD A;  2KDK A;  1DRM A;  4OPQ A;  4Y7P A;  3IXD A;  4IUK A;  3IWI A;  5FI6 A;  4EQ1 A;  1XX2 A;  1EI5 A;  5TBM B;  1BLS A;  1K25 A;  2V20 A;  5GLC A;  2P7J A;  4E3L A;  4YNR A;  4R23 A;  2Z2L B;  5HDS A;  3GMW A;  2GNX A;  2HJ9 C;  5G4Y A;  1F9I A;  3W4P A;  2C6W B;  1EWZ A;  3JVU A;  2IWB A;  2V2F F;  4QB8 A;  1JTD A;  2EXB A;  1O7E A;  4WLA A;  3V67 A;  3KSH A;  5DFY A;  1NY0 A;  1XGJ A;  1T18 A;  3PBT A;  1PFL A;  5F68 A;  5HD3 A;  3I7J A;  4EES A;  1NZU A;  3LUQ A;  5CHU A;  5DVA A;  2HP9 A;  2ZMA A;  4GS9 B;  1ZG6 A;  4S2N C;  2PR6 A;  3VSK A;  3ZVT A;  2J3T C;  1GHI A;  4UAA A;  1DJC A;  1YT4 A;  1AXB A;  5KIZ A;  1ZKJ A;  1M40 A;  1MWU A;  3ZGA B;  4F3L B;  4FH2 A;  1MWS A;  2OLU A;  2B5R A;  3F1N A;  1MWT A;  1MC0 A;  1YLZ A;  1OT6 A;  5IS1 A;  3K3C A;  3FKW A;  5CGW A;  1FCO A;  1OJ5 A;  5GL9 A;  4EER A;  4X68 A;  3LR4 A;  4FTX A;  3S7O A;  4OKP A;  4EUV A;  4P6B A;  4R3J A;  3WS5 A;  4ARZ A;  3KO6 A;  4HQA A;  4PM6 A;  2W1R A;  3QP2 A;  2G7U A;  1RCJ A;  5FAP A;  1OTB A;  3P09 A;  4P87 A;  3A3I A;  1MBL A;  1WYC A;  4S2K A;  1TEM A;  2OAP 1;  4MN5 A;  2VGK A;  4GLQ A;  4WF0 A;  3DTM A;  5DJT A;  3CPT A;  4B88 A;  1XXM A;  5HAR A;  1TDG A;  3IQA A;  3T50 A;  3T4J A;  4Y0T A;  1RP5 A;  4DXC A;  1OTI A;  3LGO A;  4I3J A;  4PM8 A;  1H3Q A;  3IWQ A;  2YKF A;  4AFI A;  1YAX A;  5FEF A;  2ZOI A;  3EEA A;  2G2W A;  4KQR A;  1L2S A;  2OWH A;  3PBR A;  2K31 A;  3IH8 A;  3WS1 A;  5DFX A;  4EU0 A;  3EQU A;  3GRJ A;  3T1X A;  2VK3 A;  3OOV A;  4WMC D;  3QP5 A;  3IX4 A;  3PBQ A;  1H0M A;  1PWD A;  1GA0 A;  1FSY A;  3OPL A;  3M6H A;  4NEE D;  1LT0 A;  1OTA A;  4JGO A;  2I9V A;  3TW8 A;  3PXP A;  3V3R A;  2A3U A;  4WMC A;  5D3O A;  2HJE A;  4BD1 A;  2H0Y A;  2ZL1 A;  4B9O A;  4G3V A;  3B42 A;  3SH9 A;  5KZH A;  1G6A A;  2HGV A;  4HP4 A;  4S2O A;  1YLW A;  1NYM A;  2VKS A;  1XJ4 A;  2PRF A;  3IF6 B;  5E2F A;  2ZC4 B;  4GHI B;  2A24 A;  1YLJ A;  5AQB A;  4WBG A;  2VLG A;  3F1O A;  4UA6 A;  3RJU A;  2FZ0 A;  4KZ5 A;  1LL5 A;  4Y13 A;  5HDD A;  2ZC6 B;  3G2Z A;  3ZCZ A;  3GEC A;  3PBN A;  1WE4 A;  5L10 A;  