5HPMB

Cetuximab fab in complex with cyclic linked meditope
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
216
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cetuximab Fab light chain
publication title Cyclization strategies of meditopes: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 45
structure length 216
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hpmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hpmB01
3OJDB 2VABA 1I1AC 2KZ1B 4HHAA 5J6HB 3QXVA 3MLRH 4WGVB 1YDPB 1P5UA 4PB0H 3GNML 1EA9C 5C08D 4PJBF 1ZVSB 4UV4L 3SDDB 4WU5B 3IGAB 5HYSA 3VG0L 4P2QE 3N1QC 3NIGE 4BUHA 1CYGA 3GMOA 5FM8A 3IDXL 1EUTA 2PYED 4WWID 5CJOH 3DSNA 1KYOK 3RKDD 3GSUA 4EQ3A 3DTXB 2NY4C 2HVJA 5E8DL 5KVEL 1MCKA 5IBUB 4ONHA 4PV8B 2R2EA 5A3IC 3MJ9A 5IFHH 2BFVH 3PDOB 2C3GA 2V9RA 3HMXA 3FQRB 3BAEH 1IGIH 2F53E 2XQBH 2FR4A 3VCLA 4K3HA 4N8CL 2AXJA 3PQYA 5C1MB 3MXWL 4WEBH 1DQLL 4JFEB 4M8QA 2AI0L 3VXTB 1D6VL 1ZHBB 1BZQK 2GTZA 4DCQB 4ZD3H 5C2BH 3PGFL 3P30L 1IRAY 1A9EB 5SWZA 4OJFL 3ZHKA 4XPBH 2CDFB 3OB0K 3DXAB 4F57H 3OR7B 4FN0A 3S35X 2HT2D 4TQEL 2BP3A 3GSWA 3X13A 1D5XA 5CKAA 1H5BB 2VYRE 1BJ1J 2D7QA 3BT2H 4PRIA 4WFGE 4GLRH 3RI5K 1M71A 5AZ2L 4MD4B 3I50L 1T0PB 4NBZB 4R2GB 2LQRA 4BM7A 1FBIL 3RTQA 3MGOB 3TT3H 3VRJA 2VC2L 1JGEA 3HUJE 4PJHA 3TYGL 2GSIA 1VGKA 2M26A 4L3EA 3PWPE 2IPTL 3KPTA 4XAKE 4G8IA 2WK2A 4P2RE 1RJLA 5CZXD 3SDDC 4C56A 1F6LL 2FCBA 1NFIA 3IKCB 4UOW1 4HKZA 4R96A 1R3HA 5IG7B 1NAKH 5FO9B 4U31A 1BM3H 1YEHH 3U6RA 4I0PA 4W70A 4OM0L 3ARFC 4PRHD 3Q3GA 4D0BB 4X99B 2WUCL 3PP4L 4Y4FC 2X89A 4ODWA 1QEWA 4HGMA 1CZ8L 1BWWA 3T2NL 2D31A 3IDMA 2P42B 3GB7A 3LEVH 3B5GA 2AXFA 3MA7B 4GKSA 4LPTA 5GISH 3O6FB 4EI5B 3ZLQC 5FDWB 1KULA 2NYYC 1QRNA 4P23C 5C0JA 5JIHA 3RZCC 3SJVB 3P2TA 1WCQA 4EZMA 4QHMA 4XX1G 3CX5J 2Q8AL 1MJJA 4D9LL 1G7QB 1HSAB 2CQVA 5IB1B 5JLZA 4HUVA 4JFHD 5E9DA 4UB0L 4OGAD 2PXYB 1U8NB 2X4PA 2P24B 3INUH 2NXZB 4KZDL 3VFVA 2X4OA 3BP5B 1YEIH 4PJGB 4NRZA 4TYUA 1OP3H 1NFDE 1QR4A 4JGUA 5DUPH 3LKQA 5T1MB 1KFAH 1G9NH 2WIIA 4NZJA 4LKCA 1YNTA 4XVUD 1SMAA 4X4MA 2YOCA 1HI6B 2WQ8A 4MD5A 1DANU 3K4AA 4NZUL 4QKXB 4V2BA 4BH8A 4LMQI 5AG8A 4CBPA 4WVRA 5L2JA 2I26N 4BH7B 3U9PL 3GI9H 1EDQA 3IT8D 1SMOA 1BEYH 4YQXH 1GGIL 2ESVB 1U3HB 4NWTH 3EIFA 5ALCL 4DKEL 1CFVH 2EDKA 2W9EH 4YEEA 2R0ZL 1U8PB 1ZE3C 4NQEB 4U1MB 5J6GA 1HNGA 3OGCA 1G7PA 2GCYA 4GUPB 1MAMH 3LH2H 4OFDA 3SPVB 1MLCB 3I85A 3VWKC 4M5ZH 2BY3A 1JBJA 5BVJB 1HH6B 5B3JE 1HCVA 3DX6A 2M2DA 3QDJD 4CMMA 5KSAA 1TITA 1AGBB 5AAMA 4KVNH 1T21A 3QIBB 4OCXL 1QFPA 3B8SA 3K8LA 5EUOE 3T4YB 5I2IB 1FGNL 3O6FC 1B6UA 2XN9E 3K74B 4NQSB 4G7YH 2IPUK 3UZQA 4HCRL 3UPAA 1MJ8L 4OZFB 3X14B 1NJ9A 2VIRB 5EO0A 3BH8B 5BJTB 1N0XH 4DGVH 2ZOLA 5CD3A 5FYLD 4QXWA 3IKKA 4R7NB 1JWMA 4JGMA 5J12C 4XNYH 1K3ZA 2VZ3A 3KPPB 1FVDA 1Q9OA 3UYRL 1BFVL 2V2XB 5FYJE 4NNXA 3MRKA 4XWOC 2YK1L 3BHBB 4NO0B 4W4OC 1ZT7A 5FYKH 2PKDA 3MRCB 2HRPH 2JK5A 4UT9H 4WGWB 4NGHL 4LLVA 1VADB 2PYEB 2D03H 2LTQC 4PRPA 1OSZA 2YZ1A 3QT2A 3MUY1 4TSAL 3D2UA 5KSBA 4P2QB 4RWYH 4W68A 4Z77A 1A7RL 3LQMA 5IHZA 4QTIL 3TBTB 5T1LD 1YN7B 5DMYA 4OLZH 1NC4D 1J10A 1JTOA 2EE2A 3DX7A 5HVGB 3MFFA 1RQ5A 1LQSR 5D1XA 1J8HA 4HD9A 3FT3A 4ODUA 4ORGB 4PJEE 2PETA 4JCMA 4L8DA 2NLJB 2GI7A 1A7OH 1RU9H 5C0RH 2GY7B 4WIQA 1CLYH 1CFQA 2CK0L 3UP1A 2DTML 4LPWA 2VUOA 1RZKC 3ZKNC 2HJFA 3V6FA 1BQUA 3HZKB 1OAQL 2RFXA 3NFPA 1MY7A 3QUXC 4O51B 1CQYA 3KYKH 1J12A 3E3QE 5EUKA 4D3CH 1R5IA 4LSTH 2CMRH 3BPOC 3FN9A 2E6JA 1Z5LB 1OAKH 1UWGL 4YHNA 1YEJH 3I6LE 1CGYA 1OM3L 5I1LA 3A6CL 1TQCB 1AY1H 5FM5O 3AXLB 1ZS8A 1JGUL 3D0VB 4G6KH 2VTFA 2GAZB 3QEQD 1U8IA 3UCRA 4E0RB 4X9HA 2CDEA 2Q3AA 3L7FB 2DI9A 2Y07L 1NBZA 4H26B 2XRAL 2X6MA 3HUJB 3W9EA 3QNXA 3VXPA 4XPAH 5F97E 3PWPB 3PL6D 3MUZ1 4K94L 4FXLA 4K7FB 2F5BH 1RUAH 2GJZB 3VI4F 1P84K 5E5RB 1S7QB 4PJ8A 3CFCL 3W11D 1OAUL 4RGMB 3ZL4H 4RIRB 3SE3C 1L7IL 1MVUB 4J6RL 2AV7B 4PP2A 4U7MA 4DZ8B 1FZOB 1J0JA 5B4MC 3O4LA 2R39A 3C8KB 4XZUB 5MENE 3ULVD 1HH9A 3UJTH 2PUQT 2AEPL 4KY1H 4QHNB 4XX1E 3WDIA 5CZKA 5ICYA 3Q6FB 4Z18A 3NN8A 1VFAA 3T08A 3NBNA 4L1DA 1F4AA 1ZHNB 5FYLL 1A6TA 1CLOH 2DD8H 1J0ZA 4PV9A 1ZEAH 1GIGH 3T1WA 1LWRA 2C4FU 3SCMD 3L3IB 1JFQH 5C0FB 1L6ZA 3HKFA 4WY7L 3GSOB 4KUZL 3SKUD 1XF4A 3B6SB 5GGRA 3OAUL 1EIBA 2D7PA 3MO1A 4LPCA 4OZ4B 2EDWA 5KVGH 1I4FA 5ITBH 1NFDB 2EDRA 4UINH 1TQCC 1EO5A 1BJ1H 4FXGA 3UPCA 4MDJA 1PZ5A 1DFBH 2XZZA 2X05A 3LAFA 3QDGA 2ZOKB 3LKNB 4M61A 4DK6A 2J8HA 4G6AD 4R4NC 1GXEA 3WKML 3O3AA 4CMHC 3BWUC 3X12A 1F13A 4PRNA 2HJKA 5I0DA 2FGZA 5I66A 4YBLB 1DBML 4NHCH 5TPWH 5BZWB 1OAXL 3IFOB 3KHOA 4Y2DC 2OTUB 5C6WH 1ES0B 1WCBA 1JK8B 2FBOJ 4XP5H 5I1DA 5I71C 2NTSP 2ICWJ 4W81A 3U7YL 3Q1SL 4BZ2L 5IEKA 3EYSH 3LD8C 2BJML 4Y5XA 5IBLD 1TETL 5KG9B 1Q72H 4W6XB 4I9WD 1I8LC 1HXMB 1I3RA 3W5MA 4PGEB 1NLBL 4X6DF 5BO1L 1A6ZA 3W82A 1AO7D 3C60B 2KQNA 3CFKA 3JWDL 1F11A 5T3XH 4M43L 4JQIL 1WK0A 3ROOA 2BCKB 4IMKA 5LJYH 1OL0A 5IB2B 3MGTA 5T5NG 2R29L 4F7MA 3EO1A 3NCEB 4N90D 4UIMA 4Z7VE 5IBTL 4JHAH 2VITA 3KYAA 3KPOA 3MV8E 4P59H 5HHOA 4B7LA 4FQIH 1INDH 1CL7I 1RMFH 2BNUA 3C6LB 3PNWB 5KVDH 4O02L 4ZG1A 2JJSC 3DMMD 