5HPMB

Cetuximab fab in complex with cyclic linked meditope
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
216
Chain Sequence
b'QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cetuximab Fab light chain
molecule tags Immune system
source organism Mus musculus, homo sapiens
publication title Cyclization strategies of meditopes: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
total genus 45
structure length 216
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hpmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hpmB01
3MV8A 1RVFL 3O8XC 1JYVA 5DD0H 1WIUA 5L88L 5DVOA 1KJVA 4NKDA 3KHOA 1KN4L 2PO6C 1AJ7L 1M7DB 3ARUA 1AFVL 2C9AA 4W81A 3SE8H 1UVQA 3LN4B 3KDMA 1S9VB 3L3GA 3WO4B 2APFA 3ME0A 1GGCL 1MVFA 4YIQA 5EBMB 5E6ZA 3AB0C 1RZ7H 5ADOL 2IPKA 3ETBF 1SJXA 5EOCJ 2CKNA 2IADA 5LJYH 4KVCL 2DMBA 4NQDE 2BMKA 1N0XH 3WDIA 3QHZL 3RA7L 5FCSH 1XF5A 4ZFGH 1P7KB 4PJGE 2EC9U 4LNRB 4PJ9C 4MNQA 4X6CF 2VQ1A 3HZYB 2OL3B 1FZMB 1OP9A 1XGQA 1NCDH 3QNYA 3A6CH 4Z7UF 1IVLA 3Q5OA 3O6MH 5HGAA 5EA0H 4LRIC 4MB5A 2X9XA 3F12B 5HGHA 3MV7D 1A2YA 1EGJH 4JRXB 4FTVA 5I0DA 1C5DA 2E3VA 4HSQA 3PDGA 4N8PA 4YBQD 4G8FA 3FT4A 1MHPH 5HDBF 4NWUH 1YEFH 3MV9D 4OUUA 1DBJL 5B8CC 4NOFA 4D8PA 5B39G 4LSPH 4LF3B 4OD2B 4JKLA 1T83A 4DUWA 4QOKE 3OR6B 4ZNCD 5KG9A 3HA0A 5EUOE 4AK1A 5ALCH 5C0RH 2CJUH 4KKLC 4H1LH 3DWTA 3MRNA 1TTFA 4HX1A 4RAVB 4JM4H 4QHMA 4POYA 4LIQE 1E4XH 3QFJE 4WNQA 1T03H 2ZZUT 4M7LH 3VFSA 1I8MA 1NAMA 3HFML 4Z7WE 2R15A 4IM8A 4YHNA 3AS3A 4UQ2B 5E1AA 1BOGB 4PR5A 3GFUA 3T8XB 4HJJL 5DJXB 1TJHH 1LO0H 1MCWW 4IOFC 3K4ZA 2OR7A 2BY3A 2IADB 4HGKC 1R3HA 3ABZA 2QJDA 5KVEH 1YN7A 1Z2KA 4DVRL 4C56A 1T22B 5JIHA 3I50L 3MLUH 2GJ6E 5DK0A 1QTYT 4KPHL 3RUGE 1HCVA 4QRUA 3V6FA 3IFLL 5LCVH 4F57L 4I48A 1D5XB 1EK3A 2F74B 1Y18B 3CX5J 3MCKB 1GZPA 1P69B 1KCVH 4J1UB 3LMJH 5HGDB 4V1DE 2I9TA 1JMXA 4KQ4L 4X0KB 4ONGH 1LO5A 2FLBT 1GHFH 3IXTB 2NY2D 3AMLA 4XPBL 1N5YL 1E4WL 2P43B 4LLVA 3H7BA 4NZJA 4ODWB 4Q0XL 4CU6A 4WFGE 1BZ7A 2B1HH 4YHYB 1HHKA 1JGDB 4GG6B 3KXFA 2GK0B 4YHOH 2IPUG 1BVKB 2XYCA 4N1HB 3HR5B 1I7TB 1KCSL 2B4CC 4JPVL 5HYJE 4KJYB 3LSOA 1IGIL 1L0QA 4LNVA 3WIFB 4Z7WF 1JN6A 1JZ5A 4QRRD 1E6JH 3TBVA 2XWJB 4ODWA 2FSEA 5GGSA 3UTPE 4WO4A 5DJAA 2WP3T 5GRVK 5KSBF 2D3VA 3JWOH 4F15C 4U0QB 2ARJB 3UDWC 4YWGL 4Y4HC 1OGAE 4F9PA 4MA7L 5ICYA 2FBJL 5HSFA 3GRWL 2ZWLT 1KLUA 1BBDL 1NCBL 5C3TA 5HYIA 3PHSA 1B6DA 1FIGL 2NLJA 1KJ2A 3D5OF 4GO6B 3RNQB 4G8EA 1LILA 3EYVA 4KK8C 3QXDA 4WW1B 1DUZA 4LSSL 2VDKL 3BYTA 1EZVY 5KANI 4A2MA 3DROA 4BUGA 5IM7A 3DLQR 3T04D 1MEXH 4EXPX 3VFGH 3QJFA 4K8RC 4MZ3A 3DTXB 2FX9H 3I2CL 3HE6D 1INEH 1MWAA 1AGDB 1S7QB 2BNRD 5C09B 3ARBA 1F11B 4U1HB 5JW4Q 2V2TA 4LGRB 4NUJB 1T0MB 3EJYD 4Z7UE 1G9EA 2F5BH 1LNUA 1CFBA 1DBBH 3MRJA 3WFZA 1F97A 4XNMB 1NC2B 3CVIH 3UEZA 3T2PA 4ZOCA 4Y19B 2WWKT 1T5XA 3QDJB 1FL6A 1OTSD 2RBLA 3ARFA 5HGAB 4LOUD 3QDMD 4PJGF 1KYOJ 1LDSA 4QXGH 3F6LA 4HKXA 5I8CA 3L6FA 5J0BA 1H8OA 3D2UA 5I1KL 4PRBB 1LEIA 4NDMA 3ESVF 3QDMA 4OV5A 4TSAH 4P9HC 1BHGA 5E6IA 4KZDH 4MWFB 1FBIH 3MOAL 1G7IB 3KXFB 3MLVL 4F15B 1VFBA 3SE4C 2VDPH 4TTGA 5MENB 3CFCH 3M17B 5ICZA 4X5LA 2F53B 4P2RD 2Z31D 4DVRH 5I1EL 4U31A 5IVXE 5DRXA 5ILTL 2GAZB 4QOKB 2NZ9D 1QLRA 3FRUB 3ZTNL 4YHYC 2VL5A 5EU6B 4GKSA 4IBLT 2UVEA 1YC8A 4G80B 2BHZA 3BW9A 3MACH 1CE1L 4N0CC 3HE6C 2J8HA 3O9WB 5DFVC 3RQ3A 2YUZA 2FL5B 1V3JA 2OTWB 1N8ZA 4PTUA 4JFXA 5EUOA 2J6EL 2PTTA 3FO2A 4ESKA 3QG7H 2A6IA 4HUKB 5H94A 1AO7D 4ELMB 4QOKA 1EBAA 3GSNL 3QNZB 3QB7C 5E8EA 8FABA 2PF6A 1NEUA 4JKPH 1NCAH 4WW2C 4APQB 1J0HA 1XIWD 1IQWL 3F7VB 4F9LA 1XIWA 3MUGB 4W6YB 5CILL 5DJ0A 5MEOB 