4WN5 A;  1DP8 A;  4ID4 A;  5A8B A;  3Q07 A;  4KG2 A;  3PAG A;  4JXV A;  4EW7 A;  2PYR A;  1SZV A;  2E8I A;  3R4K A;  4HJ4 A;  4EQI A;  5FAS A;  4JBF A;  3UB5 P;  2XH9 A;  2ZMF A;  4LGW A;  3GVB A;  4JF4 A;  5TR7 A;  4ME4 A;  3BY9 A;  1KE0 A;  2YKH A;  1MWR A;  4E3K A;  4MDZ A;  1BT5 A;  1IFQ A;  2Q9N A;  4B4X A;  2J9O A;  4GOG A;  3DWK A;  4Z9Q A;  1YM1 A;  4I3I A;  3T4Q A;  2WYX A;  2PYP A;  4R70 A;  1XFQ A;  3MKE A;  1K55 C;  3TOI A;  1MXO A;  2XRN A;  2FH5 A;  3NDG A;  4KG5 A;  1KGE A;  3O87 A;  4OQH A;  2VX8 A;  5EE8 A;  3KSG A;  4XT2 B;  4YIN A;  5HPI A;  2ZBB A;  3E4O A;  5FA7 A;  2XR0 A;  4P6Z S;  2ZM0 A;  1NZO A;  3W4O A;  2JCH A;  2O99 A;  3A3F A;  3VOY A;  4YOF A;  5G4Z A;  4GCZ A;  1OME A;  3ZQ5 A;  5FI2 A;  1LI0 A;  2DMW A;  3BY8 A;  2OAQ 1;  5TGF A;  1IYQ A;  4KZ9 A;  2O9A A;  3L7H A;  3UY6 A;  3EGX C;  2C5W B;  1PZP A;  2O9C A;  4WZ4 A;  1GCE A;  5CEB A;  3QHY A;  4JLF A;  3LY4 A;  4EET B;  2XD1 A;  1L3L A;  1K4E A;  1KE4 A;  1SKF A;  5FDH A;  5HZH A;  4MEZ A;  4WZ5 A;  3IS2 A;  2EA9 A;  3FWL A;  2NUT C;  3C4O A;  2EFU A;  3UE0 A;  2ZM2 A;  3IX8 A;  3A3E A;  1J9M A;  1ES4 A;  3M2K A;  3BYD A;  5FQQ A;  2JE5 A;  2BAS A;  2XSS A;  3L9K A;  3O3V A;  1KGG A;  3T4T A;  5HPF A;  4BBT A;  3LIB A;  1Y4O A;  2P74 A;  3Q7V B;  2X01 A;  3ZHH A;  3ITA A;  4Y0U A;  1WYB A;  4DDY A;  5CTN A;  5HL1 A;  1I5Q A;  4JXW A;  4ETX A;  1ERM A;  3CWF A;  3SZT A;  5FQJ A;  1YSP A;  5JYO A;  3IF6 C;  2PD7 A;  1IKI A;  5EVI B;  1FOF A;  3GDI A;  3OPR A;  5DKK A;  4OLG A;  1ACF A;  2VZW A;  3HLF A;  4BBU A;  4RX2 A;  4Z1W A;  1DY6 A;  2CC1 A;  1HTZ A;  3LR3 A;  2ZC5 B;  4HJ6 A;  3BWL A;  1XJ2 A;  1W79 A;  1FIL A;  4II7 A;  4N92 A;  5HWW A;  4MBK A;  5A93 A;  2V0U A;  3CJM A;  3MJQ A;  4HNB A;  2V8C A;  5CGX A;  3LI9 A;  3NOP C;  4X25 A;  5IT5 A;  3HLG A;  4CQH A;  1CQA A;  2HDR A;  1H5X A;  3MZD A;  1NWZ A;  2EX8 A;  2J3T D;  3G32 A;  2J80 A;  4E3M A;  1PYY A;  3D3O A;  2WKI A;  3ZNT A;  4QY6 A;  3G2Y A;  3A3J A;  2J3W A;  3HJI A;  2WKH A;  3MF0 A;  1TVF A;  1LL8 A;  2A49 A;  3LIE A;  1JVJ A;  3C4P A;  3JVV