3V6BR 2IPKB 4NIKB 5HBBA 1DEEB 5DUBB 1CFNA 1JN6B 2HRLA 3QXDB 3N50A 1SYVA 1PY4A 4BQ6A 3PGCB 3KYOB 2CKBA 1X5GA 2IPUG 4Z8FH 2P5WE 1OT1A 5FO8B 1KTDB 5C7XL 3RDTD 4UBDD 5T1LB 3ULVL 1NC4B 3S88H 3RX5A 2XTLA 4DOHE 3SN6N 4Y4HB 4UQ2A 3ORJA 5CJQL 5BV7L 4LVHC 5IKCB 3FRUA 2P8LA 2NXYC 5EO9B 2XXCB 4XCYA 5C71A 4KJWC 2D4FA 4XXDA 1S9WB 3HI5L 2VB5A 3D39E 1FPTL 4FQ1L 1WT5C 4LSRL 2EDNA 2LAGB 4PJEB 5KOVC 3GIVA 4J23A 3CDGA 4OBSA 2GKIA 1G6RH 3OV6A 5GGVL 2A38A 2J3SA 3KPMA 1QLEL 5JOFB 3L3OA 4XBGA 3VFTA 3UO1H 1R0AH 4P9HC 1QBML 2XTJD 3LPFA 1B0RA 3O2DH 6CGTA 3RWIB 1S9XA 1PQZB 5CJ5A 3P0GB 2G9HA 1F3JA 5DRNA 4WDIA 2K9UA 4QHLB 4WFHE 2FECL 1ORQB 3QEQB 4H1LH 2GFBA 3P11L 1XH3A 5DFVD 1C16B 2MFNA 2H3NA 2COQA 3C6LC 1ZKAA 4JFDE 1QNZH 1NKRA 4GG6B 5DK3A 4LHUD 4LASH 3C2SA 5AUMB 3W39B 3U0PA 4HIXL 2EDEA 3V4VH 4MS8C 3RJDA 4NN5B 3KLHD 1FNLA 3VGAC 4OB5H 3F12A 3VMNA 5J0BA 1FORH 4HH9A 2WBJA 5JXED 5IJKC 1QFHA 1HCFX 1JNLH 2OMNA 1S7SB 5H2BA 3CUPB 1YPZB 5CD5C 3FTGA 2FEEI 4Z95L 4JZOB 2Y36L 1FFRA 2OCFD 3B5HA 1ZT1A 5C0CD 5JDJA 3TZVD 4HMDA 2Z4QB 2XKNB 4OCYL 3HAEB 1A7BA 4X6CE 4KQ4H 3VXSD 1W72H 1OTUD 3MLPA 1WIPA 3V5KA 3L5WA 4JDVA 3MUGA 3H3PL 1BQSA 1RFDH 5FKAA 1U8HB 1UH3A 4NO2A 3I6GA 1YY9C 3MRLA 1T5WA 5TE4L 3AGVA 4UDTA 4MJ5B 2YWZA 2NY6C 3U1SL 1EX0A 1DL7L 2QQLH 3UMTA 2B20A 3IXAB 4HS8H 1EGJL 3DYPA 2Q86B 2VDRL 1NGPL 2KPNA 2KZWA 4LLUB 5CBEA 3E3QC 5CEYA 1RUPL 4WUKL 3QUMA 4EEEA 1M05B 1XGRA 2BERA 4OUUA 1KCRL 1AD0A 5L9DL 5DGRA 1OB1B 2G2RA 4O2FA 4EDWL 1BMGA 4G6MH 3P4OA 4M5YL 1AD9A 5LAXB 1CFTB 1J1OH 3J7HA 3Q6GH 4U6XA 3QI9A 4NCDA 4P2OA 2EDQA 2H26B 4F7EA 4K55A 1J5OH 1AHWB 1IEHA 3BGMB 4YX2H 4UU9A 4LLQB 3EOAB 4F15C 4P46C 5L0QB 4PG2A 3X3GL 4QHKJ 3JTSA 4XPTH 4JPVH 4A6YH 1P6FA 2FJFA 2A9NL 2ARJB 3WDJA 4YDIH 3QPXL 1EXUA 1LDSA 1YECH 1FE8H 2AV1B 2CXGA 2V5YA 3ZDXF 4PLNC 5EORL 1CGTA 3MC0A 1FYTE 4ODHH 3ARVA 1HDMB 4NKOA 1HQRA 4FQHA 5JHLL 2RR3A 1A22B 5FCUL 1KPUB 5LGHH 1IKFH 4LU5L 4YDKH 1J05A 3TVMD 5E70A 3KJ6H 5FM5M 2BHUA 2GHWB 4IRSB 3BMVA 2R0WH 4NWUH 3V6OA 3GRWA 5HI3D 1JNHA 2FATL 4L9LA 2IADB 3VA2C 5HDBF 1AO7B 5DJDA 4NN7C 3T65A 4M4RA 2D7TH 4K2UL 1A6UH 4NQDA 5E2VL 3T3ME 4JY5H 3FHAA 2FJGB 3QZWG 1NUDA 5FYKE 3WS6C 4ZYKB 1INEH 4H8WC 4X6EA 3Q0HA 3ARDA 3JTTA 1N6VA 5HVWA 5HHMD 4HH8A 3FQTA 3T8XA 3SO3B 1OD7A 1JV5B 4Z7VB 1LO5B 1A0QH 3MV8B 4XI5C 4XGZA 1EO8H 3TT1L 2J8UE 1B6DA 1ZANH 5DF0A 4OFKA 4Q6IB 4JFXB 4ZPTB 1V05A 2Z0BA 4J8RA 3VD3A 4D0DA 4EUPG 1KTLA 2Q1EA 5FB8A 5ICZB 1K4DB 4ELMF 1AHWC 3QFJD 3WUWG 5ELIA 2IH1B 5DJCA 4BFBD 3LPWA 3RDTB 4BZ1H 1I7RA 4EN3D 1TXKA 4KJPD 3S9DB 2P5WB 5KTEL 1KIUA 1FAKT 5CSBA 1CIDA 4OZHF 4ZPVA 3ARYA 2H2PC 3QIUD 4DOHB 3P4NB 1ITCA 4LP4A 4UZGA 2J5LB 3GSQA 3MLUL 4HW6A 4OKVA 3V7AG 1R3IL 4S1RL 4HS3A 1KN4L 1EAPB 2SEBB 3WLWD 4G6FD 3R8QA 3BQUA 1WEJH 2XPGB 1C12B 3R1GH 4P2CG 3CD4A 5CSZA 4JLRA 2AXHA 4DUXA 1AKJB 1JHLH 3IJYA 4UQ3A 1BGXH 1IAKA 5SX5H 2XTJB 1CN4A 2YUXA 1JNNL 1KPRB 1RK0A 3T4AB 2DQIL 3SE8H 5J9PA 2QADB 1VGEL 4GAYB 4Z9KB 4K3JL 5TH2A 4WU7A 1DE4B 4HXAL 3QO1A 5DD3H 5B21A 4PGBA 4LNRA 2V6HA 3SO3C 2VH5L 1KENH 2W9LA 4C54A 3RIAK 4OCRL 5K59E 4PJAB 2OR9H 1DQML 2ZWLT 3T0DA 3ZE1F 4CW1A 4XP6L 2PW1A 5ANMA 3DHJA 3NACH 1X5AA 4MCZA 5CGMA 3RL2A 1E4WH 4QCIB 3LKOA 4F9LC 1UADC 2ZG3A 1SQ2N 3CSPA 4MNQA 3ZE2E 1X5ZA 2WQRA 5TE7H 3RWEB 5AEAA 2P1YA 3S7GA 1ZA3A 1OSPH 4XHJC 4XCCH 4BUGA 1FZJB 2O5XH 3O6LH 4LLYB 5C0CB 4HEME 3TZVB 3ILPB 2BC4A 1MHHA 1Q9KB 5SV4A 1U58B 3N85H 4PY7A 1MQ8A 5DZNA 1DBAH 4C83B 5A43C 4XAWH 3VXSB 4HUXB 2VDKL 15C8L 4XNXL 5F7NC 3RVWD 4QRQA 4TULL 3U9UB 4P5TA 4UDUA 4KMLB 4X6CB 3QB7C 4LFHD 2Q8BH 3KPLB 1LVEA 1MHCB 4G8GA 4NUJA 4M1GH 1CR9H 4LCUB 1CK0L 3MJ9H 1JL8A 5BS0A 1NGXA 3HMXH 1JZ2A 2AJSL 4QO1A 2NYYD 3KXFE 4ZXBA 1F4XH 4WO4B 5HJ3B 3THMH 2QADC 1MRDL 1FL6B 4XP1L 3HCVA 1KLUB 5SWQA 4PJ7B 2E6PA 3QCVL 4UTBL 3ETBF 3LN5A 4KTDH 3TN0C 1PKOA 1NC2A 4ZFZA 3FCTB 3SGJA 1J1XH 1JWSB 4TVPD 5JORB 3TCLB 4OLEA 4QOKD 3KYMB 1KN2H 3DGGA 4HS6A 2NY5L 5DJAA 4KRMB 4RFNC 3RZWA 4S10A 4J3XA 3S37X 1U42A 4QF1B 2DWEB 1LP9E 4ZS7H 5C9JA 1CBVL 3RA7L 4CAGA 3C5ZB 1H3XA 5T3XE 4UMGA 4OGYH 4XWGH 3MV7A 3N1MC 4M1DH 4PJFA 2X7LB 2AQ2A 4YLQT 1T7YA 3R0MA 3L5HA 4PJ5D 5DRXA 1LE5A 1MJ7H 1A6PA 5CILL 1YZZA 4JO1L 5JZ7D 2NR6D 3DNKA 1CD9B 5CLTA 1G9NC 4LLWA 1AXTH 3CX2A 5C9KA 3PGDB 1R5VA 4JB9H 2IAMA 4R97B 5EOCJ 3MTRA 2OXHA 3O81A 4FABL 4KK6C 1AQDA 1XGPB 1TZHA 3KPSD 2NY1C 2YD4A 4ZFOL 3KNBB 4OLXL 4MAYC 3ALWA 5GRUH 2C3VB 5JHDA 4WO4C 2ADFL 5HHPB 3REVA 3GI8L 3LHPH 2IBBA 1S7VA 3JV6B 1MVFA 5D70L 1W0WA 1IE5A 2NZ9D 3M8OH 4XNUH 2ICCA 1LDPL 5HGAB 2D9CA 12E8L 2ITCB 5DJXA 2VDNH 4YHLL 1OTSD 2W9DL 2E7BA 4EN3B 5E99H 3MRPA 3AU1B 1IQWL 3C5SB 3FZUD 1C08B 3VRIB 1HN1A 4LEXH 3RPIA 4G9FA 1T89A 4CDGC 5E6ZA 4JM2A 2Q20A 4KUCD 4HMCA 3EFFB 5IWLC 4K9EH 1T20B 1S7TB 3MLSL 5DEFB 1K9TA 4M93C 3GSRA 3D3VE 4UUJA 4OZIF 4HJJH 3LKPB 4U1JB 1NBVH 3RVXC 3MJ7A 4PRAA 2BXYA 1QD0A 4Q9QL 4ZUUA 4G6FB 4ONGL 2GITB 5IVXA 5CJXA 4ZUTA 1A9BA 1JWUA 4R90H 4WV1B 5E00A 4JG1L 3UC0L 1A4KB 4F33B 1WBXA 2FO4A 3MV9A 5E8NB 5GIRA 2YEZA 5IV2B 4MAUH 5C70A 2AXGA 4JFZL 1HYSC 1NMCB 1ETZA 2R1YA 2J6EL 3MNWA 3WS3B 5JIPA 4GW1B 43C9A 3TESA 