3FO2B 4G7YH 2WWMC 1E6JL 4GKZA 3PP4H 3PQYE 3G5ZB 3C6LB 5F3HB 4O51A 4H8WL 2DQJH 2OTPA 5E6ID 1TCRB 3ZL4L 3MCKA 2NXZB 2YD1A 1ULVA 1JGUL 3FMGH 1MJ8H 4IIQA 1E4WH 4XNMA 1MCBA 2X70B 2N56A 3DSFH 1ZLUK 4KGLA 4OQTL 4MNQE 2DAVA 1UA6L 1LP9B 3IF1B 4G6FB 5E8DH 3WMSA 1CLOH 4K7FA 3ILPA 2VLLA 5I8EA 4JFEE 4R2GD 2HT2D 4DZ8B 3RVXD 4D9QD 2BOCB 1A6AB 4X6DF 4L3AA 3HC3H 4QNPF 5KVEL 2VERN 2A0LC 2QHLA 3PG2A 5ALCL 2JJTC 4S0TD 1ROWA 3IFLH 5LCVL 4ZXBD 4MVBC 5DJ6A 1DE4B 2Q87A 2QSCL 4ZUSA 2NY4D 1DBAL 4F80A 3WIHL 1TITA 4MXWL 1YNLH 4L8CA 3MRQA 5AWNL 3TV3H 4ONGL 1OSZA 1UGNA 2YRLA 4QXUL 1BFTA 4I9WE 4PG2A 5DVMA 2OSLB 2EDTA 3H3KA 1LO3H 3X3FH 3IU3A 3P30L 4D0CA 4AY0A 1WAAA 3BEWB 1C8PA 4OCMC 4QHKJ 4DVBB 4UIMB 4U6VL 4DGIH 3LOWA 4JG1L 1JK8A 4Z5RB 5I1GL 1ZT4A 1T2JA 3B9KA 3JZ7A 3DYPA 4PV8A 1N4XL 1MJUL 4PP1C 1BFOA 1KPUB 3BP6B 1RIVH 5HYQA 4O2CA 4PJIF 4Y5YB 5FYKD 3TA3B 2D03L 4E0RB 3F58L 3VFVA 3I6LE 1KPRB 5JIIA 4AIZA 1C08A 43C9B 2GTWB 1WC7A 3N85H 4F3FA 1Q0YH 4GAGH 4JO2L 4O2FB 3B43A 4WU7A 3TM6A 1P6AB 2CUHA 3L5IA 3PWNA 5JHLH 2ICEA 4LU5H 3X13A 5ADPL 2GSIB 5F96H 1OP3K 3B6SB 5A2LH 3ZYZA 3O3AA 2RCSH 4LLQB 5JNYB 2VXVL 4LP4A 4ZG1A 1QNZH 4MQXD 4U1NB 2NY4B 2G60H 4XP5H 3HRZA 4PJAE 1N59A 3W39A 5KSBA 2AJUH 3B9AA 5HDQH 3LH2H 4H20L 1HDMB 4OM1H 1YECH 4FQ2L 2NMSA 3WFHB 2X4SB 1JPST 4IMKC 3VXQB 3OKNB 3BKMH 1F3DH 2VC2L 4Q6IC 2GIYA 5A16B 4MJID 1AGDA 3M8OH 3ARDB 4MXQC 1FO0H 3E6FB 4DW2L 5C86A 5SV3A 3BKCL 5GS1C 1CDUA 3ZL4H 4LSRL 5E99H 5A40E 3NPSB 4U6HA 3SJVB 1GGIH 1RIUL 1CZ8H 3EYQC 1I7RB 1A6ZA 1PSKH 1VB9A 5LGHH 1VCAA 1Q0XH 5J1AB 4ZPVB 3SGJC 4ZDHB 4YO0B 3PQYB 4KH2A 3BEVA 4NRXB 2MQCA 3T77A 2YMXH 1YNTA 3O6LL 5GGRA 5KSAC 4BSVB 1KLGB 4NDMB 2LTQC 5D7JB 2NNAA 3GMMB 3QFDB 1DLHB 4WUUB 1HKLH 2HJKA 4JO3H 3WUWA 4K7PL 4LRNH 3ZKSD 1NBVH 5JHDD 1H8NA 5CZVL 3DUSA 4X0KA 2XKSA 1RK0A 5DC9B 1BECA 1EO8L 1YJDC 5CS7A 3OKLA 3KPRD 3FT4B 4EI5B 5DRXB 2ADGA 4H25A 4Z7UB 5JOFA 43C9A 4PJHE 3QFDA 3KVQA 1TVBA 2P5EA 3PL6D 1YPZA 5J06A 2NYYD 3ARWA 4LEOA 4L4VD 5KAQG 3MV7B 1QRND 1PKOA 1S9WB 1JWMB 4PJHA 2EKSB 5EU7E 5DHVH 2B0SH 2G5BA 4K9EH 3F7RA 2MJWA 1G7LA 1FBIL 4Q6IB 3PWUA 3C60A 3VE0A 2ZCHH 5I8EB 3UC0H 3NOIA 4TULL 5D1QA 1JYWA 2UWEE 4ETQB 2IPKB 3UTTE 2EDLA 4YFDB 3G9VA 5FYJD 1BVZA 1HIML 4X98B 1JHTA 5J8OA 1OTUD 2M8XA 4KRPB 2X7LA 3O2VH 1INQB 2ARJQ 1TVHB 4JRYB 4ZUSB 1UZ6F 5IB4A 3RWDA 2WIIB 3VDBA 2APXA 5T5NF 3OAUH 3FMGL 4UMGA 4L8DB 1J86A 2YBRA 3FFDB 4TUJA 1ONQB 2ZSWA 4XWGH 1EAJA 1U95B 3IDIA 3SDDD 4K07A 1IC7L 5KJRH 3ZYIA 2O26U 4OUOA 5EWIL 5INCA 3T3PE 4EDWL 1VEOA 4RMVA 4K7FB 3SN6N 4KTEL 4HUUA 5D5MF 3RX7A 1SYSB 4PY8J 4QRPB 1QBAA 1JHKH 1YECL 4TUJB 1IILE 1AD0B 2VDRL 1PKQE 4E0RA 3NIDF 3VJ6A 2GTZB 4FFVD 1CGVA 4OZHB 1JGUH 4NQDD 4N1CA 2EE3A 2BNRE 1DBAH 4PJGA 1E4XI 4ODXB 1MCNA 4HV8A 3GIVB 4XHJC 1Z0NA 4XVSL 5CIPB 2D31A 5IBLD 5D96B 5BV7H 5GS0L 5L9DH 4O02L 2F8OA 1FN4A 2NY5L 2EXYD 5GZOD 3U7AA 5E9DB 1I8MB 4M62H 3KNBB 5JMOC 4ZS6D 1VFOA 4IOSD 5IFAL 2GCYB 3P11H 1HDMA 2ATKB 5DMKB 2HVJB 2NY3B 2BXYA 3BN9C 2UUDK 1OWWA 5EBLA 3TA3A 1ZGLM 4XMKH 1QQDB 4OIIH 3E6HB 4CVZA 3MYZA 4JHAH 2I24N 4GXVL 4LLUB 2ITCB 3MV9E 1YEIL 2W9EL 1YMHA 4QRTA 5EBWA 3VXNB 4ZD3H 1PBYA 5HTSA 1O7VA 3P40A 3UO1L 3RWDB 4U6HB 4HZLB 1F11A 4U1HA 2XZAL 3QUXC 4PJCA 1XEDA 3KPPA 5D9SA 4UTBL 3S88L 1LNUB 4KUZH 3DI2B 4GG8A 2IPTH 4X4YA 1SJEB 1DBKL 4OLUH 5EU4A 4RNRA 5D71H 3QPXL 4U49A 4OF3A 1RURH 4XI5D 4OF6A 4WHDA 3KAAA 1S5IL 3R4DA 1UB6A 1ZHLA 1U58B 2ZUUA 4CMHB 3BIAX 3GGWB 3VXUB 1WCBB 3DUHA 5GRVL 1VFUA 3QFJD 1MFAH 4P4KC 4RRPA 1OARL 2J5LB 3P0VH 1EBPA 2H3NB 1U91B 1R24B 4PJ7E 4Y0GA 5JPNA 3GMLB 1K8DA 3SPVB 1RZJL 5C7XL 3LKOA 1CLYL 2H9GA 3D18B 