A;  4RX3 A;  1G5U A;  2VV6 A;  4JXG A;  1ESU A;  1XJ6 A;  4EUZ A;  2ZQ8 A;  4N1X A;  3D4F A;  4PM7 A;  5FSR A;  1VET B;  1RGZ A;  3O86 A;  4GNU A;  3UPN A;  5DTS A;  3H7W B;  4GD6 A;  2GDN A;  4KZ3 A;  4S2L A;  4DKI A;  3Q7Z A;  2NUP C;  3A3D A;  3AGE A;  1EW0 A;  2XRO A;  3K2N A;  3PTE A;  1WA9 A;  3QP4 A;  3MBZ A;  2HZ5 A;  5FEG A;  4HH2 A;  4UEY A;  4C3Q A;  1JNU A;  4YWZ A;  3QP6 A;  3OCN A;  1FR1 A;  3T4K A;  3WS2 A;  3VE4 A;  4A5R A;  3HCY A;  3T1Q B;  3NDE A;  4LV0 A;  4CLC C;  3NEC A;  4R4R A;  2W3D A;  4KQD A;  5L07 A;  3MZE A;  3G4P A;  4MLL A;  3RXX A;  1P9W A;  2XFS A;  3WRZ A;  1LLB A;  5FAQ A;  2PBY A;  3BRM A;  2EX9 A;  5AJG A;  3SOI A;  1FCM A;  2JBF A;  3IHA A;  4HES A;  3V39 A;  1CJF A;  1SKO A;  5MC7 A;  1VEU B;  3U2A A;  2WKP A;  3UDX A;  1IYS A;  5EFW A;  1K54 C;  5FQM A;  2WK0 A;  4HOI A;  3V3S A;  1T1A A;  2HDS A;  5M1A A;  1GSW A;  2JN7 A;  1ZHH B;  1T19 A;  5EVI C;  4E3J A;  5EM0 A;  1K6R A;  4FH4 A;  2V1B A;  1YMS A;  2VGL S;  5TBM A;  2QPN A;  4JGP A;  3NIA A;  3FPW A;  3PR6 A;  2OSU A;  3MXS A;  2QJ7 A;  3FC7 A;  2W3E A;  4NG2 A;  5HWV A;  5EOE A;  1N9N A;  4I39 A;  5DTK A;  4IBR A;  2BG1 A;  1IKG A;  3BFG A;  3LI8 A;  5M18 A;  3SS3 A;  4OON A;  2R78 A;  3N7W A;  5E2E A;  3ZNY A;  1FCN A;  3S7N A;  4FD8 A;  4UQI M;  4GS9 A;  1XKZ A;  5EOO A;  4KQO A;  4X53 A;  4EXO A;  3JYI A;  2ZM8 A;  4H8R A;  4P0M A;  4BL2 A;  4Q0I A;  4KZB A;  1TS6 A;  5FQ9 A;  2GX5 A;  1VQQ A;  1K6S A;  2PAV P;  3UPO A;  4E6X A;  1L0E A;  3LEZ A;  1I2W A;  4F3L A;  4MN6 A;  4NXB A;  4PM9 A;  1KE3 A;  2AVX A;  3LID A;  3MS6 A;  4LV2 A;  4OQG A;  2WKR A;  4OH0 A;  1IEM A;  2Q9M A;  2KOI A;  4PKY A;  5CHM A;  3DTK A;  4MBH A;  1HLU P;  3T4L A;  5CXW A;  3Q1F A;  3ZVW A;  1ONG A;  3ZG9 B;  2ZLY A;  1ONH A;  2G2U A;  2WGW A;  2WGV A;  1YLT A;  2R9X A;  3UPP A;  2Q0O A;  3E4Q A;  5FI7 A;  4M3K A;  4X55 A;  3CUE A;  2Y2Q A;  4BJP A;  4DE1 A;  1NRF A;  5CHJ A;  3UB8 A;  4JF6 A;  4HH3 A;  2JKT M;  3MQQ A;  5CX7 A;  2JKT I;  3WS4 A;  1CI8 A;  2Y2H A;  2QYB A;  5HSQ A;  1SHV A;  4GKU A;  2ZL1 B;  1DJA A;  3UMD