4R97C 5KW9L 2GJ6D 4RQQB 2YXFA 1Z3GL 4RX4A 4B53A 2FBJH 4H0IA 4O2CB 3ROLB 1JZ8A 2X42A 2YPLE 2YC1A 3QXAA 1KGCE 4Y5VA 3NFNB 4GT7A 2OJZH 2V17H 1SJEB 2CIKB 1AR1C 3VXOA 3GGWB 4N0CD 1SEBA 3LMJL 2DLTA 2UZIH 4X7DC 4G8EB 4X4YB 3WBDA 5GGUA 2AGJH 1I7ZB 3QSKB 4KHXL 3BSZH 1CTNA 1RUQH 5EO1B 1FRGH 3WNKA 1XGQA 4OLWH 5DD6A 3HPLA 5D1ZA 2PTTB 4PJXB 4UV7L 3BOVA 3JWOC 3GBNL 2R2BA 5JR1L 4ZFFB 4CVZA 3TFKD 2VWEE 2VZUA 4AM0B 1IGYA 1N8ZB 1U8JB 4Z7QE 1QSED 3EBAA 4PR5B 4Y4KD 4CADA 3MBEA 4PLKD 3UTPD 1LNUB 1B2WH 3PIQA 5EWIL 4ODXB 1G7IB 1UA6H 2B1HL 3LIZH 5ENWA 1MEXH 3SKNB 5AWNL 3DROB 3BE1H 2R4SH 3LS4H 4O9HL 3RY6C 4ZSOE 3BX7C 4Y1AE 2ID5A 1K6QL 3GEWB 5KOMC 1DBBH 4KQ3L 4DGIH 5DT1H 3ZTNH 1ACZA 1E6OL 4QXGH 5IEHA 1XIWD 3F58L 4HSQA 5EZIH 3OX8B 1A1OB 2YD2A 5IQ9A 1GZQA 3HFMH 5HHNA 1VPOL 5F6IB 2C7UA 3E2HB 5TE6L 4GLRI 1ITBB 4NSKB 4JO3H 4Q74A 5D2LB 2R8SL 2P7TA 2B4CC 5HHQA 3GJFA 5GZNC 3VW3L 2PCPA 2HYMA 4MXQC 3QH3A 1TVBB 3NIFE 1QQDB 4QT5B 1QSFE 3P73B 3QFDB 4TSCH 4JHWH 4HWZB 4TTDC 1JE6A 4NNPH 5I1KL 2BNQD 4YWGL 1H15A 3BIKB 3EO0B 3T0EA 1DVFA 1E4XI 3G6JE 5D7LD 3FFCA 3LY6A 1KEGL 1MCSA 3H9ZA 2PTUA 35C8H 2ATKA 1NUNB 1UYWH 3LB6D 1LP9B 1UACL 3MOQA 4IOIA 1NLDL 5KSUB 4PJ9D 1YYMH 2BMKB 32C2A 2VLRA 4JGJA 3SGDH 3MRBA 4K3DH 3QCTL 3KPQB 1MELA 5J6HA 1UB5B 4FFYL 4GAJH 3ZDZE 2GEEA 3AB0B 5H37H 4LARH 4GBXC 3RAJL 2E9IA 3BDXA 3IGAA 5EA0H 1RZKL 5HGHB 2P44B 1QPPA 1UKTA 1Q1JH 3BIAX 1NGWA 5K9QI 4BSWA 1A6AB 3QJFA 5EBLA 5IMMB 4PV8A 5GS2D 3RHWF 1Q0XL 3BZEB 1LHZA 2DJUA 4P4KB 4NNYA 5C0IB 3DURA 1MQKH 3NIGF 3TO4C 4JFEA 3VXTA 43CAA 1ZHBA 5I1EH 4DCQA 1KBGH 2AS5M 1S3KH 2X1XR 3IDUA 3I2CH 4MA7H 2ADJA 4JDTH 4LPYA 1A9EA 4ETQA 1GOGA 3KAAA 5DEZA 3C2AL 2E5EA 3ARWA 2MNUA 5K33A 1S7WB 4LOUC 4X5XB 5E1AB 3E8UH 3O0RH 2EDJA 4N8VG 1H5BA 4LDLB 4PJIE 3GMQB 4PGZA 1T66D 3WN5B 1TJHH 5GQBA 1Q9WB 4X7FC 5D5ME 4RAUB 1PSKH 2GT9B 4MWFB 1UM6H 2PO6A 1U8KB 3D3VB 1HIML 4WCYH 4JFFD 1OARL 2X5PA 5D2NA 4XP9H 1MCWM 3FO1B 4RRPG 4RISL 1FFNA 5IROC 3QUZC 5FA3A 3SKOA 4KJWD 1CE1L 2Z93A 1IKNA 5DMGD 2XKUA 3BW9B 4H1LB 1QUNA 3HRZB 2J88H 1F4YH 2BVOB 5T1DH 1RIHL 4KTEL 4K3EL 3UBXB 4K7PH 2GJ6B 1NGQH 4DJMA 1EFQA 3N06B 4WHDA 4KHTL 3OKOB 5J89A 1KIPB 2DAVA 4D0BA 4X99A 1N2RA 4YZFE 5EOCH 4ZDHA 5KSVB 2BHZA 1MCFA 3QJHB 4WUUD 3NIDE 3IVKA 4KKBC 5GS0D 5MI0B 3WV0A 1FDLL 4DAGL 5JDSA 2YPLB 1BPVA 4P4KC 3MA7A 1WIUA 3REWB 4XVTH 2O5ZL 5CBAB 3JVGC 5DDHA 5FIEA 3H42L 4O4YL 3GSXB 1T7ZA 3PXHA 4GW5B 1LO2L 4XC3L 5E95B 1G7QA 1HSAA 4FP8H 2EH8L 2B1AL 3M1BB 2OYPA 2JELL 1OAYL 2GYSA 1H3TA 1P9MC 4JPWL 2PXYA 7FABH 1RK1A 1N4XH 1U8NA 2P24A 3MYJB 5DI8B 5C6TL 1T1ZB 3BP5A 4Y16B 5K9KB 4PJGA 5F7WC 3R4DA 3P9MB 1QSEB 4Q6YA 4Y4KB 3P3YA 5T1MA 1GRWA 5I75B 3CVIH 1JF1B 4X7TB 3TBSA 4XT1C 3WN5C 1TJIH 3OJMB 1MFEH 1QFWI 4RGNE 4ZO6A 3OZ9L 1HI6A 3VG9B 2QHLA 2VLJD 3CSGA 2P8PA 3PQYE 4HF5H 4NDMB 1AFVH 1TTFA 3FT2A 2CKBH 4PY8J 3SKJL 1P4IH 4Q9CA 3RVTD 3SE4C 3O2WL 3QG7L 1TJGH 4JDZB 4OZGB 4M6AA 4HPOL 1K4CB 5SWZE 2ESVA 1U3HA 2PR4L 1EMTL 2GIYA 2KQMA 1MAJA 4ZSOB 2P5EA 3LPGA 2DBLH 5IVZB 1OF2B 4GW4B 4HQQL 1U8PA 1UZ6E 4U1MA 1IEAB 4GUPA 5F9OH 1GVIA 3IDIB 1TNNA 1OGAD 3A6BL 4YHKL 5BVJA 4PRIE 1ZLWH 1F3RB 5MEPB 2KKQA 1AGFA 2NY6D 3AY4A 1FZKB 2DQGH 3B9AA 2CGRH 1AGBA 4EOWH 1LEKB 3HNTH 1I1FA 4QXTB 3QIBA 4UIKH 1KCSL 4LRIC 1FNHA 4V2CB 1K8DB 5I2IA 3EJZC 3BUYB 3FOMB 4PUBL 4PJHE 1ZHLA 5LCVL 2BNQB 4APQC 1K5NA 4L3EE 5D4QA 3CFJB 1RUKH 5MEQA 1QSFB 5D7LB 4C56E 3QHFH 5KJRH 1IC5H 3QNYB 4OZFA 4OCNC 3SGKA 3MLXL 1CF8L 1FFPB 5B3JF 5BJTA 4LSQL 3G6JB 2NY3D 4L5FL 4U6VH 5H37G 2YBRB 4PJ9B 2Y6SD 1N59B 1YNKL 4R7NA 2BRRH 4UILL 1NGYB 3I3EA 5EUOF 5I75C 3KPPA 1BZ7B 3KR3H 5EOQH 3U46B 1HILA 1XGUB 2VWEC 2V2XA 5C08A 2B0SL 2YSSA 2QQQA 4HIHB 4KK8C 5DLML 3FOLB 4FQXD 3MRCA 3VFRA 4LSVL 2MOVA 3OG4B 1QRNE 2X70A 3VD5A 2PYEA 3DVGB 1URLA 4XNZB 5EU7E 5GS0L 1ZA6B 4QRPD 2V2WA 5DQDL 4M6NH 5E9DE 1FL5A 4HUUB 4KAQH 3TBTA 1RHFA 4RBPK 3QAZB 4YPGB 3VFGL 3O9WD 4NQXB 4OF0A 4U0QB 1TQBC 3IFNH 3MOAL 5IF0B 2N56A 3R06B 1GAFH 1HK6A 3Q5YA 1BD2D 2FX8L 4X4ME 4MDIB 2F54D 4N8PA 3WFHB 3JV4B 1MCBA 2ITDB 2QHRL 3F6IA 2R0KH 3ALPA 5DTFB 5D1QB 4XNMA 1D6EB 2OX5A 3FN0L 3BXNB 1ZLVH 1DSFH 4OV5B 3IFPB 1S5IH 1JHKH 2CLZB 4YXKL 3QUMH 4PJEF 2ICWB 1Z5LA 1T03H 1DN2A 1WAAF 5D96C 2X4NB 5D72L 2DN7A 1N0LA 5LG1A 4J4PD 4U1SB 1JGDB 4MA1C 5DS8B 1S8DA 4PJIB 1UM4H 1HZHL 3AXLA 3D0VA 5IW3A 2D9QB 4M9OA 1B4JL 1NCBL 1M4KA 4HIIB 3L7FA 3I3DA 4LHJB 1T4KB 4N1CA 5D8JH 4LDEB 2EE6A 3BVNB 3H3KA 3DO7A 2R69H 4HBCH 3A6OA 1MCWW 4E41D 4KKCD 1JPSH 1MF2H 1EZVY 5F96L 5IQ7L 2H45A 4WWKD 3RWFB 2DQFA 2WANA 1S7QA 2V5SA 4PRHA 5D7KE 4PRBB 2EKJA 3K1KC 4RIRA 1MRCH 3CC5A 5DUMH 5BMFL 3NCJH 1MVUA 4ZMAT 1P53A 1RIVH 4DKAA 2AV7A 1UM5H 3QUYD 4G8FA 3VWJD 3QAZC 3BD5A 4X8JA 2YPVL 3WIHL 3C8KA 3WXVL 5CUSL 1SEQL 4L1HA 2XOTA 3GRWH 1NDGB 4QHNA 1CFSA 2BRQA 4PYGA 4CRPA 3Q6FA 1GC1C 2JJVA 1SBSH 3PHOA 4PBXA 2VABB 3W2DL 4JFQB 3TIDA 4HHAB 1YMMD 3V79C 1Z9SA 3PV6B 4F58L 1SJHA 1IAIH 3WD5L 4AL8L 5I19H 5IHLB 4M4PA 4O58L 5F3HB 5C0EA 5ECJE 4PRPE 1AGDA 1R5WB 4J3VA 5C0FA 5KSBE 4PRDA 5JW4N 3GMOB 3HRPA 2Z8WC 3V4PH 1NBQA 2CO7B 3QG6A 4FTVD 4OZ4A 5GGRY 3GDBA 2HVJB 1J8HE 