4NPYA 1FNGB 1DL7H 4NO2A 1U2CA 4TOYH 4G9DA 1UYWH 5C0IA 1W8NA 4WEBL 3GIZL 3S36X 3J8F7 4Y4KB 4G6ML 2F8XC 1FL3B 5INDB 4OCYH 4S1QL 3TA3D 4G80A 1TMCB 2JK5A 3MROA 25C8L 1CFTA 4ODSH 3S5LG 4Y5XA 3D85D 2PETA 3WLWC 3BRDA 3DMMC 5HHME 1KJVB 4EEEA 4KPHH 5E4EC 1CIDA 2AABL 3GMMA 3KYKL 3VFNB 2XI9A 4JPWL 2JB5H 2MCPH 4M7KH 4E5XB 3FQUA 2WBKA 2NY7L 3UTSE 4P23A 1GPOL 4OQTA 4YDJA 2NW3B 4NZTH 5H35B 3BQUA 4HIEB 3T0EE 4EI5A 1FNAA 4BFIA 2UVFA 4UT9H 3V6OE 4PJDA 5E4IA 3HUJE 2FB4L 5IK3A 3ZSSA 4CVZB 3EO0A 4UBDC 5BVJB 3QUZC 4B41A 3GSWB 4WI2A 3VRJB 3LN9A 4U1IA 2R23A 2IFFL 4C57C 3BH9A 3UJTL 4LOUC 2B2XL 2E7LC 3LV3A 2N7BA 1S9WA 5JDSB 4HS3B 4JCLA 1IGMH 4X4ME 3HR5A 1XF2B 2VQ1B 4PJEA 3ROOA 1OGAD 2R69H 4RNRB 5J7CC 2NY6B 4PJDB 1B4JL 4NCC2 1PW3A 5IHUH 4NKDB 1KG0A 4OCWH 5E9DD 5CZVH 5HYSB 4PREA 3VRJA 5KZCD 4FXLA 5H37H 2BVOA 1H3TA 3QXUA 4UAOB 1CL7I 5FYJU 3CC5A 1N2RA 2HH0H 4WU7B 4MA1B 2XXCB 2WINA 2J6EA 3RY6A 3FQXA 1S7XB 5I30H 3A67H 5I1JH 4OZIA 3RZCA 3RFZC 4NQCE 5FGBA 2CMRL 1FZJA 5L9DL 1M71A 2EH8H 4LCCB 5I1AA 4JFQA 5DT1L 3ILQC 2DJUA 4OCLC 1XGUB 2HN7A 4M3KB 3U1SH 4PP1D 1FLRL 2R9HC 5AAWA 3DYOA 2BSSA 3QDGA 1VGEH 1FN4B 4EI5D 4Q9RL 2VSDA 2BNQB 4JFHE 5EO9B 4X6DB 4FQHA 2P7TA 1FVCA 3DRTB 1AD9B 3QPQC 5I1IL 4QCIB 2EEAA 5CBAB 5GISL 1HIMH 4LP5A 1KCVL 1A7NH 3R1GH 4TSBL 1I1FB 3QDGB 1G0XA 2GTZA 1EGJA 1YY8A 5JO5B 4ZSOE 3RDTD 1S78D 2W60A 2NY6C 5IV2B 3G5ZA 4KROD 5CP7A 1JWUA 3AREB 5D5MA 5TE7L 3W0WE 1OTTD 1TTGA 1I9IH 2YD4A 4XPHL 5ESAA 5C0BD 1DBML 3B9EA 5ALBH 4URTB 1FH5H 4ZXBA 4HWBA 3BP5A 2BC4A 4PV9B 3SGKC 3O3BB 5BO1L 4JFOB 5CWSA 3CDGB 3ARDD 1MELA 2KH2B 3RTQA 1DQJB 4KI5D 5HVGB 2ERJB 1OTUC 4R2GC 2NY6D 5GGVY 2FIKA 5L6YL 4GJTB 3DTXA 4G42B 3DI3B 3GNML 3CVHB 4HD9A 1JTTA 4FQJL 1AGFB 3NPZB 1WFUA 5C9JB 5SWSA 3NZHL 1UEMA 1DQQB 4ZUVA 3BW9B 1YY9C 3BT2H 4XX1G 5DD1L 2K9UA 5J3HC 3VA2C 3X12B 3G6JE 4ZS7H 4MDJA 4V1DA 1XF1A 2I07A 4HH8A 4LSSH 3WHXA 4UAOC 3UXFA 2L7UA 4RQQB 1KNOB 1HXYA 3ROLA 4KVNH 4XVJH 4PJIB 5BZDB 4UT6L 5IVZB 5IB2B 1NMAL 4D0BA 3IU3B 4DQOL 2X4UB 2HA1A 2F58H 1ORSB 2BNQA 5A3IC 4GW5A 4KHXH 5LGJB 2R1YA 4AEEA 4JRYA 2VLME 3VFNA 3C6LA 4BSVA 2F5BL 4E41B 1IAIL 2V5YA 2EDOA 5CBAA 2VL4A 1RU9L 1YMMB 3UTTD 5M7QA 1V7ML 1KEML 3BDYH 3P4MA 5IB2A 2YPKA 1XGYH 3GK8L 1JGLL 1PEZA 3CH8A 1R5WB 2JB6A 3EJZD 1UA6H 1RK0B 2AEQL 2ERJC 5JW4N 3OAYH 2FD6H 3ULVE 5BS0E 3P0YL 3MLRH 3WLBA 1CLZH 1ZANH 3WN5B 1RUPH 1ZA6A 3I75A 1EEYA 1GGUA 4PB0L 4APQA 2DTSA 2JIXD 2VLLB 4RMSA 1X5XA 4N8VB 1WZ1L 1BP3B 4YE4H 4P4KA 3BHBA 4ZXBB 2JCCF 1FP5A 2N4IA 4O00A 1QUNA 4O4YH 4HKBB 3MC0A 2RFXA 1JWMA 4PJHB 3DV6A 5F6HJ 5JNYA 1SBBA 3L95A 2H2SD 4C56D 3HRZB 2NLJB 4HJ0C 4ERSH 2X4TB 3GM0A 3QIBD 5AYQA 4PJAB 3MOBH 3BGMA 1G6RH 4NCDA 1EXUB 4XPTL 3TBWB 1BEYH 5TGBA 3L1OL 3Q0HA 2R4RL 3TNNB 4LASH 1U8HA 5TH2A 1L6XA 3K4AA 4QRSB 3WS6A 3R0NA 3WLWD 2EC8A 2EDRA 4JJ5B 3OX8B 4NZDA 1FO0B 2JF1A 4U6VH 5DHYA 2BVPB 5CZKA 4HBQA 4F7TA 1Z3GH 4RMTA 1J0ZA 1D5XA 2YD5A 5EULV 5E00A 5J1SC 5CJXA 4P46A 1QR1A 5MP6H 1I1YA 1IARB 1LWRA 2DQHL 5DUMH 1QSFB 4FQ2H 2BERA 4GH7B 3DRTA 3OX8A 1LDPL 1T5XB 1VEMA 5I73B 1F00I 1QO3A 3C9NA 5B38G 4NQDA 4X9GA 1D5ZB 3KYOB 1U92B 2MHAA 1P7KA 2R0WH 1CR9H 2JIXA 4Y4FA 1GCFA 1AKJD 4ZUWA 4NSKB 4YFEA 4HG4J 3H9SA 3QDGE 3BX7C 2ZKHH 5F96L 1VFBB 4RFNC 3MGOB 1HHIB 4C59B 3AREA 2BVUA 4DUXA 4QT5A 3NN8A 2LE9A 2LU4A 2AJUL 3ARGC 5ITFA 4QRPD 1J0IA 4RFEA 4Z0BL 1G7QA 3H9SB 1MJJA 4K3DH 2NPLX 3WEXB 4Z95L 4KKNA 3S4SB 1NBVL 4NPYB 2F58L 3RVWD 2BRQA 1CGTA 4G9DB 4XXDB 5DI8A 3MRDB 5E08H 2YPVL 5C0RL 4WWID 5BJTA 3IF1A 4F3FB 1ZHNB 4HWBH 3A67L 3QUYD 5DD0L 2DIBA 5KVFL 1KEMH 1Q94B 3BGMB 1KJMA 1FNFA 2VJXA 4ONHA 1BBJB 1JGLH 