A;  3VV4 A;  4IJG A;  5J7E A;  1TD5 A;  4S2J A;  3FG8 A;  3G34 A;  1CEG A;  3HLC A;  4K0X A;  1HD8 A;  5GHX A;  1XGI A;  2JHE A;  3IXG A;  4GZB A;  3WWX A;  2A24 B;  2D01 A;  3EEH A;  3BFF A;  5J3W A;  3ULF A;  2EWV A;  1F5M A;  4IED A;  3BEC A;  4ESP A;  2W3F A;  3A0S A;  5I5L A;  2ACG A;  3OCL A;  5CEC A;  3SH7 A;  4IHQ A;  4XUX A;  3NI9 A;  1H8M A;  4K91 A;  4QD4 A;  3VP1 A;  3M2J A;  3ZG5 A;  3BFD A;  4OQ0 A;  4GHI A;  4ZTK A;  1PW8 A;  4HJ3 A;  3HVF A;  1YQS A;  3SS5 A;  2PHY A;  2P9V B;  3D72 A;  4WEJ A;  3T1S A;  2PT7 A;  2VV8 A;  3EWK A;  1GSX A;  4E04 A;  5IU1 A;  3VOL A;  4LFU A;  4BBV A;  4EEU A;  3IXH A;  4OPZ A;  4XUZ A;  4ZAM A; 
#chains in the Genus database with same CATH homology
 4LPZ A;  2W1T A;  3UB7 A;  1LSX A;  1F98 A;  2VZW A;  4BBU A;  4Z1W A;  3LR3 A;  1G6O A;  4HJ6 A;  5DJU A;  2K2N A;  3BWL A;  2GZA A;  4K08 A;  3C30 A;  1XJ2 A;  4KUK A;  4LLO B;  4WL9 A;  1VB6 A;  1STZ A;  1XFN A;  4L0L A;  4PHT A;  4IUH A;  4II7 A;  4OOL A;  5HWW A;  2V0U A;  3MJQ A;  2KDK A;  1DRM A;  4HNB A;  5L8M A;  1V9Z A;  3P7N A;  3LI9 A;  4IUK A;  4WUJ A;  4NXG A;  3NOP C;  4EQ1 A;  1IOU A;  5IT5 A;  2M1C A;  3UE6 A;  4L9G A;  4NXF A;  5TBM B;  4DN0 A;  4CQH A;  2WKQ A;  1ZTU A;  4KUO A;  4QPR A;  2P7J A;  4MMN A;  1NWZ A;  4PAU A;  2XA7 M;  2J3T D;  4YNR A;  2J80 A;  5HDS A;  2GNX A;  1TS0 A;  2HJ9 C;  1P9R A;  2P08 A;  4XT2 A;  5G4Y A;  3S7Q A;  1F9I A;  3D3O A;  3JVU A;  2VV7 A;  4GW9 A;  2J3W A;  4HY8 A;  3HJI A;  4WLA A;  2ZMV A;  3MF0 A;  1NLY A;  4LRY C;  3V67 A;  1LL8 A;  3KSH A;  3LIE A;  5DFY A;  3IS2 B;  3H9W A;  4G3W A;  3CI6 A;  3JVV A;  1V9Y A;  2VV6 A;  3UB9 A;  5HWT A;  1T18 A;  3PBT A;  3F1O B;  4CLC B;  2VA0 A;  2OWJ A;  5F68 A;  1UGU A;  5HD3 A;  4HIA A;  1XJ6 A;  1OTE A;  2PR5 A;  4R38 A;  4EES A;  1OPX A;  3LUQ A;  3G6O A;  3RTY A;  3SW1 A;  4GS9 B;  1TS7 A;  1MZU A;  3C8C A;  3LIC A;  2PR6 A;  3MQ0 A;  2J3T C;  1ODV A;  3T4O A;  3UE3 A;  1NRJ A;  3HJK A;  1S67 L;  3H7W B;  3NHQ A;  3NOT C;  5KIZ A;  3R7W B;  2NUP C;  4F3L B;  1EW0 A;  2XRO A;  3K2N A;  1WA9 A;  1VHM A;  