2BVEA 2R2EB 2VN4A 2VZ1A 4H20H 5H8DA 2RJMA 1D9KC 4NT6A 2VLJB 4YXHH 5IW6B 4NN6B 1H3UA 5JW4Q 4RGNB 5EIIB 2EE9A 1XF2B 2ZOKA 3LKNA 2YRZA 3OB8A 4XHJD 4R6UA 4DGYH 2FH6A 1RV6X 3FQXA 2W60B 3B83A 5JXAL 1LEIB 3VMPA 4OLVL 4QYOA 5DMKB 2Z35A 5CMAB 5CGTA 2ICEB 1I7UA 1NKOA 5BZWA 1BFTA 3NABH 3IXTB 1YJDH 2GSGA 1FO0L 4HWEH 1OGAB 1DTUA 1MFCH 1CGWA 4K7PY 3MA9H 3SKMA 1X5FA 1AJ7L 3QDJA 2LU3A 3EJYD 3GSWB 2MMXA 5TDOB 3SDXA 2AJXH 4XVJL 4IIQB 1LO3L 3D25B 5E56A 3UBXI 2FWOA 1U2HA 1L7TH 4PRIB 3E1F1 4GMTH 2DRUA 5KG9A 1M71B 4G80B 4KKLC 2FL5B 2I5YH 5GHWL 3VRJB 4PGEA 3MRDB 1JGEB 3SDAD 5I30L 5LWYH 3EZJB 4JRYD 1A5FL 3M17B 2NY3B 2BCKA 3IDJA 1YEFH 4C56B 5ALBL 4XMPL 1MWAL 4OCSL 1U8LB 3RX8A 4MA8L 5I9QC 3H9HB 1ORSB 1FG9C 2AJUH 3U6RB 4I0PB 4IDJH 4LVNB 3O4LE 3Q3GB 4IHOA 4CGTA 4Q9RH 4M62H 3X3FL 4FQXB 4ODWB 1QEWB 1MIEH 2ERJC 1JN6A 3FONA 3IDMB 4YJZL 2VDLH 1KIQA 3BEVB 5CCKL 3PGCA 3KYOA 4EJ1C 4RMVA 2EDTA 2N1KA 3CZFB 1F45A 2IFFH 4QRPB 4Z7VF 5IESL 1KTDA 4GJTB 1KV3A 3V52H 5T1LA 4QHMB 2L0DA 1NC4A 4HJGB 1MFBL 1MJJB 4OM1H 3MLRL 2EXWC 2VR5A 1FYHB 5IKCA 3MV01 3MACL 4PB0L 5GGSA 2XWTA 1JPFB 3NZ8B 1EHNA 2X4PB 4FQQB 3VFVB 2X4OB 4PD4K 4ISVA 5I1AB 5IMOB 5IIEA 1OGTB 3LKQB 4DWHA 1MY5A 5EC1A 2QSCH 5FAAA 3D87B 2WIIB 4LSSL 3DVIA 4MAYD 3QCUH 1YNTB 1BX2A 4IRJC 3GM0A 5DK0A 2BFVL 4MD5B 3RTQC 5DHYB 2QEJA 1FGVH 1I9RH 5JOFA 3BAEL 1PG7L 2XNAB 3G6AB 3QDGD 1KCVL 2XQBL 4I0KA 2IQAB 2E7LA 1RURL 1T04A 5FOBA 1F58H 1H3PL 4CU8A 5I17A 4WRLA 4WEBL 3WO4B 3HE6D 4WI7A 3O4OC 5HSFA 3KLAB 4YO0A 5J6GB 3OAZK 2QR0B 4QHLA 3QEQA 4X7EC 1U3ZA 2HT4C 4XCFL 3O3DA 8CGTA 3MZTA 3QHZH 1NPUA 1CICD 4UT6H 3HI6H 4JO4H 4CMMB 4GG6A 5KSAB 3LKSA 1L0QA 3MUJA 3ULUH 5AUMA 3W39A 5L2KD 3BT2L 3RVUC 3PL6A 1NAML 4YFLI 3QPQD 3RVXD 4N0FA 4R8WH 1BF8A 3RNQB 3VI3E 1LO4H 3PWVB 4NP4H 3U82B 2R1WB 4NRXB 1EVUA 4G3YL 4RNRB 2VXTH 4OFPA 5DGQA 4LBEA 1YPZA 3QUYB 5EU7C 3VWJB 1KELH 1D5IH 3HE7D 1BOGA 5CD3B 5HHOE 1FLRL 3RWGA 3LQZA 2XKNA 1KCUH 1YMMB 1EAJA 2VLMD 4WJ5B 4HUNB 1NAKL 3LSOB 1Q9OB 2I24N 1U8HA 4K9EC 3GHEH 1UWEL 4U0RB 3S34H 3MRKB 4MJ5A 3NOIA 3QXUA 4P3CH 3SCMA 4OBRA 3STZB 4NQCD 3DETC 3IXAA 2Q86A 1PLGL 4I77H 4U49A 3JV5A 3UROR 5T1KD 3DECA 4PRPB 3GIZH 5EU6D 3BRDA 5GISL 3BRGC 4HJ0D 4Y5YC 3D2UB 5JUEL 4ZAKD 5IFAH 4Z77B 3WO4C 5C0ND 2WBWB 2Y23A 2NTFA 3O3EB 3S3SA 2IH3B 5LAXA 2DKMA 1CFTA 3FT3B 2ICWI 4ODUB 3VJ6A 2EYTB 2MCG1 3O8XD 2H26A 5IHBA 3INUL 1GGBL 4LLQA 1GZPA 1A7PH 1KFAL 2CK2A 1G9NL 3P9WB 5HYJA 6FABL 3BN9C 2HJFB 5E08L 3S4SG 3V6FB 2V5RA 3NFPB 3HZYA 1YY8B 3WFDL 5IFJB 2Y1VA 2AV1A 1WSST 2C4FT 5EUKB 3IB4A 3NGBC 4KRPD 1KPUA 1XMWA 4NO5B 4YHNB 1BVLB 3EHBD 3GI9L 1QHOA 1R6VA 3S98A 2FRGP 4LAQL 1KG0B 2ZG2A 3K2UH 1VESA 3J8F7 2IADA 2VR4A 1FAIL 5FV2A 1AO7A 3SDAB 3LH2L 4JRYB 1KJMB 3UJIH 2R9HC 1NBZB 4Z7WF 4ZYKA 5L6YH 3VXPB 4G6JL 3ISWA 4I4WB 1V3LA 3GK8L 2OI9B 5DR5H 2BDNL 2BNRD 4TTDD 1JV5A 4G7YL 1MLBA 1UCBH 5EZOL 5DD1H 3DMMA 1H3GA 3GMRB 5L8JB 2F5AH 4M02A 1NMBL 2MCPH 4PP2B 5T5NF 1TPXB 3TC9A 5D1XC 3MLYH 4Q6IA 4JFXA 4ZPTA 1H0DA 3KPNB 2DQTH 1BBJB 4MB5A 2W0KA 3OSKA 4Z7UB 3T2PA 2IH1A 4HULB 3TA3C 3NN8B 4K8RD 2OBGA 3RDTA 4RMTA 4BFIB 2DL9A 4ZUSA 4WHYH 5D7IA 2O5YL 5GRJH 1ONQA 5JPMA 4GKZA 1X7QB 2J8UF 3V0WH 5I1GL 3KJ4B 1BVKB 4M6OH 3HB3C 4U2YA 1XF4B 3A67H 4LIQL 5CGYD 5GRZA 1GL4B 1YEEH 2D03L 4MX7B 2A6KA 3MO1B 1UJTA 2SEBA 3ELAT 3Q48A 2FNBA 2JB6B 1DQQB 5GSVA 1N5YH 3DVNA 2BVYA 4FXGB 4OLZL 1F4WL 4FHBD 3UTSD 1C12A 3UXFA 3QDGB 5CLWA 1A2YA 5DMIL 4M61B 3D9AH 3RX7A 3WHXA 1RU9L 5C0RL 3O3AB 3JWOL 3P0VH 5D71H 3X12B 4B41A 4PRNB 3HE6B 2HJKB 3OF6D 2QSQA 5TGBB 3GJFH 1F8TL 1KPVB 1I9IH 2X41A 2VJXA 5BCAA 3BPLB 4PJ8C 3KYKL 1F4HA 2YN5A 1CICB 4D3CL 3IF1B 4V1DD 4LSTL 4U1HA 4PJAA 4LHUA 5EBGA 1RZ7H 2I60H 2CJUL 2ZCLL 4Q2ZA 1TPXC 5L2KB 2EICA 3V6OE 5K9OB 3T1FB 4Y5XB 4QCIA 1N5AA 3NAAH 4M1CD 1ZTXL 4WW1B 1CXHA 4NQDE 1AY1L 2JCCB 5JXEA 2UYLB 4WI3A 3RWEA 1A6ZB 4F9PA 4XMKH 3CFKB 1F11B 1FZJA 2NCMA 4JO2L 4LNVA 5K59F 3HE7B 1T7VA 5I1HL 5C0CA 4OF6A 3TZVA 3ILPA 4OV6F 3MGTB 3KJ4C 1Q9KA 4PS4H 5TQ0H 1S78D 1M1SA 1U58A 3EO1B 3UTOA 4XPAL 2B4CL 5GXBB 4MD0B 4AK1A 4C83A 1NGZB 3VXSA 4HUXA 3SOBH 1FP5A 1MCQA 2FHCA 1RUAL 3RU8L 5HHOB 4RZCB 3X11B 3ZE2F 5DHVA 4Z6AT 3W0WD 2FIKB 3BISA 1K8IA 3WJJA 1U3JA 3D69B 4LCUA 4Z0XB 2DMKA 4YH6A 5C3TA 5DXWA 5EU6B 2B7DT 5F89A 4OD1H 2CKBB 5EZLA 4KY1L 4QHKI 1BIIB 1I1YA 1F90H 5DD0H 2EC8A 4D2NA 4KDTC 2WAHA 1FL6A 3G5VB 3NVQA 2ZUQC 2AJYH 2APBA 3VH8A 3MRHA 1JF5A 3WLBA 3O6MH 1T6WA 3FRUB 2DD8L 4K8RL 4Y2OA 1ZEAL 1GIGL 1X3DA 3BPLC 1IC1A 2ZSWB 3FCTA 2BOCA 2JLLA 2XV6B 3RKPA 3WYRA 3TCLA 3HLAA 3CDGB 4EIZC 5KVGL 3KPMB 3K8MA 5GSRA 4UINL 4F2MA 3MRIB 2ZUSA 1NCCH 4GQ9H 2ATPB 4OD2A 5IGXL 1DFBL 4FFWC 3VFTB 3E6FB 3F5WB 3TVMA 4DK3A 2X7LA 3O41B 4CJ0A 4IMKC 5KANG 4S1DC 2ZKHH 3PJSA 1HHIA 2CLVB 1F3JB 4CVXA 1MSPA 4X9FA 5CEZH 1NCAL 1WBYA 4NZTL 5T5FL 4NHCL 2YUZA 3FKUS 2GFBB 1FC1A 1XH3B 3GNMH 3H7BB 5ANME 2DI7A 1JMXA 1FL3B 4XP5L 5HDQL 2H3NB 2VXQH 4UV4H 3VGBA 4ENEC 3PGDA 1IGTB 5FGCB 1FFQA 5DA4A 4MNQE 1N3NB 2WP3O 1CXFA 3U0PB 1BQLL 5EU3B 1XGPA 3EYSL 3EJZD 2X1OA 5E8DH 1UVQA 3B9VA 5KZCD 5DO2D 4HH9B 5HHPA 4PP1D 5H2BB 5E4IA 5ESAB 3WDHA 3JV6A 