4N8VG 1UT9A 4NKQB 3GMNA 2BNUB 5IGXH 4NM8H 2BY2A 1BREA 4WI7A 3E6HA 2VXUL 5TE7H 3UJIH 3DETD 3V6ZB 1W0VB 4JAMA 1YNTB 4LSVH 5GGRB 5IB1A 1RZ7L 3B5HA 4XC1H 5ADOH 2VXVH 1F42A 4NUJA 1ZVHA 1T2QH 4K7PH 1HXYB 4P2QB 3ROLB 5DMYA 5EC2A 3MRBA 5D1QC 4LCWD 2W0LA 1KB9K 5I1CH 3I3DA 1UWEH 4LLDB 2NW3A 4PG9B 1Z9LA 4HKJA 2W0FB 4QHLA 3C60C 4KK5C 1K6QH 1QLEL 3OKLB 1HSAA 1QBLL 2FYYB 2QV2A 3FQRB 1MCDA 1V7MH 3FQWB 1CD8A 4LFHD 4LLMA 3V2AR 4AIXA 1A6WH 3AXLA 3BN9D 3O9WD 4S11A 3HCVB 5BS0A 4LU5L 2H3NA 5JDSA 2HFEB 1I8LA 4YXKH 3RAJH 3RI5F 5F7HA 4F8QA 1MFDH 2ZUQC 3KPRB 4PRAB 1FVEB 1VACA 3CNKA 3KLSA 5DRNB 3AY4A 5CMAA 4HWUA 3PGFH 1IC5L 1T5WA 3P3YA 4PJXF 1KTLA 4PRPD 4UUJA 4LKCA 5FO7B 4RQQA 5D1XC 5L6YH 5ID0A 3QEQB 4HC1A 4TVPL 2AEPH 5D7JD 4P9HH 3D9AH 2YHGA 4HWNA 2WBJB 3DUSB 1U3HB 4HBCL 3T0EC 4KHXL 1NANI 1PZ5A 4F33A 3RL2A 3GKWL 1M7DA 1LK2B 4LASL 3VFOA 3F65A 3PHOB 4L8SC 1L7IL 3SE3A 1DEEA 2R0KL 3GHBL 4EN3C 2HFTA 2EYSA 1KJMB 2Z8VC 1A9EB 3BWAA 4QEGA 2EZ0C 4FP8L 2FD6L 3K7UA 3UJJL 1P5UA 3A6BH 3L3DB 3HZMB 3LS5H 4POZD 2YN3A 5MP6L 3HE6B 1KGCE 5CJOL 2XG5A 4D9LL 2G5RA 3ARZA 2HJLB 1MCPL 4L5FH 2OR9L 1MQKL 2QQLL 2F54E 1C16A 1CU4L 4CBPA 1BD2B 2GYSA 4TYUA 3QEHB 3HI6H 4MD4B 4ODTH 3VJ6B 1FFNA 5B39B 2CQVA 4FQLH 1XT5A 5CP7B 2EEBA 2PO6D 4XPAL 1EMTL 3Q3GA 1G0YR 2HJLA 4JDVA 4KXZI 4Y4FB 1TCMA 1MCSA 3SDCC 4GRLC 4DZ8A 2IH3B 5I8OL 3O8XD 3PF2A 4TRPL 2DB8A 1IEBA 2VOTA 5E7BA 2BVOB 4PV9A 3SDXF 2AJSL 3FOMB 3WD5L 3VGBA 5BMFL 1FNGA 4HJJH 4PRNA 4Y4HB 4LAQH 3D0VA 2GY5A 1MUJA 3CH1A 5C08B 2Z0BA 3TPUA 4KJYA 1A21A 4ODBD 5F1SA 3O41B 4QRRB 5E2UH 5I19L 3IS0X 3LN5A 1INEL 3L3OB 3MZTA 5BVPH 3DX9A 1OSPL 2NR6D 4YZFF 1UXSA 1GAFH 1J0YA 1B0RA 5EORL 5A2FA 2Z4QB 5D1ZB 5J12C 4XMLH 1S7RA 4JLRB 2HWZH 1FDLH 5FDYA 2V2WA 3PXJA 3OAZH 3O2WH 5GRUH 2DQDL 4GXVH 2ZCLL 4X6FA 4XXDA 4ZDHA 3KYNA 4QF1A 1PZ5B 3SDAC 2E9WA 2P7TB 1U92A 2MHAB 1HHJB 4LQFH 1W72L 4JO1H 3OHXB 1UYWL 3WHXB 5KTEH 4OFVA 5FKPB 2IPTL 1JPSL 2IAND 4PBWD 3TBTB 1TTUA 4I2XE 1YEKL 2AGJL 1IAMA 1KXVC 1PQZB 2D9CA 3HTLX 2DM7A 1QFHA 4IRSA 1MIML 1N8ZB 1U3HC 2APTA 3MRIA 3ARRA 3S35H 5CEZD 5DK0B 4XVUC 1N6UA 3VFRB 2R0LH 3VXUA 1IAII 3P0VL 1N5AB 3KDMB 4LCUB 1CXHA 4AJ0A 1T0MA 3TBTA 3CFEB 1CE6A 3MJ6A 5FV2A 5HYFA 2DLGA 3ARPA 1FRGL 2HP4A 3NIFE 3ZT5A 3GRWH 2Q8AH 3RDTB 5E7FA 3OPZH 5D7IA 5C0EA 3SE3C 3MUHL 4U4BA 2AK1L 4LCUA 3O3DA 2X2YA 2BHUA 3BJLA 3IKCB 4O02H 5HJ3A 1NSNH 1JJUA 4Y16B 4MWFA 5J9PA 1IGJB 1U8NA 5AZEL 4Y5XB 5E1HB 1NBQA 3LVEA 4D9LH 5C0EB 3RKDD 5ID0B 3V5KB 4V1DB 3N1PC 2FX7L 3CPLA 5IROA 1Z5LB 2OYPA 5HVWA 1I7RA 1NGWB 2IQ9H 4Z7VE 2O5XH 3MLYL 4MVBD 5D2NE 3PQYA 3GHBH 1UXWB 5I2IB 4G43B 4YK4B 3W0WA 1VERA 4R0LA 2ZSVB 1DE4A 3QUMH 1QOKA 5B8CB 4KV5E 4N90D 4XRCB 3QXDB 1JTPA 4XMPL 3O4LB 2VLRB 4WEBH 1FL3A 4OLUL 4RX4D 2EXWD 1FZMA 3ZE0F 4H0HB 2JK5B 4FRWA 2OSLA 1IKFL 1MCPH 2IBGA 5F7KC 3FTGA 1G1YA 2DL9A 3BUYB 1X7QA 3HC4L 4OZGB 3IU4H 3MV01 3WLBB 3VWKD 1N6QH 5FM5O 1NAMB 1A6VH 5GGVL 3RX5A 4WW2B 3BFOA 4NN6B 2Q6WA 3ULVF 1NC4B 2BRRL 1T1XB 2NY4C 2PCPA 5H35A 3C09B 3NZ8A 4LVOC 4WI4A 3EYUL 4N0RA 1REIA 2BDNH 2P5WA 4YQXH 3ARFC 1SBSL 2X70A 1LK2A 1KPRA 4Y5XC 5K9KA 4JFDE 4X83A 3L95B 4UILL 3D2UB 2H6PA 3JV4A 4PJXA 1HHGB 4DAGH 3T4YA 4N5ED 4ONFH 1U8KA 1EO5A 2NXZC 2XQBH 5DRZB 3CZJA 3RWGA 4R4NC 4A6YH 2Q3ZA 3BKJL 4M9PA 3UYRL 3MRHA 5GRYA 4XP5L 1N4XH 4H26A 1LO5B 5BVPL 4OCRH 4MAYD 4MQTB 4KJWC 1P2CB 3AM8C 3JBG7 4OB5H 3L3OA 2DYPA 1JIBA 4MAYA 1VDGA 1TQCB 1WUNT 2X4OA 4LSTH 1KT2A 3ISWA 4GBXD 1MAJA 3MA7A 4S1SL 4YAQB 1LO2L 1EV2E 1FZKA 3T2NL 5DRWA 4AM0A 3RWFA 4DN3L 1RUKL 4JHBA 1V5JA 3B4NA 1OB1B 5TE6H 1HH9A 4M1GH 4M6MH 3SE8L 5GRJH 1OVZA 1DR9A 2WWMD 3EYSH 