3F1N A;  1MC0 A;  1OT6 A;  5IS1 A;  3K3C A;  4ETZ A;  4HH2 A;  4UEY A;  1OJ5 A;  1JNU A;  4EER A;  2L4R A;  4YWZ A;  3LR4 A;  3OCN A;  4B93 A;  3T4K A;  1UWN X;  3S7O A;  2VGL M;  1G28 A;  3VE4 A;  3MXQ A;  3HCY A;  3BW6 A;  4EUV A;  1BYW A;  2W27 A;  4ARZ A;  4CLC C;  1GSV A;  3KO6 A;  4HQA A;  1TS8 A;  2W3D A;  1LSV A;  3DBA A;  4KQD A;  2W1R A;  2G7U A;  3VE3 A;  3NJA A;  1P0Z A;  1OTB A;  3UB6 A;  3PBO A;  1P9W A;  2OAP 1;  4MN5 A;  1N9O A;  4O0P A;  4GLQ A;  3LFV A;  4WF0 A;  2W0N A;  1OJG A;  5DJT A;  1T1B A;  4M4X A;  5AJG A;  2O9B A;  3S7P A;  3T50 A;  3T4J A;  1OTI A;  4I3J A;  2KX6 A;  1H3Q A;  3LIF A;  4HP9 A;  3TJZ C;  2YKF A;  4AFI A;  2ZOH A;  1YAX A;  2ZOI A;  3LR0 A;  3EEA A;  5MC7 A;  3U2A A;  2WKP A;  2OWH A;  4BWI A;  5EFW A;  1YKD A;  3PBR A;  2K31 A;  4HOI A;  5DFX A;  4Y2F A;  3OC2 A;  5C5K A;  4EU0 A;  3EQU A;  2D02 A;  1T1A A;  1GSW A;  1S1Y A;  2JN7 A;  1ZHH B;  3H82 A;  3OOV A;  5HDC A;  2HV1 A;  3PBQ A;  1T19 A;  3OLO A;  3BJN A;  4UQI S;  3KSF A;  4NEE D;  4DJ3 A;  1LT0 A;  1OTA A;  4JGO A;  3C38 A;  2I9V A;  4FSF A;  2W3H A;  4ZRR A;  3KX0 X;  2PDR A;  2V1B A;  2QHK A;  3PXP A;  3TW8 A;  2V9A A;  2VGL S;  5TBM A;  2HJE A;  4Q0H A;  3CUE C;  4B9O A;  2Y79 A;  4G3V A;  4Y3I A;  3B42 A;  2JKR M;  4JGP A;  5F5Y A;  4JGR A;  3FPW A;  2HGV A;  2JKR I;  3PR6 A;  4HP4 A;  2QJ7 A;  2VKS A;  1XJ4 A;  2H28 A;  3FC7 A;  2W3E A;  5TJJ A;  5HWV A;  2Y8H A;  3P01 A;  4CLC D;  2V0W A;  1N9N A;  2L1M A;  1Y28 A;  4JGQ A;  4GHI B;  2A24 A;  1OTD A;  4I39 A;  5HD5 A;  2IA2 A;  3KYZ A;  2QJ5 A;  1KOU A;  2VLG A;  2Z6D A;  4Y5F A;  3MMH A;  3KSI A;  3LI8 A;  3F1O A;  4CLC A;  3OBF A;  3EOI A;  3MR0 A;  2FZ0 A;  2R78 A;  3IBR A;  3S7N A;  2Z6C A;  5HDD A;  4FOF A;  4H6J A;  1W63 M;  4UQI M;  4GS9 A;  3GEC A;  4KQO A;  3NOU C;  5FL3 A;  3W2Z A;  1LSW A;  3PBN A;  4EXO A;  4WN5 A;  1DP8 A;  2K7S A;  5A8B A;  5F6A A;  5AVE A;  4Q0I A;  4BMW A;  4EW7 A;  1TS6 A;  2W1T B;  2PYR A;  3BQ8 A;  2GX5 A;  3RH8 B;  3H7W A;  5HL6 A;  3R7W A;  3ZYT A;  3R4K A;  1S4S A;  4HJ4 A;  3E98 A;  5LBR A;  2HF6 A;  