5I8OL 5DJZB 4S1SL 1CXIA 4N8CH 4WFEE 1ZT1B 3ARED 3MXWH 4OFYD 1FVEA 5HGAA 1DQLH 3QFJA 3CLFL 2ITCA 1D6VH 4NZRL 2EXYC 2OTPA 4JHAL 4NJAH 4QGYA 3O2VL 3PGFH 4TRPH 3L7EB 3AU1A 4U1IA 5HGDA 3P30H 4EN3A 4JDVB 3G9VA 3MUGB 1RIUL 4G8GE 1DR9A 1MCPL 3MGAA 3MRLB 1T5WB 1INDL 1RMFL 1C8PA 3IU3B 3HG1D 3OG6B 3QIUA 5BS0E 1I3GL 4ONOA 5E4EC 4OCLC 3MODH 4J7RA 5CBEB 4JQXA 3ALXA 4WI4A 4U1JA 5CEYB 2IEPA 3SBWA 5DZLA 3QNZA 5AZ2H 1HWHB 4Z8FL 1R24A 3RUGA 1XGRB 2X4SA 2X2YA 1WGOA 1BZ9B 1AD0B 1Y6NR 1QSZA 3SDCD 2G2RB 4WV1A 4WFFD 1GOFA 1YQVH 2DM2A 1AD9B 3UTSB 5CZVL 1PG7W 4LKXB 3VFNA 4F33A 3TYGH 2LFGA 5E8NA 3UDWA 3U2SA 2M8XA 3V0AC 5IV2A 3F7VB 3QI9B 3ILQC 2GW5A 4F7EB 4KI5E 3RHWK 4Y19D 3ULUE 1KJ2L 4UU9B 2VLKD 3S96A 3MCLL 2C3WA 4RQQA 3MNVB 1JGLL 1G6RL 4YUEL 1X5YA 3EGSB 1L9NA 3ROLA 5HI5C 3OKDB 4GS7B 4OM0H 1JPTL 3MV7E 3OWEA 4UT7L 1EXUB 3NFNA 2WUCH 4N1HB 4PJFE 2CIKA 3PP4H 2WBJC 3GGWA 1CZ8H 2QL1A 3WL9A 1HQRB 3OQ3B 3UO1L 3JSSA 4G8EA 1J05B 3O2DL 1H8OA 4OZFH 2EE3A 1R3LB 5CWSA 1JNHB 4L9LB 2EZ0D 1IGMH 2Q8AH 3WUZA 5J1TC 5GZOD 4PJXA 5J13C 5DJDB 3T65B 5LQBL 2IAND 4UB0H 2EIBA 3GBMH 5FGSA 4OQTL 1QNZL 4KZDH 1I1CA 5BW7A 3HNSL 4XPGL 4LASL 5I73C 4OF8A 5JHDE 3ARDB 3JTTB 4Y8DC 4ERSL 4ODXA 3FQTB 1G7IA 5IBUG 1AC0A 2CDGB 2UWEB 1J18A 3MRQA 4OB5L 4I1NB 3TGXA 1G6VK 3DROA 3EJJX 4Y89A 2B39A 3W0WB 3VXUD 1FSKB 4RA0C 4XGZB 4J8RB 1KTLB 5FB8B 3MRFB 3OX8A 1AP2B 4P2OC 3VXMD 1GGIH 5ALCH 4DKEH 3WNNA 4G9FE 4HKXB 1TCMA 5DJCB 3WUWB 3B2VH 2R0ZH 1W72L 4PG2C 4JY4B 5F8RC 4S0TD 1N6QH 5D2LA 4LMQE 3DHMA 1RFDL 1AGCB 4M7ZB 4ZPVB 4XPFH 1J11A 4KV5E 2QQLL 3DV4B 2D0GA 4HS8L 3SQOH 2AK4D 4QT5A 1QFOA 3P73A 3QFDA 5IVXE 4CN1A 3OKLA 1QR1A 4QOKA 4JN1L 4HWZA 3IS1X 1U8OA 1T0MB 2OL3B 3MV9E 4MQXC 3H9SD 4KXZH 3V6OC 3WEXA 3ARGD 2YN3A 1MJ8H 3I75B 1WBZA 5JIIA 3LRGA 2K7PA 4JLRB 5ISZE 4X80H 4J3WA 5C0BD 1JRHI 4UQ3B 1IAKB 2I25N 3Q6GL 2BY0A 2XFXA 5I1CH 2H2SC 3NIFF 1E6JH 1P6AB 1T2XA 5J9PB 1PAMA 4PJ5A 5D93B 3KPQA 5TH2B 4WU7B 4XPTL 3ARUA 1UKSA 3QHTC 3QO1B 4OLUL 3UYRH 4A6YL 1BFVH 4PGBB 1MRFH 1O7SA 3CPLB 4YDIL 1F00I 3VFOB 4UAOB 2CR6A 2YK1H 5HGHA 2DI8A 4ODTL 4JRWA 1K85A 4MJID 1WJ3A 4CW1B 2V9TA 2PW1B 4IS6B 4LVOB 4NGHH 5LGHL 3RL2B 3KPSA 5F1IB 4TOYL 1X6NA 3IFLH 1UXWA 5CINL 3KJ6L 4IM8A 5INCA 4ZOBA 3LQAC 3H7LA 2VL5A 1VSCA 1A7RH 4NWUL 5KZCB 4QTIH 3ZDZF 3BZEA 2DDQL 5JOPD 3VXRD 2GTWB 1SJVA 4RFEA 1GSMA 5C0IA 1G7JA 2Z31D 4JY6A 4JY5L 1JZ3A 4LHQB 1IAIM 3AREB 3BKJL 3OPZH 3GM8A 2BC4B 1INEL 4KPHL 1YJDC 3OAYH 3CLEL 4D0CB 4JZJB 4PY7B 1V7ML 1E27B 5T3ZD 5F1OB 3N0PB 5CP7A 3UTZA 3MQIA 1JHTB 1OAQH 4P5TB 1OW0A 2ZSVA 4G43B 3HG1B 1S7WA 2A6IB 3BQUC 4X5XA 5E1AA 3EUUA 1FH5L 4G8GB 3OR6A 1MCRA 3ZKSD 2HG5A 1KOAA 2MQCA 4NFBA 1ZGLA 3GO1H 1Q9WA 1UWGH 4YHYC 5LXGL 4L4TD 1E4KA 4KZEH 5BS0B 3CMOL 4RAUA 3HR5A 2GT9A 2BSSB 4MWFA 1EJ6A 5SV3A 1OM3H 4L4VD 4ZXBB 3SDCB 4R3SB 2EXWD 3BUTA 1GC1L 3FO1A 2KBGA 3T0BA 3LN5B 1IEBA 1NC2B 5KS9A 3VD4A 2F15A 2XRAH 4Y19B 4ZFZB 2BVOA 4PJIF 5FHAH 2VLKB 4YC2B 2GJ6A 2HN7B 3DX8B 5DJ6A 3GSNL 3T0EE 2QQNH 3CDCA 5D5MF 1X44A 2A0LC 2DQHL 3FFCE 4K94H 1NCWL 3DGGB 5DJAB 3LN4A 1HHGA 1KIPA 4IRJD 2VE6B 1D5ZA 1ZGLP 5KSVA 1OAUH 1MI5D 4OZFG 5C9JB 1BOYA 1L7IH 4ONFL 2QTEA 4J6RH 2VLRE 3PP3H 3R1GL 1GGTA 4PJDA 3MV7B 4I18B 1JHLL 1BGXL 3L1OL 2EYSA 4PJFB 1TVDA 5A2KH 5CBAA 5IB3B 1X5KA 4TSBL 1DQDH 2CUIA 5TQ2L 1AE6H 4P57B 2X4QA 1RVFL 2NQCA 1VDGA 5DRXB 1KSRA 2XICA 3IAPA 1GGYA 5FYLH 4YZFF 5GS1B 2IANB 4P5TC 3MYJA 3NIDF 1UWXK 4LLWB 3BJLA 1T1ZA 4B7IA 3FO0L 5FOJA 4PD4J 4WY7H 1FNAA 1G1CA 1X5LA 2OR9L 3P9MA 4KUZH 1QSEA 4BQBA 1XF5B 4X7TA 1JF1A 3MR9A 4MXWH 3OAUH 2XZCL 4J3OC 1E4WL 5HGGS 1OTTD 1B9ZA 4LPXA 1NDMA 4ZXBC 4NDMA 1P4BH 4LPUA 5CKGA 3VXUB 2EO9A 1CDBA 5SX4H 2BVTA 3REVB 4JFEE 1ZVYA 4YBQD 3CVHB 2GUOB 3BPNB 5F9JA 1OSPL 4QRSB 1RZGB 1W0WB 1XIWA 3FMGH 4ZTOL 2O5XL 4OZGA 2ZUTA 3AFLA 3O6LL 3UZVB 4MNGB 3WKMH 5IVZA 5E5UB 2DKUA 4GW4A 3MBXH 3SGJC 1KEMH 3T77B 1DBAL 5DC0A 3CFIC 4XAWL 2F19L 4L4JA 2FX7H 2C9AA 4KI5C 1OAXH 2VLLB 3TJHC 4YAQB 1T22B 3RPIB 4JM2B 3FHQA 5T3ZL 1FZKA 1WWCA 1WFUA 3DETD 1LEKA 4M1GL 2YD5A 3LRHA 3VXNB 1CR9L 4UUJB 1K8DA 2AQ1A 2BJMH 5D2NE 3WE6A 1TETH 2BNQA 3MJ7B 3BZFB 4JVPA 4URTB 1UZ6F 4XCEA 4ZUUB 3THML 5CEZE 5D7LA 1RZ8B 4ZUTB 5GRVK 5E00B 3ARGB 5E94A 1MREH 4JFYA 5BZDA 1WBXB 2FO4B 3MV9B 2BVQA 3JWDH 2J8OA 1BP3B 2YEZB 1CCZA 2Q7YA 1F2QA 1WTGT 3QQNA 4CNIA 2YD9A 4NC1E 3U4BH 4PJ9A 3MNWB 4X7CC 4ZS6D 4YDLB 1J1XL 2IAMC 1ZHKB 4HZLB 2EDOA 4PJHF 1BZ7A 3OBAA 3RY4A 2DQDH 3U46A 3PABB 1ACYH 3QXAB 4HIHA 1ZK9A 4Y5VB 5JTWA 3ZKQD 2W59A 4ZOAA 3H6JA 5C0AD 3QP3A 1FCCA 4MJIB 3OTTA 4OGYL 3DVGA 4YDVA 1S7RA 3T2QA 2VOTA 4XVSH 4KMTL 1X5JA 3UTTD 4KROD 5C7XH 5DJ8B 1JPST 1ND0B 5DD6B 3ULVH 5A2IH 1WZKA 2ZJSH 1MJ7L 2ADIB 3HPLB 4PJGE 5D1ZB 3UAJD 3VXRB 5CJQH 4NQXA 4NYLB 3W5NA 2R2BB 3MRJB 1T89C 3F7PC 5IF0A 1FPTH 4FQ1H 3RWHA 4LSRH 3N1FC 1IGYB 4DTGH 4JB9L 3WFHA 4CADB 3MBEB 1J0IA 3ZZ1A 3C9NA 3PIQB 2ITDA 1KLFA 3MRRB 4LLAA 2P46B 1D6EA 3JUZA 4RMRA 4YE4L 1CLZH 2JJSA 3WSQH 3VGGA 5CJXC 4OV5A 2ESVE 2CLZA 4I0CC 5FGBC 2P5EE 2ICWA 5ERWA 5IMLA 4Z7OF 3GKWL 2NX5D 2X4NA 5FDYA 1UKQA 4U1SA 1JGDA 5IQ9B 5DS8A 2VDNL 5J3HC 2E9BA 5HHNB 1P1ZA 