2D0HA 5IOPA 5GZNC 2CDGB 5MI0B 3UAJC 1A0QH 2ICWB 5FYLE 4CMMA 3C5JB 3QIUC 2DYPB 3UJJH 5EIIA 3DMMD 3HUJA 3R0MA 4W70A 2YD2A 1A14H 4AT6A 1H8SA 1MJ7H 4EVNA 3U30B 4GBXB 1K8DB 3G04A 3PWPB 5IOPB 1MQKH 2H9GB 2FHBA 2XN9B 3QAZB 2B8OT 1S7VB 2GJ6D 3GIVA 3QI9C 2E8ZA 2R39A 3PXHA 3KPSA 3THMH 1B0RB 4RMQA 3C8KB 1I4FB 5GIRA 3IJYB 2P8MA 3UPRB 3GJFK 1QFWH 2PCPB 3IDMB 3K8KA 1CFVH 1BQSA 2X44D 4KK6D 1CXEA 5JDJA 4K7PY 2P5WB 2XG4A 3WL9B 4NWTL 5DRNA 2DQCH 2CO6B 1KG0B 1R0AL 1NQBA 1EXUA 3MLRL 5JQHC 4P5TD 4Z7QF 4M00A 1WBXB 2C1PB 4V2CB 5B4MC 4JCMA 4LSPL 4M7JL 1ZT1A 2OLDA 1ZEAH 4F8TA 3VD4A 3Q6FA 4U1LA 1NH6A 4X8JB 1CICA 1KIUA 2EO9A 4NM4H 4UT7H 4DOHE 5T3XD 1IC4L 1R3HB 5J6GB 1JZ6A 1BQHB 1LP9E 2KPNA 5F1NA 5FYJL 1T22A 5L8KB 4MHHI 4I0PB 4G3YL 4M5YL 1HK6A 4J4PC 3ULUH 3EJZC 1L7TL 1IRAY 4FMKA 1FIEA 4WY7L 1SEQH 2BSSB 5GSVB 4G43A 2FEDD 4XWOD 3RHWK 3UTZB 4HS8L 2VO5A 5DUPH 5DZOA 3QCUH 3RI5K 3C5JA 3HE7B 3O0RH 5L2KA 3O4LA 2MQ3A 5DR5H 3WUWG 5DGRA 3M45A 2EDHA 1DLHA 1PG7L 1TQCC 3FQNA 5JPNB 4JHWL 1I85C 4U6XA 2NXYC 2Z8RA 3IDIB 4DWHA 2EICA 3INUH 1IGTA 4JREB 2FECI 4FZ8L 4JPIA 5ISZA 1YY8B 4KK5D 2VTFA 5JO5A 4BYHA 5C6TL 5DJ8B 2BRRH 3RZCB 4PIRF 5BQ7B 3NTCL 1Z5LA 1EO8H 1HQ4A 1B4RA 3FOMA 3U48A 1NDGB 2HRPL 1VEPA 5FOJA 2D7TL 1UACH 5EZLA 1I3VA 3BDYL 5F1OB 1IGTB 3CDGA 1J05B 5GHWH 2XPGA 1H3WM 4NOBA 1JNLL 5DHVA 5K9KB 3QDME 2Z92A 4KGJA 5CEXB 4MQSB 1KV3A 2BVTA 4WWKC 2FJGA 2BVPA 5ICXA 4EDWH 3LN5B 1QBBA 3RPKA 1OF2A 4NBXB 5H2BB 1KLFA 5C3LD 2K3TA 4X7EC 1B0GB 5EIQA 4LCYB 1DUZB 4KJQD 1C1EH 5F7NC 2A6JB 1HYRC 4KMTH 1X5AA 4MQ7B 2W0PA 3P2TA 2NY2C 3MJ7B 5T3XH 5DD3H 3UZVB 3RNKA 4PLOB 1WBYB 4WI5A 2OR8A 2X4TA 3LQZB 3MLZL 5L2KD 4JQIL 1OHQA 1QHOA 5TE6L 5DFTA 3T3PF 1NCWL 3NCBB 5DEGB 5EBMA 2GQHA 3WHE0 3PL6B 4LHUB 3BP5B 5DRWB 3L5XH 3WE6B 4MA3A 4NQXB 4C58B 2OK0L 1EX0A 4JRWA 3DVFA 4OFIA 3RZCD 2IAMC 2WZPD 5D4QA 1FCGA 2DQCL 3NFPB 1UZ6E 4CJ1A 2GSGA 5F3BA 1R5IB 1SYSA 1RMFL 4EVNB 1ZLWH 5GS1A 1U93A 4LHUA 4J3WA 4X4YB 1H3VA 1YYML 4XP4L 5EH1A 4QRRE 1RZKH 5EOQL 5GGVH 4OFDA 5CGTA 1OAZL 5MENA 4WFFD 2FEEL 5SX5K 5LXGH 3QFJB 1BQLL 3ARXA 4DVBA 3TBVB 4PS4L 4KZEL 4IMKA 1YEDA 4WDIB 4UNVA 3VRLF 4X5WA 1H3PL 1T89A 5BQ7A 4F58H 4OZIE 1I4FA 3BXNA 3H9ZA 4CN1A 1S7WB 4HT1L 1UKTA 2WBWB 3X14B 4LCWE 5D72L 5H37G 1QLFB 4QXGL 5BZDA 3O8XB 4MCYB 1OM3H 2P5EE 2NY2B 1X4XA 2PO6B 3MJ8B 1NEZA 3GUTA 3CVHH 4P2OC 1DJSA 5CEXA 5F6IC 25C8H 5EG6C 5IKCB 3CMOL 2WM0A 2DN7A 3QWOB 4D9QE 4JHWH 4HWZB 3VXMD 4JRXE 5DK2B 3V7MA 5D93C 5T1DL 2ICEB 4HX1B 1CTOA 2E27H 2JB6B 4KKAC 1DLFL 4M7KL 2MCPL 3GUTB 2D0FA 2ITCA 5JOPD 2HFFA 3I75B 1UWXH 3UTPD 4X4XA 2N1KA 5EZIH 3QEHA 4ZNEA 2J5LC 4ONHB 4YR6A 3U4BH 5DFWH 3UTSA 5IEHA 4BFIB 2EIZB 1NCAL 2LVEA 3BD4A 4M6OL 4P2OD 2D7MA 2FWOA 5E2VH 4NQDB 5F89A 5E8PB 2VLJB 3QPXH 2AEPL 3RBSA 1YQ2A 1B2WH 3DOSA 4M93C 4YPGB 3MOAH 2QKIB 3KYKH 3QEQA 4P2OA 4G6KL 3MO1B 1A2YB 1GZPB 2JB5L 2MKLC 3K2MC 5GS1B 1EHLH 1IGFL 1F6LL 4DGYL 3O2DL 4GRMA 4HIXL 1FZOB 3QEQD 2DJSA 1SEBB 5I6XB 4JHZA 4PJAF 2GITB 3TH4T 5I76B 3BZEA 2A9MH 2DDQH 2H45A 4AENA 4UNTA 2IGFH 3ZKXB 2P44B 3EDKA 3OKDA 1JNJA 4GMSH 2E8YA 1FZJB 1B4JH 4PGZA 4JJHA 5H2BA 2WSKA 4JFQB 4Z8FL 5ERWB 1YPZB 1C7TA 3VW3L 1C16B 3OG4B 1FZKB 4UOJA 1KEGL 3MV7A 4MD4A 3RWHA 1W0WA 1OOAA 3DX6A 4E41E 5ACMA 4MJIE 1BIIB 4DEPC 5F9WB 2I5YH 4UU9A 1RI8A 2Q20A 1PY9A 1UG9A 2VITA 4KROB 1TQBB 3MV9A 5F6IB 3E3QC 2EH8L 3CLEL 4WW2A 5B21A 3MLSH 2NXYD 3B2VL 1WV7T 2DLTA 4L4VB 1Q9WA 4M3JA 3MBEA 1EO7A 3DXAE 2IFFH 1FGVL 3KWWB 3ROOB 1TFHA 4PTTB 1FL5A 2ZOLA 5DQJA 3SDDA 1DN0B 4QRRA 1FG9C 1XR8B 2EXYC 4OZGF 5GZOC 3VGGA 1ODAA 5I1IH 1RZKC 4UV7L 1Q72L 4WWKA 3MRJB 4TUKL 4LEOB 4QNPE 4L4VA 