4F3L A;  3E4P A;  3F1P A;  4MN6 A;  2ZMF A;  4NXB A;  2B18 A;  4ME4 A;  3LR5 A;  3E0Y A;  3BY9 A;  3PHY A;  2LB9 A;  2YKH A;  4I5S A;  3C2W A;  3LID A;  4MDZ A;  1IFQ A;  2WKR A;  3ICY A;  2CMN A;  3RFB A;  3PBS A;  4I3I A;  3LYX A;  3T4Q A;  2KOI A;  2LB5 A;  4PKY A;  3CLO A;  2OOL A;  1UWP X;  3T4L A;  2PYP A;  5DF9 A;  3O5Y A;  1XFQ A;  4L9F A;  2MJ6 A;  4R70 A;  2M7V A;  1S4R A;  2XRN A;  4LRX C;  2FH5 A;  1W63 Q;  3CIT A;  4MN7 A;  3B47 A;  1YSQ A;  2EWW A;  3A0R A;  4RQ9 A;  1T1C A;  3E4Q A;  2VX8 A;  3KSG A;  4XT2 B;  1X0O A;  2VEA A;  5HPI A;  2ZBB A;  3CUE A;  3E4O A;  3B33 A;  3H82 B;  4P6Z S;  4BJP A;  3CAX A;  1D06 A;  2O99 A;  2V1A A;  4I38 A;  1XJ3 A;  3EGD C;  3UB8 A;  4HH3 A;  4YOF A;  4GCZ A;  2JKT M;  5G4Z A;  3MQQ A;  5CX7 A;  2JKT I;  4WEL A;  3ZQ5 A;  2QYB A;  5HSQ A;  1MKM A;  2QKP A;  4NXE A;  2KLI A;  2DMW A;  3BY8 A;  2OAQ 1;  3EQV A;  3UMD A;  3VV4 A;  3BQA A;  4IJG A;  4LRZ E;  1TD5 A;  5J7E A;  3FG8 A;  1P97 A;  4I3A A;  2O9A A;  3EGX C;  4G3K A;  3TE8 A;  4DMZ A;  2JHE A;  3KYQ A;  2O9C A;  3MFX A;  3PYP A;  4O01 A;  2PD8 A;  3FPV A;  2W3G A;  2O0Y A;  2A24 B;  2D01 A;  3EEH A;  4R3A A;  4EET B;  5J3W A;  5F69 A;  3ULF A;  2EWV A;  3T4S A;  2GJ3 A;  5HZH A;  1F5M A;  3IS2 A;  4HHD A;  3MQO A;  5DKL A;  2M7U A;  3F1N B;  4P6Z M;  2EA9 A;  4CLC E;  2NUT C;  2W3F A;  3A0S A;  4H6J B;  5I5L A;  3OCL A;  4DJ2 A;  5KSH A;  4OOM A;  2A2L A;  4IHQ A;  4PKY G;  2B02 A;  4WEK A;  5AVF A;  1N9L A;  1NLZ A;  1H8M A;  2BAS A;  2XSS A;  2INW A;  2QWS A;  2VJW A;  3T4T A;  3UME A;  3IBJ A;  4ARZ B;  5HPF A;  4O8G A;  4BBT A;  1DP6 A;  5K5B A;  4R6L A;  2L0W A;  3LIB A;  4GHI A;  3LIA A;  3F1P B;  4HJ3 A;  3K3D A;  4NKP A;  2PHY A;  4GJ4 A;  5J4E A;  3D72 A;  4WEJ A;  4ETX A;  2PT7 A;  1S1Z A;  4Q0J A;  3CWF A;  2VV8 A;  3EWK A;  1GSX A;  4MCW A;  4E04 A;  1D7E A;  2XA7 S;  5IU1 A;  1YSP A;  3VOL A;  1TF1 A;  4EEP A;  2PD7 A;  1DP9 A;  4BBV A;  4HI4 A;  4EEU A;  4L9E A;  3A0V A;  3TRC A;  2P04 A;  1S66 L;  3GDI A;  1OT9 A;  5DKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...