4JFFA 5HVHB 4LEXL 2P7TB 3P11H 4XHQA 1VA9A 1T4KA 1HQ4A 2GJJA 4JVWA 3BVNA 2R15A 3QH3B 4K9EL 3HB3D 1RULL 4WW2B 1J0HA 5C92A 4GKNA 4HIXH 5I74C 3ZYIA 2NY2D 2KH2B 4NKQB 2HLFC 1H15B 4PRBA 1JI1A 7CGTA 4DEPB 2CRYA 4R90L 2YMXH 4W6YB 4WUUA 1IT9H 3NCYS 4M7KL 3UJJH 1CS6A 25C8L 5ILTH 2Y36H 4LSUL 1NDGA 4DKFL 4IOIB 2QV2A 2Z8SA 2DL2A 4OCYH 5C08E 3MRBB 4JFQA 1EUUA 3MBEC 2AJZB 3PV6A 3EOTL 5C8JA 1SM3L 4OIBA 1CFBA 2FBJL 5F1SA 4PY8I 3H3PH 5KBNC 1SVZA 2X4TB 5F3HA 2PYEE 4JJ5B 3KYNB 4JZNA 1R5WA 3IAQA 2X4RB 3ZKMD 3RNKB 1DL7H 4OTXL 1TIUA 4XNQB 2UZIL 4GRLD 2VDRH 1NGPH 1NGWB 1RUPH 4GRWH 4BSWB 4WUKH 5JA8B 4FQJL 1QYGL 3QJFB 2AGJL 5F21B 4RGOH 5EBLB 3HTLX 1KCRH 1RUQL 1FRGL 2B2XH 2Y72A 4OLWL 2VLJA 4FFVD 5IW6A 1PVHA 2HAZA 4KWUA 4YFEA 5EIIA 1XF2A 4NNYB 2WP3T 4N0UB 2VRAA 3L9RB 1BQHB 1WLHA 2Y4SA 4Y88A 3DURB 5KSBF 2ZCHL 1TCRA 2W60A 1LEIA 43CAB 5DMKA 5CMAA 2ICEA 1NEZG 3X3GH 2ADJB 2LABA 3QQ9D 4LQ1A 4ETQB 4XBEL 4LCYB 3IXTA 1UA6L 1WAAA 3OL2A 1OGAA 2A9NH 3QPXH 3T0EC 1DVFC 5EORH 2APXA 1RSFA 2VXVH 5TDOA 4IIQA 3D25A 5JHLH 2DB8A 4YHZL 4IOFC 1T1YA 5DT1L 2DIAA 3EAKA 4HC1A 4N8VB 2C4XA 4G80A 1G7LA 2FL5A 5CEXB 4IDLA 5TF0A 2PO6B 1HEZB 3WJLA 2FATH 2ZUVA 3MRDA 5I1IH 5D2NB 1OP3K 5FHBH 1QBLL 1MHPL 1FFNB 8FABA 5FA3B 5E2VH 3M17A 3SKOB 5HPMB 4ODBD 2YPKA 2D7OA 2EDHA 2Z93B 4N1EA 4I3RH 3PWNB 2DF3A 4PRHE 3QDAA 1U8LA 3FAXA 1E4XH 2FYYA 3H9HA 1ORSA 4H5SA 1L6XA 1N2RB 4ZDHB 1MUJB 4AEHH 5B38B 2X1PA 4FZEL 4FQXA 2QQKH 5EN2A 3IVKB 3TT1H 5JDSB 3BEVA 3NTCL 4PLOB 4MA3B 1UYWL 4XCNB 5E7BA 3MSPA 5L8KB 4DN3L 4PJBB 3CZFA 3HAEG 3F6LA 4QRPA 2FB4H 4YFDB 5DDHB 3T0AA 4AENB 4JFHE 4KROB 1IGCL 4BKLB 4K3DL 2OP4H 4HJGA 2BVPA 2ED7A 4M7LL 3RWDA 3MRNA 5IUSA 3O9WA 5KTEH 2VDPL 3G9AB 5EU5B 1U6AL 3RIFF 4ODVL 1JPFA 5GGSY 1OQXA 3NZ8A 1RK1B 5EA0L 4FQQA 3WS6A 4ENED 5IMOA 5I1AA 1BD2A 1FO0A 3DX9B 1OGTA 2F54A 1Q1JL 3U7AA 1GH7A 1OHQA 5ABDE 1H5BC 1WC7B 1Q94B 1R3IH 3TBSB 5DHVH 3EDFA 2C1PA 4WTWA 5ID1A 3K8KA 3U7WL 1W2KT 2WV3A 2FO1A 4HAGA 4R2GC 5DHYA 2P8PB 1T0NA 1Z0MA 3FT2B 1X6LA 5J57B 5D2NC 2XNAA 3G6AA 3VDCA 3STLB 2V7NB 2IQAA 3FB5A 4QRTA 1U3YA 4N5EC 2JE8A 5DWUH 1JNNH 1MQKL 1IKNC 4J4PA 2DQIH 5C09D 2P5EB 4TPRL 5I1EL 4POZD 1VGEH 3OKKB 3SO5A 1KBGL 4K3JH 1NFKA 4UTAL 2YXMA 3KLAA 2HLAA 3QDJE 5EPMB 2QR0A 4MA7L 4JQVA 4JKMA 1XGYH 4HXAH 4NC1C 1NMAH 3SDXE 2VH5H 3TYFB 1AGFB 3EDEA 1UQSB 3O0RL 4NFCA 3BGFB 1I1FB 1CLCA 4XP6H 4E41A 1INQB 2NY2B 5F7LB 2A73B 1QA9B 4WWKA 4EI5C 1ZHLB 3RNQA 1GPOL 1K5NB 3PWVA 3KGRA 4F80A 2R1WA 5MEQB 4NRXA 4QGTA 4ETYA 2OQJB 4RNRA 4Q7DA 5FYLE 3QUYA 3BGAA 4XP9L 3DRTA 3VWJA 4NJ9L 2VQ1B 1CDHA 2BSRB 3S3JA 1A6WL 2PXYC 3JZ7A 3QDMD 2NXZC 4XP4L 5T1DL 5DRZB 5HDOA 1YMMA 4WJ5A 1PYWB 4U1NA 3TCXA 3IU4L 1A7QH 2RCSH 3NCBB 3LSOA 15C8H 3BZ4B 3VI3F 3HS0B 1HILB 4XTRC 4P0DA 2CUMA 5C08B 2YSSB 4R9HA 1QKZH 2HFEB 4C55A 3STZA 1IGFL 3VFRB 2X70B 1XAUA 1CK0H 1UH2A 4ZO8A 4FTVA 4LCCB 4F9LA 1U3HC 3E0GA 2V2WB 2HTKC 1FL5B 1MRDH 4NKMA 4IJ3B 3VDAA 3O3EA 1OAZH 2IH3A 3LN9A 4FP8L 1A21A 3LEYH 2EYTA 3QCVH 4UTBH 7FABL 4TUJB 1QFWH 3AY4C 1PD6A 3RWJA 1XR8B 1RI8A 3CVIL 3QIBC 5FKPB 3T04D 5ADOH 2AEQL 1O7VA 1MFEL 1TJIL 2NY5H 4XNMB 1YY8A 5IFJA 5D7JD 1NAMA 3ARBD 4HF5L 1CBVH 3RA7H 5JW3H 1KACB 3DV6B 1P4IL 1F6AA 4NO5A 1IAMA 1R3KA 4GXUN 2V2TB 1BVLA 2DLHA 3N9GH 3ECBA 3QEQE 4WI5A 2OR7A 3EYOB 1KG0A 5A40E 3U4EB 2DBLL 1S8DB 3C08H 3FT4B 4NCC1 5E6YA 2IALA 5CILH 1FIGH 4GG6E 4JO1H 3SDAA 4JRYA 4P5MA 1KJMA 3CGTA 2IJ0C 4WEMB 2IG2H 4NM8H 4I48A 1AQKH 2CGRL 1IZKA 4TUKH 4JR9H 3L3KA 4PTUA 3DO7B 4I4WA 1GYAA 4M48H 4FABH 4D94A 3RKDC 2AVGA 1NCDH 1YPZE 2DQFB 4J3UA 4PRHB 2AABL 1H3VA 1N64L 5TJWK 1KLGA 5L88H 4HLZH 2ADFH 3ULVE 2AK1H 3GMRA 1I8IA 3CC5B 3TV3H 1IC5L 3FQUB 4G8FB 4X8JB 1A3RL 3KPNA 1FNGB 1CFSB 2H2SD 3KPRD 5EULV 1BBJA 4Z7UA 1P7HL 3PHOB 4A2MA 4YHLH 3TIDB 2HKHH 2OM5A 4BFIA 2W9DH 5K9QG 3C87A 2XQYG 2BY1A 1SJHB 2A1WH 2V5TA 2AJVL 2F58L 1X7QA 5C0EB 2HT2C 1BAFL 1AGDB 4EQ2A 5I1JH 1BVKA 4PB9H 4Q97A 4M9PA 4PRDB 3MLSH 2VMFA 1CDYA 4MX7A 3QG6B 1RZFH 4MAYA 1RY7B 2N7AA 5IJVB 4M6NL 3AC0A 4LGSB 2JB6A 3DBXB 1DQQA 4ONGH 4NT6B 4JREB 1EFXD 3L5IA 3OXSA 3RGVD 1BVZA 2X4UB 3UC0H 1X4YA 1PJ9A 1IILE 3BMWA 3S8WA 2JJTC 4JFZH 3IFNL 5CZXC 3FQXB 2D7MA 5FXCH 3S37L 5C09B 1GAFL 1S7UA 4QYOB 3HE6A 5KW9H 2X9WA 2Z35B 1VEPA 4HEPG 4GH7B 5TGBA 1I7UB 1KPVA 2XZAL 5GJTH 5HYJD 5I0ZA 2LE9A 2R0KL 4FQLL 2N4IA 4ZODA 1IJ9A 2GSGB 2NY0D 5J1AB 1BBDL 3C09B 1DZBA 3ABZA 1CICA 4TVPH 3SKMB 3IF1A 4RGMC 1YEGL 3QDJB 1DSFL 1ZLUH 4P3DA 1T3FB 1S5IL 4I9WE 1JHKL 1NL0H 5DVNA 1MCOH 3SDXB 3LMJH 5DD5L 5L2KA 5HI4D 2FWOB 1T03L 5K9OA 3T1FA 1UJ3A 2NNAB 1AO7E 4WW1A 4Z7WA 2YD6A 3KS0J 4KHXH 4K07A 4JVUA 2JCCA 5HHVH 2UYLA 3PDDA 4WTZG 3LV3A 4N90E 5AAWA 1ZWIB 5JR1H 3HE7A 3CSYA 4OGAC 2O61A 4XMLH 3IDJB 3QDMB 5D8JL 3CFDB 4Z76B 1T1WB 5I6XB 3TF7C 5MP6L 4ELKB 2AW2A 5MERB 4XB7A 4MD0A 1NGZA 1U91A 2A0LD 4GRWE 3MJ8B 2VQTA 1CDCA 1MF2L 5INDB 4LLMB 4RSVA 4RZCA 2RAMA 1KB5L 3X11A 4XVUC 3MMEB 4JKKA 4IHOB 4KK5D 5AWNH 2FIKA 3BEWA 1MRCL 4NQCA 3NCJL 1RIVL 2R4RL 1G7HB 3FONB 4EXKA 3D69A 1K6QH 4Z0XA 4BQCA 3U30B 1KIQB 1E6OH 5T1KA 2YKLL 5EU6A 1A1MA 5D7IE 3F58H 3CFEB 1IFHH 1BIIA 2ZNWA 2DKSA 