3HCVA 2NY7H 3G6DH 2IANE 2WINB 4M1DH 4JN1H 2XFXB 2J12B 5JR1H 5GGTH 4HLZG 3OZ9L 1AFVH 1FPTH 1IBGL 5E94A 3AC0A 3V8CA 4DKAA 1NBZB 3ZE0E 3CX2A 3O45B 2IH3A 4M93B 1CD0A 2XTJB 5GGSB 4L4VE 2IQAA 2E7BA 3U83A 2C3GA 5BXFA 1Q0XL 3CVHL 4BM7A 1EUUA 3TCXA 2XFXA 2FJHA 1AQKL 2P24B 1A9BB 4P5TC 3ZKQD 5T1LB 1N0XL 3WNPA 3Q2CA 1H15B 1YEGL 3ULVH 1HSAB 2C4XA 4NN7B 2DLIA 1CS6A 2WMPA 4N8CH 2YD3A 1WEJH 4XRCA 1CU4H 2D7QA 4RMRA 2VC2H 1U8PB 3ARTA 4JPKH 3EOBA 1U6AH 2VIRB 4QTIL 4Y16D 3NACH 3SQBA 3QJHA 5CLTA 1RK1B 4WV1C 5LXGL 4OLYL 2DQUL 4J4PD 1J1PH 3MRRB 4NKMA 1LEGB 2H8PB 1HHHB 4JM4L 4UQ3B 1T7ZA 2YR3A 4K3GA 3T0AA 4U1KB 5JXAL 2AW2A 5BMFH 2YS4A 4RDQG 5JA9A 2OZ4A 2HTLC 2Y36H 5KAQF 4MDIA 1Q9WB 2EECA 3TH2T 3KLAB 4X4MA 4H1LB 3EOAB 4QHUB 4Y19A 3QIUD 3N1QC 1BAFL 4U1NA 4GXUN 3S96A 4LVHC 5J13C 5T3ZL 3L3HA 4Y4FC 1X3DA 1ZA6B 4OD1H 3UDWA 2YWYA 4TULH 2DM3A 4JDVB 4NRYB 1XCTB 4N90E 5I66A 2OI9B 4XBPA 3EDDA 4CU8A 1KENH 2KZWA 4MS8D 1ADQA 4N68A 5SWZA 4X6BB 5D1XD 3PIQA 3DV6B 1GGTA 5GPRA 4AH2A 4NC0B 3KPLB 4NFBA 1CICB 3WYRA 5CJXC 3A6CL 1M71B 3GGWA 2R4RH 1ZXQA 4ALAH 3HKFA 2VXTH 5IW1A 1MLCB 4OAWA 4P48A 4WCYL 3FRUA 1NBZA 4XBPB 3U4BL 1S8DA 2X40A 4O9HL 3QQ3A 4ZPVA 1A5FL 3IRZA 3G6JA 3OKKB 4XBGA 4BQBA 5A1AA 3LKOB 4N5EC 4LCIH 3WS6C 3OKDB 4LKXA 5TPWL 2ILLA 2CDGA 4ZQKB 5IBUG 1ZVSB 3VXNA 2D0GA 3HUJB 5KSAD 4EJ1C 3JWNC 3BP4A 5H94B 3ARFD 2YK1L 2P8PA 3CPLB 4OLWL 4P46B 4TPRL 4Y1AB 1M7IB 1UM6L 1W0WB 3SE9L 3WXVH 3W9DB 2EEDA 1SM3L 4XCCL 3O11A 3ALWA 2AQ3A 4NKMB 1G6VK 3LD8C 4MCZA 4UQ3A 1N7MH 5IMOA 3QUXB 3CFJA 3O3EB 3SDXB 2NY1C 1F3DJ 3FZUD 4HS6A 4JRXA 5IFHH 2PW1A 4YDJB 1CGSL 2NCMA 2DI8A 5TE4H 4YDVA 2HKFL 2RQ8A 1BOYA 2VDOH 3U46B 3N06B 3SO5A 5FCUH 3BUYA 3PGDB 4XX1E 2D7PA 3L5WA 1JUFA 5FYLD 4U3HA 5IMOB 3DO7B 3RVWC 2DWEA 3NH7H 1TNMA 1UVQB 4JN2B 4KKLD 2ATKA 3B9VA 3LEXA 5FYLL 4HFUH 2A83A 5GRJL 3GMQB 3U4AA 4XCEA 2ZKHL 4P59L 1KCKA 4I0KA 5F9AC 1H5BA 3SEPA 2CPCA 4U3XA 2ICWA 3TJEH 2GJZA 4AG4H 1IGYA 5DD6A 4MXVF 5HDOA 1URLA 4HZLA 4HWEH 3B9KD 4QHNB 3EKCA 1P7QB 2O5ZL 4PP2A 2BSED 3IT8D 4PGJA 1FYTE 1NJ9A 1I7UB 3UYRH 1CF8H 4W6XB 1VPOL 2ZOLB 2R1YB 5DQJB 1H3GA 4QO1A 3B9KC 1UM4L 2XACC 1JHKL 1QSED 3CDCA 2FH6A 2DD8L 3PP3K 2VDQH 1G1CA 1TZHA 1KYOK 4JRXD 1AIFB 1KENL 4QHNA 3RVTD 3U0WL 5CINH 2Q8BL 1H9VA 1J1OH 2FJFB 4PJXE 4BZ2L 2Q86B 3RTQC 3HAEA 3MBEC 5I73C 3ZKXC 3S3PA 3V0WL 4ZXBC 4JRYD 4LLAA 3LPWA 2A6DB 5DQ9A 4WENB 1X7QB 4OZGA 4LVEA 5C9KA 2D31B 4NGHH 32C2B 2HLFC 1OAUH 4RFEB 2X1PA 3MLTB 4UB0H 1JI1A 3MGTA 5CD3B 4LCWB 3WKML 2AKRA 4IHOA 4OM0H 5D8JL 1QLFA 5FUZL 2O5YL 3W5NA 3FB5A 3PGFL 5FGRA 2EYRA 4IDJL 4PJDE 4OB5L 1MHEB 2FJGB 3OKYA 3U46A 3VXRD 3H42H 3IRPX 1HQRA 5DJCA 1C5BH 3BMWA 5J11B 4R0LB 2NY1D 3IB4A 3LQAL 1KCUL 2E7HA 2VIRA 3SDXE 4NZRL 2M1KA 4HWZA 3LZFH 3ET9F 3QUYB 3AU1B 3IDJA 3MBXL 3P4NB 2LAGB 1TJIL 5B38B 4Q6IA 4W68A 4FFZL 3QCUL 1AY1L 4WFEE 3O0RL 3HS0A 4N9GB 3O2DA 3ARSA 4UZGA 1TPXC 1QR1B 2FLRT 3ULVL 2IAMD 1JPFA 3LB6D 1HE7A 1CVSC 2R29H 1TLKA 1MCKA 3ZKND 1CDBA 4Y8AA 1D9KA 4PP2B 1XIWC 3NZ8B 3IFPA 2JJSC 3RDTA 1IFHL 3VFWA 2NX5B 4K3EL 4HKZB 3R8BB 4I13B 4ZTOL 3HI6L 2Z35A 4P9ML 1HCFX 1DBBL 3N9GL 4ELKA 5FYLH 4KDWA 4UT9L 3BZ4A 4LARL 3SDAA 2L4OA 3S4SG 4DK6A 2M26A 2ZSWB 3DVNB 1BPVA 1K4DA 3ZSTA 5HY9A 2VAJA 1I75A 2ZJSH 1MWAH 3W0WD 1DQLL 1P53A 3PJSA 5DMIH 3S98A 2Y07L 3P30H 2E6QA 1XR8A 5HI3D 5IMKB 1E6OL 5C9JA 3ZDZF 1O0VA 3MA9H 4WU5B 1YY9D 1VKXB 4EBQH 4OD1L 3V5DB 4X7CC 3G5YB 3L3KA 5ABDE 1R5WA 3KR3L 1J8HE 4JZJC 5GS0D 1RPQA 1YNKL 2ID5A 3LRHA 3UTSD 4CU7A 1YDPA 3JTTB 4R97B 4X6CA 5CGMA 1HQ4B 3T0ED 1CFSA 3U2SB 1OAQH 4G8GE 5ERWA 2C3XA 2LTQB 5D7JC 3S6CA 4D0BB 1LO3L 4Q74A 3X3FL 