4ZAKA 4PPTA 3QDHA 3D0LA 3G5VA 5DQ9B 5JQ6H 1VPOH 5JO5B 5TE6H 4YBLC 1RUML 5BRZD 4LCIH 3D48R 2UZXB 2R8SH 1BLNA 1IAIL 2I9LB 5I19L 5GGSB 2JB5H 2XWTB 4OLYL 1WIOA 3O8XA 1IVLA 2DTSA 2ZSWA 4K94C 3VW3H 2OSLA 1U93B 4ISVB 4DVBA 1LO0H 5IIEB 1JF6A 3F65A 5EC1B 3BDYL 5A16B 3W9DB 3QIWD 4KVCH 5I1KH 4AEEA 1BX2B 4M7JL 2YA0A 5D7JB 3P77B 5DK0B 3WIFA 2XTJE 3CXDL 4LCWD 3MRIA 3ARBB 2ATPA 3KWWA 4EIGB 4AT6B 1NANI 3C60C 3LQAL 2XG4A 3E6FA 2ICES 2D2OA 3DSFH 3F5WA 3FRPG 1T04B 5FOBB 3MJ6A 3O41A 1WISA 1NLDH 5I17B 2CLVA 3TNNA 3LS5L 5DJ0A 4I2XB 2Y7QB 1ZVHA 3CJJA 4YO0B 4PJAE 4FFYH 1RZJC 3TIEA 3QEHA 3PDGA 3JUYA 3O3DB 2VXSL 3B9KD 1PBYA 1FHGA 1Y6MR 3H7BA 4L8SB 3RAJH 1FL3A 4BSJA 5BXFA 2WLZA 3MA9L 3QULA 4GG8B 4OI8A 1J0YA 2JJUA 1IGTA 3LKSB 4X6DB 2YHGA 1BFOA 1CWVA 2AJXL 1N3NA 4ORZC 4WENB 1XEDA 1UFUA 4YNYB 5EU3A 3RBSA 3PL6B 4DFHA 4FG6D 1OPGL 2BNRA 2AKRA 2VDOH 4N0FB 3MRMA 2VXUH 5FECB 4OCMC 4R26H 4NO3A 5C0CE 1Q0XH 3LVEA 5TDPB 2QJDA 2F8VA 3AUVA 5F44A 4Y4HC 4LBEB 5ESAA 4LF3B 5DJZA 4YHOL 5F7FA 4AQOA 1DQJB 3VXSE 1BOGB 1JGVH 5BV7B 3EW3B 3RWGB 3LQZB 1A3LL 3LDBB 3NZHH 3IJSA 4KU1A 4GAGL 1WUNT 4FZ8H 3L7EA 3U0WL 1QOKA 3GSVB 3ARTA 2LV4A 3WXWH 3RPKA 5DYOB 2FH8A 3IU3A 3SCMB 3F7RA 1ZMYA 1VFMA 2FGWH 2A6DB 2E7LC 1JUFB 4PJ7E 3PV7A 1CQKA 4AIOA 3G04A 1ADQA 3CDFA 1YMHA 5B8CB 1EZVX 1BZ9A 3JWDC 4X7SL 3RY5A 2YZ8A 3UPRB 4QTHA 3V52L 4BFGA 5IR1B 5TF1L 1OARH 2NTFB 3K1DA 1BFSA 4LKXA 3UTSA 2NW2B 5T33H 3BKCL 4RISH 2Y06L 2VDML 1LEGB 3VJ6B 3F7VA 4KXZI 1NSNL 4DQOL 4K23L 1CE1H 2DM4A 5C0DB 3MPCA 1HINH 2WZPD 3MFGB 5SWSD 2A74A 1RIHH 1C5BL 1GZPB 4K3EH 3MNVA 3OF6A 2QSCL 3PL6C 5HYJB 3EGSA 4NN5C 3OKDA 3QCUL 2NY0B 3HZYB 2G5BA 4GMSH 3W11C 1CDJA 4V1DA 4GRMB 4K71B 1U92A 4PJCA 5FUOL 5C2UB 4DAGH 1KC5L 4KI5F 1ULVA 4OI9A 3ZE1E 3ULVC 2O5ZH 4I5BA 5BQ7B 4LQFL 5B39B 3ZDYF 1R3LA 3MLZH 4O4YH 2CSPA 5E8PA 4XC3H 1LO2H 3MLTA 2EH8H 3VFPB 2JELH 2PYFB 4I3GA 3ZMRA 5HHME 4D9RD 4HWNA 4UT6L 3HI6L 3SCMC 5B22A 5C6TH 4JRXD 4JO4L 2PF6A 5CHNB 5B3NA 3QZWA 5LGJA 1LE9B 2CDGA 3IDYB 2HLFD 2UWEA 3D1MC 4R8WL 3CNKA 1LO4L 1MLBB 3OZ9H 5SX5K 1VCAA 3W0WA 3DMMB 3HC3H 2Y5EA 4GRWB 4XH2A 1MNUH 4MYWB 3F7YA 1FG2A 3QFJE 3SKJH 3G5YB 5AZEH 1X9QA 5GS2H 1X5IA 1D5IL 3O2WH 3QG7H 1H0DB 1L4IA 3ZO0A 4FFZH 4KK9D 4HPOH 4EUPA 3MRFA 1AP2A 5E6ID 1KXVC 1HOCB 4G6AC 2PR4H 1EMTH 1A7NH 4HKXA 1I1AD 1KCUL 4AIZA 4HQQH 1SBBA 2A9MH 3WUWA 5L0QC 2WM0A 2YUVA 3FL7A 4ZUSB 5ADPH 5D7IB 1MIML 3BWAA 4JY4A 5BRZB 2DMCA 3MLVL 1V7NL 5TDNB 1ONQB 5JPMB 1AGCA 3G08A 1B0WA 1K2DA 5FO7B 1V3KA 4TN9A 3V4UH 4GKZB 3S34L 4HPYL 4X98B 5KAQG 2EDFA 3F62A 3DV4A 1D5BA 3RUGE 5CIPH 1FNFA 4I77L 1HHKA 1VEOA 4R7DB 4MJ4A 5HVFB 1D7FA 3OGOE 2A6KB 2NY4D 3QIWB 5LCVH 2N7BA 1T0MA 2OL3A 2X40A 4RAVA 1QBAA 2OXGA 4IRSC 5A3ID 5IFAL 3GJEB 1I8MB 5GSVB 3DVNB 4ALAL 3I75A 3MLXH 2UUDH 3B9DA 1C5CL 1A2YB 3KS0H 2IGFH 4LSQH 1EHLL 4H1LG 4KV5F 4L5FH 4AY0A 3WHXB 1GGCH 4MZ2A 3UBXG 1YNKH 4C57C 5IVXF 1MCNA 3RWCB 4UILH 1A7PL 4OQTA 3C5JB 3BP4A 1Y18B 5DURD 3QEGH 3IDYC 1CGXA 3B9KB 5AYQA 4I8DA 3CPLA 1SY6L 3T09A 3VFOA 4P9MH 5DLMH 4U1HB 3DMMC 3LOWA 4LHUB 1YEKH 4Q2ZB 2VDQL 2WMPA 3P9LA 4MVBC 4IOFD 4IS6A 4Q6IC 4HUWB 1KYOJ 4YGVB 5F1IA 2XA8H 4QRRD 3MLWL 1N5AB 4PJXE 4HGKC 5GS0H 2DM7A 5DQDH 3K2UL 1OVZA 3RDTC 4UBDC 2CPCA 5D9SA 2GTWA 2WINB 1UEMA 2R56L 3FQWB 2ED8A 3AREA 4OFYA 5SX4I 3S5LG 3SDDD 1IGJA 1FFOB 5EBWB 3CXHK 5F7HA 4ZUVB 1JMZA 4Q0XH 5K9JH 2FX8H 4JZJA 4D0CA 1DUZB 2J5LC 2ORBL 1E27A 2MKWA 2APTA 5DR5L 2QHRH 4R4BB 1JHTA 3ARFD 4ELMB 3FN0H 1QLFA 1A64A 4G43A 1PKQB 2AP2A 3HG1A 5DHVB 4G5ZH 4I3SL 4Y4FD 2A6IA 3NH7L 1K8IB 2F5AL 4YXKH 5BVPL 1MPAH 3MLYL 1P7KB 1V3JA 3CMGA 2XTJC 5F89B 1J1PL 3MCG1 5D72H 5EZLB 1I1YB 2BSSA 1IC4L 5D2LE 1AI1L 1J7VR 4P23D 3LEXB 1HHJA 3RZCD 3SDCA 4R3SA 2Q6WA 3IETA 3M07A 4YHML 2DQCL 1HZHH 3BDBA 1BWMA 5JQHC 4R0LB 3VH8B 3ZYOA 3MRHB 3WLBB 1B4JH 1TZGL 2A77L 5GRJL 2IFGA 1NCBH 2D0HA 4TVPE 5DFVC 4LGPB 1M6OA 3DXAD 4QOKE 4QY8A 4Y19A 3EYVB 4NKIH 2VLKA 2BOCB 4HGWA 2HN7A 3DX8A 3HLAB 4NHUB 3EO9H 4Z7NE 1VACB 2UVFA 5F96H 5IQ7H 4GFTB 3KLHC 3TBVB 2VE6A 4NOFA 5GSRB 4F2MB 4HC1H 4JM4L 5JXEC 5BMFH 3C6SB 4OD2B 3D6GA 3BH9B 4F9PC 1U95B 1UEYA 3CK0L 4XC1L 4I18A 4MZ3A 4PJ5E 3V5HB 1P7QA 1DLFH 3WXVH 2O93L 4DFIA 5CUSH 1SEQH 3TVMB 5IB3A 2KL6A 5DJ2A 4H0HB 5D6CB 5IP4A 4GSDL 1Z6JT 3TZVC 5LBSH 4D9QD 1FV1B 2FX9L 4P57A 1FNSH 3PJSB 5I8EA 1HHIB 4P99A 4DZBA 4CVXB 5HXMA 2G60H 1OTUC 1WBYB 4F58H 1I9IL 3VWKD 5GS1A 1LILA 2IANA 2K1MA 3WD5H 3WIIH 1CU4H 4O58H 4QWWC 3KPSE 4LDOB 4RFOH 4RMUA 3K46A 5JMOC 1RZ7L 2I60L 1XF5A 2L4OA 3L5XH 3QEUA 5HHMB 4YIQA 3O6FD 4EI5D 2IWGA 1OCWH 3MREB 3CH1B 4HFWA 1UVQB 4L9DA 3SJVD 3HZMA 4X6BA 4PGJA 3VXUA 3MXVH 4X6FA 5IK3B 3CVHA 2GUOA 2ZPKH 2C1OB 2P43B 4QRSA 1RZGA 4CVUA 3VXMA 4MNGA 3CZJA 1FVEB 1W8OA 5JXAH 3DYMA 3G5ZA 3QFJB 4PS4L 5TQ0L 1SVCP 1CGSH 1I1AB 4OLVH 3T77A 4H0GA 5C07D 5HGDB 1FZMB 4U1IB 3SOBL 3B3IB 2JTDA 2VLLA 4XTRD 4YAQA 1T22A 1FO0H 3GSNA 4XWOD 3QIUB 1AJ7H 4JAMA 2FECI 1FCGA 1T2QH 1GHFL 1A3QA 3C5ZC 1TTUA 5CJ8A 2EIZB 3L3DA 4WI9A 1LO3H 2AK4A 3VXNA 1HYRC 5MHSD 4F7TA 2F9BT 3SDYL 3FB8B 2NY4B 3QNZB 1F90L 1R24B 3RUGB 3BZFA 5A1AA 2X4SB 2HTKD 3H9SA 5GHWH 1RZ8A 3NA9H 3QYCA 5HI3C 3ARGA 4NQED 5KS9E 2AEIT 3QQ3B 4CDHA 5DC9B 3VFNB 3O6ML 4HIJB 2I07A 3QRGL 1A5FH 2GJ6E 5C0BA 1CD8A 3U2SB 3RGHA 1AXSB 1K3IA 2ENYA 2VUYA 4GQPH 2B5IB 1ZHKA 4HZLA 3S96B 2FD6H 3WFZA 2R2HB 3VFUB 1JCKA 3ZKND 3PABA 3QUXD 4PJDE 4ZFOB 1NCCL 1QBBA 4GQ9L 4N5UA 4HUKB 1MHEB 4KGLA 1U8MB 4MJIA 1SJXA 3WL9B 1EJOH 1JIBA 2EEDA 5CCKH 5FF6A 2J12B 4QRRB 3OMZA 2YD1A 3ME0A 1F42A 5IESH 2ZKHL 4ZTPL 5CWSB 2V9QA 5DJ8A 1ND0A 5E2UL 5CEZL 2ADIA 4EN3C 1MFBH 3VXRA 4QNPE 4KJPC 4XPHL 1QSEE 3H2WA 2Z31A 4NYLA 3UTPE 5DSCB 3MACH 1HKLL 3MRJA 5FUCE 1QG3A 4HWBA 2VXQL 5HYSG 2XACC 5MEOB 3QIUC 1T1XB 4NO0D 2NY5C 4PBWD 1OP5H 5A2JH 4LSDA 2CRZA 4JQXC 2OMBA 3MRRA 4LSSH 3SBWC 3ARFB 4P2QD 3MRQB 3WLWC 3ZT5A 1T5XB 4OZGE 1IQDB 4PJGF 1MCJA 4Y4FB 4WV1C 3P0YH 1PG7H 3CCHB 3GHBL 1KCVH 5B4MD 3UDWC 1IBGL 4L4TA 1RURH 1CT8A 1NMCC 1C1EH 1H3PH 1D5MB 5F7YC 2F53D 4L4VA 4P23B 3RZCB 4HT1H 1EBPA 1QFWM 1CL7L 2B5IC 3AAZA 4NJAL 4TRPL 1RJCA 4BK5A 2EDDA 4OZIB 4XCFH 3TNMA 4ZQKB 3V8OA 3NCCB 2FJHA 4DN4L 2BNQE 1A14L 5K93A 4P3WA 2PNDA 4WW2A 3MODL 1GOHA 4CUCA 5D7LE 1QR1B 1NAMH 3OKLB 3RIFK 1L9MA 4QOKB 3IDGB 1HSBB 1P84J 1U8OB 4JKPH 4IRJA 3AM8A 1WWAX 3U0TB 1MI5A 3WEXB 1LK2B 4G3YH 1YQVL 4WFGD 3VGFA 1WBZB 3V5DA 2QKIA 2ZG1A 1A6VL 5LKNA 2XFXB 3H0TB 4R4ND 1FLRH 2NMSA 4JG0H 4KKAC 5BW7C 3O45A 3HMWL 3PWPD 4PJ5B 2AJZA 4XAKD 3IRZA 1M7IA 3UEZA 4P2RD 5GGTA 4Y2DD 3HNVH 3RVWC 3VWKB 1LD9B 5L7XH 1UWEH 3ULSB 2X4TA 3V8CA 4JJ5A 4FQPA 4U6HA 3KYNA 2DYPD 5C86A 4G42A 4YHIA 1A4JB 2X4RA 1REIA 3RNKA 3BKMH 5DRWB 4POYA 2HFGH 4XNQA 1FJ1B 1PLGH 2I9TA 5EDXA 3OB0H 3KPSB 4HFUL 2W07A 1UXWB 4Z78B 5INCB 5JUEH 2VL5B 3V9FA 4KJQC 5F6IC 3E2HC 1IGML 5FCSH 1TFHA 4RFEB 5EFIB 1U8QB 1G7JB 3ES6A 2P8MB 1S9YB 3L9RA 1BQHA 4N0UA 2HA1A 3GBML 1VKXB 2UV3A 4JY6B 4PREB 4S0SD 2NY7L 3VFMA 1GGBH 1AXIB 4HXBL 4GXVL 3V6ZA 5C07B 5J12B 3GMPA 5CP7B 4LCYA 6FABH 2XIDA 5E08H 3UTZB 1F97A 1ZOXA 2EKSA 2FEEL 3WFDH 2ZSVB 3IJHB 4TNVF 4MGXA 3G5XB 2AQ3A 5HYQA 5LGKA 4JANB 3OR6B 1FN4B 2HG5B 1CDGA 4N8VA 1ZGLB 2LTQB 4JFFE 3HR5B 4Y5YA 3VU2A 1OLLA 4LAQH 5CEXA 2QLVB 3DRQA 1HEZA 4J3TA 5C0GA 3B2VL 4M8VA 1FAIH 5F7DB 1N6QL 4RDQF 3AB0C 5JZ7C 2NXYD 2NR6C 2VAAA 5HPMA 4RRPA 4H25B 1IEBB 5KS9B 4XPFL 3PWNA 1T80A 3SQOL 4G6JH 4FQ2L 5DJ6B 2QSVA 4IEFB 3S36L 5KANI 1WTLA 3GK8H 3Q5OA 4WUUE 2J4WL 2BDNH 3PUCA 3LN4B 3QUXB 1HHGB 2HJLB 2VSDA 1D5ZB 1JRHH 1MUJA 1S7XB 3HUJF 4JPIB 5EZOH 5DEGB 5B38A 5ID0B 2H8PA 3BPOB 5C0AA 2FIRT 1NMBH 4H88L 2IBZX 3C60D 3LRSA 4WNQB 4PJDB 2XN9D 1PX3A 4X80L 4MA3A 4XCNA 2NZ9C 4IOSD 2BHYA 4PJBA 2DOCA 2EYSB 5I1CL 4HG4K 1YEDA 1E6JL 4AENA 2E9WA 3UTTA 3PWUA 3EFDL 2X4QB 4BKLA 3MJGX 1ZLWK 1OTSC 3TO2B 4XXCA 3HPJA 1CE6A 2O5YH 3FZUC 4OAWA 3TWCL 5EU5A 1MRFL 3FO2B 4LEOB 3C6LD 1OW0C 4ZNCD 2H32B 4X5WB 5I1GH 1EHAA 3DX9A 5A2LH 4FMFA 5HYEA 5FFLA 4LIQH 2CRMA 1WC7A 5FYJD 3MR9B 1Q94A 2VLJE 1XCTB 4NC0B 5I8CA 4MCYB 4MJ2A 4MS8D 2P47B 2EH7L 1E4KC 3IFLL 2ZZUT 2MHAA 1ZLSL 1BIHA 1NDMB 4M6MH 4O5LL 4PG9B 4EDXB 4MMXC 2Z91B 3MYZA 3OKNA 1F4WH 4Y4HD 1NCUA 2E6QA 5CD5D 4Z0BL 1N7MH 3AROA 1MCCA 2V7NA 3STLA 5F9JB 5DMIH 5D7SL 1XIWB 2W0FA 2BX5A 2NX5A 4KJYB 3HZVA 4NPYA 1DN0A 1NFDF 2AAVA 4X5LA 2HWZH 3OPZL 1I9JL 5GGQL 1WAAE 1AC6A 1E0OB 2F53B 3JWOH 1OGAE 3TA3A 1G1YA 3OKKA 3EDJA 5EPMA 2JIXD 4CN6A 1A47A 1F8TH 1G9MH 5FUZH 1YY9D 3TYFA 4QXUL 1BECA 1I8KA 1UQSA 4N0CC 2CJUH 2ZCLH 4NM4H 4O2EB 5MI0C 3B4NA 1ZGLM 4CL7A 1INQA 4MQSB 4YR6B 5ETUB 3GO1L 1PDKA 2A73A 4KZEL 1QA9A 1IM3B 3WE6B 3VE0B 1UENA 1ZTXH 4XCEB 3I9GL 4ZFGL 2DWDB 3LZFH 2OQJA 5E94B 3SDXF 2MPAL 2WBKA 2VQUA 1I85C 2VQ1A 4JFYB 5BZDB 3I6LD 2BVQB 3QWRD 2BSRA 1YC7A 4HKBA 4JO2H 5EOTB 2Q7YB 3HC0B 3MUHL 5I1HH 4CNIB 2DIBA 4Y16C 3TFKC 4CMHB 3N1GC 5FHAL 5DRZA 4X4ZA 1WFTA 2HVKB 1PYWA 4P46D 2B4CH 4Y4KC 4PLKC 1ZLVK 2QQNL 5FUCC 1DBKH 5DQJA 3BZ4A 4P2RB 3HS0A 3RU8H 4Y2DB 4ZOEA 3R0NA 4F7CA 4LSPH 2HFEA 1WZ1L 5I71B 2DYPB 3VG9C 3T0WA 3SQBA 4QRPE 4MHHG 1KUMA 4GRLA 3BD4A 1RJZA 1QZ1A 1XIWC 3LD8B 4YDVB 3WFEL 1S7RB 4LCCA 1DQDL 4J1UB 1CGVA 1CXEA 1AE6L 2VISA 1AIFA 1HE7A 3HHRB 4P9HL 2DQEL 2F74A 3EYQC 5MEND 4DVRH 5IMKB 4DUVA 1BD2E 2F54E 4K8RH 4HAFA 4TUJA 1KNOA 1RZJL 3RWHB 2Q87A 1UGNA 4FQCL 3WNLA 1XR8A 5E0QA 1YUHB 3C9NB 5FKPA 4N9GA 4MXWL 1JJUA 2WUBL 3QR2A 5ITFA 5CIPB 1DDHB 5AYUH 3TBWB 5FYJL 2BZDA 1P4BL 3CFBB 3MCKB 4XI5D 2CIIB 3LCYA 3DV6A 5IGXH 1ADQH 4MXVE 2P49B 3PWLB 5ERWB 4HCRA 5TFSH 5IMLB 2IQ9L 3PXJA 3FMGL 2V2TA 2AEWA 4D8PA 1I3UA 3LB6C 5HPOA 2LVEA 4OGXL 3EYOA 4PJ9C 4X9GA 2DQJL 3U4EA 1DBJH 2WIMA 3MBXL 4HK3N 4KDTA 1CG9A 4OUOA 3FT4A 1KEML 1MOEA 1ODAA 1P1ZB 4JFFB 1NCAH 1IC7L 4NZTH 5T5FH 1JNJA 1RZIB 2FX7L 4GAFB 4LVHB 4C4KO 1IMHC 2NXYB 5ACZB 4E41E 4HX1A 1KJ3L 5HDQH 3BKYH 3BZDA 2H2PD 1HQ4B 1LK3H 2BSTB 1Z2KA 3PHQA 1UB6A 3EYUH 5F3BB 5C6PB 4GKNB 1BQLH 4F8QA 4L29B 4XNZC 2L7JA 5F8QC 5DC4B 1KXTB 1CVSC 4IRSD 4JJHA 3BO8B 3VXQA 3U36B 4GG6F 4WUUB 4N68A 3C8HA 4JN2B 3FQUA 5EUOB 3DUUA 1MREL 1B4RA 2XN9B 5I8OH 1YMME 4S1SH 1YQ2A 1WFNA 1F5WA 1FNGA 3U4BL 3E6HB 2W65B 1XF1A 3CLFH 4NZRH 1CXLA 1NCTA 1G0DA 3O2VH 4G7VL 1YPZF 5KVFL 4L8BA 5C8JB 2DQDL 4ODSL 1RIUH 1GGUA 3NFSH 1Q9LA 5D1QC 1ACYL 3G6DH 1Z0NA 3ULVF <