1UM5H 1KTDB 5JHDA 2UZYB 3W81A 4GW5B 5LGJA 2WUCH 4KHTL 5ITBH 1CDYA 4S1QH 2VH5L 1S7VA 2W91A 2W07A 4LCIL 3KJ6H 1DBMH 2NQCA 4Q9RH 2Q6WB 3D39E 2NTFA 1P7QA 1EEQA 1HI6B 3BMVA 5C0CE 1RIVL 3EUUA 1OAKL 4PUBL 4Q9QL 2ADFL 3F58H 3CXHK 3I6KB 3B2UD 2WBJD 2PUQT 2ESVD 5GRWA 5D6DA 3TYGH 2H6PB 3KPTA 4I1NB 3RU8H 2DYPD 3FB6B 1MPAL 3EO1B 3HE7A 2CUIA 4J3OC 5SWSB 1I1YB 1HZHL 3FQNB 2DQEH 1NGQH 3UMTA 1I7TA 5DXWA 2NY0C 2DTML 4M61A 2WIMA 3DVNA 5T33L 4Y4HA 1PEWA 3OGOE 4LPCA 2GEEA 4UUJB 5F93C 1RJCA 1D5ZA 4XAWL 1NGZB 1I1AB 1YPZF 3RY6C 5HGHB 2AXJA 4GRLB 4GOSA 4HUWA 1WT5A 2ZNWA 1F2QA 2EDKA 5F44A 3TNNA 1ORQA 1HEZB 1ZE3C 1ZLSL 3N50A 2VXQH 2Q76B 4K94H 4M61B 4HDIA 4X5XB 3NIGE 4BZ1L 4HEPG 3TT1L 3C08H 1CDIA 1RZKL 4EQ2A 3TZVC 4HIXH 1GAFL 4NO0D 4KRLB 1RSFA 4FQLL 4XGZA 3SY0A 5I30L 1DFBL 4GSDH 1J10A 3BIKA 3TN0A 2PTVA 1ORQB 1NLBL 2DDQL 1T6VN 3QUYA 3F7VA 1D5BB 5TDOB 2VSCA 3G6JF 4NQTA 1ZS8A 1MCJA 1PD6A 2R56H 5FGSA 4XGZB 1Q9KA 4NGHL 4B53A 3GBMH 5IB5A 4O51B 4X99A 4J7RA 4HLJA 4Z77B 1JPFB 1KBGL 4EBQL 3REWB 2YXMA 3S35L 4EI6A 1MCLA 5GZND 3BP6A 3GMNB 1MOEA 4BH8B 1F6AA 2CJUL 5T1LD 4AIOA 1J05A 2D7NA 2RFXB 1C5BL 3DSNA 3ARED 4GBXC 3HPLA 1OT1A 1QYGH 3QWQB 1BJ1H 1NFDF 2R1WB 3JWOC 5BRZB 4NNPH 4OCNC 1JV5B 3RL1B 3B5GA 3LQAC 4E42A 3QIWC 4KRNA 1MJJB 3Q1SL 3LDBC 1Q8MA 4AEIL 4YJZL 5I66B 3ARBC 4U1GC 3MBXH 3FB8B 1GIGH 1T1YB 1LEKB 3SBWA 3W11D 4KY1H 3C5ZB 2F53A 5F21B 2VNCA 4KHTH 3D18A 2AI0H 4XCNB 5DFVD 3HPLB 4QOKD 4KKCC 4L3ED 1UB5B 4IOIA 5L8LB 1T83C 1UXSB 4HUXA 4IRJA 5E2VL 4MD5B 4Y4KA 4O5LH 5ANME 1RHHB 2QBWA 3FQXB 2Q7YA 5C2BL 1T1YA 2BNUA 2CRZA 4ZMAT 5CBEB 5BW7C 4UIKL 3DUUB 4MA8H 4FXGB 2A73B 4OZIB 1Q9LB 3SGEH 4QRQB 3LRSB 4HKZA 2DLFH 3BEWA 4JZOB 1CDJA 1OGTA 4OZGE 4YEEA 35C8H 2I27N 4NHCH 2WANA 4OZ4A 1A47A 4XP9H 3GHEH 1R5IA 4U7KA 3HLAA 2AK4A 4XWGL 5CGYD 3TN0B 4EZMA 1FIGH 2I9TB 1KIPB 5HHXH 1MCQA 3DHJA 1MWAL 4PJ9D 3LPFA 2FZ3B 1AH1A 4C83B 3T0VA 2CK2A 3VFMA 3MR9B 5IMKA 2DIJA 2NY5H 5BVJA 1G7MA 4U7MA 2PW2A 5IESL 5BOZG 3JV6B 3NFSL 3QI9A 4GRWB 4KI1A 3G5YA 4JANB 1T7WA 3VFUA 2ZUSA 3TT1H 1P5VA 1ZLVK 1IAIH 4LGPB 2UV3A 4WTZA 4KDVA 3O4OC 3STLB 3LAFA 3DNKA 4XMKL 3QIBC 3BPLB 1LP9A 3BZFA 3VG0H 2CRYA 3WCYA 4BQ9A 3EYUH 1CCZA 2XICA 4FG6D 1NMBH 3QCTL 4FN0A 3ZT6A 3DMMB 2ZJSL 5KSAA 4OCSL 1MRFL 2SEBA 4XPBH 4K3HA 3OF6D 4Y1AD 3TBYB 1F3JB 4EUPA 1JNHA 2DS4A 3N1FC 2J8OA 1LEKA 3L7EA 3RL2B 3ARFB 3L7FA 3GJFA 2AQ2A 1FL5B 5DURB 4XNQA 3AMKA 1DVFB 1FFPB 1IKNA 5M94B 5C6WH 1D6EA 4HFWB 2YEZA 1ZEAL 1EVUA 4YDKH 3QULA 2ATPB 4WWKB 4RBPK 4F7CA 5EC2B 3QO1A 5JW3H 1A9EA 3BWAB 1R3KB 1OWRM 3LKNB 3TIDA 2MFNA 4PRNB 1J1PL 3K4DA 4Y5VC 2GI7A 2EIZA 1OW0A 3SY0B 1EA9C 5IB4B 3MV8D 1QVOB 1KLGA 1QBMH 1FC2D 5IGXL 1NL0L 1ZT4B 2IG2L 4KTDL 2VLJA 3DX9B 2XQYG 1P4BL 4ZOBA 3RVVC 1FFOB 1J0JA 4LDOB 5BV7L 4QTHA 1ZHKB 4HZAA 3MRLB 1A7RH 5INCB 1KTRL 3EIFA 3A0OA 3D0LA 1BIIA 4WFED 2XZQH 5EBGA 3RVVD 3WNOA 4OI8A 1ADQL 1NGZA 5JA8B 4KROC 4OGXL 1KTKE 2O61B 1VACB 1KUMA 1EIBA 1MREL 3IFNL 3MV11 5I76A 1V7NL 3UZQA 3JTSA 1B6UA 5TQ2H 4FZ8H 4ZFOB 2JCCB 4PJ7F 5IIEB 4PLKD 1LD9B 2VDRH 3ULUL 3WIIL 1KFAH 3BOVA 4Z0XB 5ISZB 2CGRH 2P46B 4MNQB 3T0XA 5IT2L 3L5WB 2FIKB 3Q6GH 3HZYA 4MNGA 1SM3H 5IJKA 5DUPL 1MFDL 3JTSB 4ZUTB 3OQ3B 2AXFB 3O81A 3ARDC 2VZVA 2PYEA 1U3HD 4EIGB 1AHWB 3ZLQC 1R0AH 3ULUF 4P2RE 2ADIA 3DX7B 4Q9BA 2YRPA 1GJIA 4WEUD 5ESVB 4FOMA 4KDTA 2EDXA 3L7FB 3DJ9A 1OLZA 3HNSL 3UPCA 4L29B 5K9OB 4G7YL 3VRLE 3DX8A 3EO9L 3CXDL 5DA4A 3HPJB 1INDL 4XPGH 3VWJC 1CDCA 3K81A 3LS4H 1F6AB 4PJIA 2DMKA 1J8HD 2Z8SA 2ADIB 3VI4F 5JW5A 3ZKNC 4N0YL 1YEIH 4WFGD 2EE2A 4LLMB 4JG0H 2OXHA 2PR4L 3LQZA 3FO0L 3CFDA 5DLML 1WTGT 4PJ8C 5J6HB 3LKQB 4AT6B 1WVZA 3MRQB 5L7XH 3V0AC 3FB8A 4GBXA 1G7HB 1XGQB 1YEJL 3CUPB 2CXKA 4XCYB 2CIIA 4M7JH 2BFVL 1PFCA 4PJ8B 2AXHA 3NFSH 3KPNB 4CJ0A 5IF0A 1ZHKA 5F7EH 1GYAA 3LKSB 1XGRB 1JRHL 2PW2B 1RULL 1CWVA 3I02B 3O3DB 2DQIH 4J6RL 3L3IA 3C8KA 1H3XA 4R6UA 3MLTA 4JKWA 4N8VA 4ZFOA 3LIZH 2ZPKL 1U3HA 2HT4D 2V5MA 3BAEL 5D5ME 4IRSC 5T1KB 3L3KB 3TCLB 1CFQA 1HSBB 4JZOA 2YD6A 1BQHG 3KYNB 4QF1B 2CO7B 3SKOA 1QBML 2P5WD 4F7EA 4G6MH 1QSEE 2F54B 3DSFL 3UBXA 1CDHA 3KS0H 1J87A 1PG7H 2Q3AA 4FQCH 9CGTA 1F3JA 2LV4A 3SO3B 3X17A 1E27A 4EIZC 2XKNB 3JWDL 2ESVA 5D2LB 3BPCA 5CJOH 4ZPTA 3C2AH 1X4ZA 2XA3A 1MREH 1T2XA 1Y6MR 3GMRA 3PP4L 5C0AE 4QGYA 4Z5RA 3HC3L 3HE7D 3QO1B 4RX4A 4PR5B 3T8XA 4LLYA 3KJ4B 4OLXL 5AD0B 35C8L 1CE6B 2IF7A 4FA8A 1LO4L 3OKEB 2MQ0A 3KG5A 4TNWK 4WI8A 3K1KC 3STLA 1IE5A 3I6GB 5JXED 4Y4HD 3FAXA 1YNLL 1JPSH 5K59F 1GC1H 1T1WA 4XPHH 2XXMB 4QRUB 4TRPH 3KYOA 4JY4A 2G60L 4KKCD 3LV3B 4U6XB 4BH7B 4EI6B 4YAQA 1U2HA 4RDQF 1KJ2B 4G6JH 4ETYA 1XF2A 4PJHF 3RWFB 2DKMA 4HUMB 4DGIL 3EYVB 5J9PB 3ULVC 3PIQB 1NMAH 3GNMH 1G9NH 3FQRA 1ERNA 4NO2B 5D2NC 4I5BA 2JELL 4OUUB 5DC0A 2V7NA 1X44A 3O45A 1QFWI 2HH0L 4MMZC 6FABH 1UKQA 2HRLA 1NDGA 2VXSL 3EOTH 3I84A 4MXWH 5K9QI 4HS6B 3U0PA 2FJFA 1GGIL 2V2TB 5I8OH 1BFVH 3FRPA 2CMRH 5CJ5A 4Z7QE 1WWCA 4NKOA 4IIQC 3V5HB 4LCCA 3HMWH 4X8XA 1NGXB 2GCYA 1CFSB 3REVA 3TO4A 5FGCB 5AYUL 1S3KL 1WK0A 3MGTB 4OZFA 4JO3L 5CEYA 1GGBL 1T6WA 1IKFH 3BH8A 3MRRA 4FZEL 4HIEA 4X7FC 2FO1A 2YPLA 5DMGD 2O61A 3WL9A 3L9RB 4JDZA 5JW4M 1I3GH 1P4LB 4YC2C 2OCFD 1IGCH 3NPSC 3S3SA 4G8GA 3VGDA 2ED8A 3AY4C 5D1QB 4PRPB 5LWYH 5GSRB 2DOCA 1LMKA 5DEZA 1HINL 3DX6B 1T4KB 2FZ3A 2Y9RT 4XTRC 2H1PL 1MVUB 1U3YA 2ZCKL 1U8MB 3P0GB 3HE6A 3FB6A 2BCKB 2BZDA 4GMSL 4NFDA 2B1HL 3RL1A 3WN5C 4MNHB 4IDJH 4AMKH 3MXWH 5E8EB 1XZ0B 2XZCL 4NQSA 4H26B 3NCJH 1JZ8A 2ZG1A 1CK0L 1KB9J 1SY6H 4KI5F 5HI4C 5CEZE 1G84A 3JV5A 4R7DA 3U9PH 5ENWB 3TO4D 2QL1A 3VXPA 4Z76B 3LKPA 3S8WA 4P23D 1JVKA 2EDYA 4LHUD 1X5IA 2W38A 4M1GL 5JIKA 1U8QB 4LCWA 3RGHA 5J56B 3T4AB 1NCBH 2HTLD 3PWJA 3PDOA 1TVHA 4J3SA 2X1OA 3BP4B 1S9YA 4YXLH 5D93B 4U1MA 1FYTA 4X7TB 4UDUB 1OTSC 4HFWA 2EDJA 5KW9L 4P23B 1U8LA 4L8DA 1N0LA 1DQMH 1U42A 1XF3A 3TO4B 3I9GL 5DK3A 1U95A 4Q9CA 1IFHH 5E8OB 3O9WA 3EJYC 1ZLSH 3FTGB 3O6FA 1NFDB 3VFPB 4EXKA 2JKXA 3C5SB 2XN9A 3U36A 5E9DA 1RAMA 2HMIC 1Y0LB 4X6DE 4Z7NE 3CZFA 1P6FA 1X5HA 3O4LD 4G8GB 1YMMA 4I77H 1T1XA 1BBDH 2H2SC 2WWKO 4PRPA 2AQ1A 1AD0A 1BEYL 1FQ9C 5C07D 5CWSB 2IGFL 2FCBA 4B5EA 1AI1L 3PP3H 2AJXH 3TVMD 2NY5C 5C07A 2BSRB 5JZ7C 4MA1C 1HOCA 2WUCL 4TTDC 4UTBH 5E8PA 4KV5F 1H3UA 4LLWA 5DSCB 5HHPB 3TIEA 1IC7H 4LRIA 4LEXH 3S5LA 3VMOA 4IMLA 1P4IH 1ZA3B 4OV5B 2GT9A 1WISA 4PJBB 4GRMB 3HRPA 4MDIB 4BSWB 1RULH 5KOMC 2UY6A 4LMQI 1JF6A 1PX4A 4XNYL 3LIZL 5IMLA 4MNGB 4WHTB 5F7MC 1IGCL 1KPUA 1BFOB 1MCFA 4PJ9A 3O2VL 5E94B 1JP5A 2B5IB 4TUOB 2YEZB 2J8UF 1P84J 4PLJC 1EFQA 1X5ZA 2CLRB 3DXAB 1QFWM 1KNOA 5AZ2H 1UM5L 2OTUB 3UX9B 5CEZH 4PRIE 3FCTA 1AHWA 4H88L 4R26L 1HZHH 3DUUA 3EAKA 2LU3A 4FQHB 3C09C 3IFPB 4NZUL 3SKJL 4A2LA 4NKOB 4X7DC 1CD9B 5EWIH 5JHDE 4YDLB 5IFJB 4PJIE 3CFCL 1YDPB 3JTTA 4XAWH 1OAKH 4MJIB 3O6FC 4G6JL 1ND0B 3PL6A 1S7WA 3NIFF 4PY8I 4P5KA 3LKRB 3O8XA 3PGCB 4MD0B 3EFFB 4M8QB 4G3YH 5FIEA 4XNZC 4C55A 2A2QT 3O6FB 2VUYA 1P4LA 5L2KE 1QSZA 2X6MA 3OKNA 3QDJD 2JIXB 2YPVH 1SEQL 5IKCA 2EDEA 4RWHA 5LBSL 3O3BA 3OB8A 3ZE1F 3P9MA 4XVSH 2KKQA 5C8JB 3PGCA 2OXGA 4OF7A 3K74B 3VMPA 3CDYA 2VZ1A 4MLSA 1QP1A 1ZSDA 3EOAA 1NCCL 3D3VE 5IW3A 2GJ6B 3QA3B 4LF3A 3ZE2E 3REVB 3VDCA 2DQFA 4XPFL 2CKBA 3QISA 1WBXA 3NA9L 1BM3L 1FGNL 2IBZY 1ZA3A 4PGEA 2R8SH 1DANU 5I1CL 1CFTB 1OPGH 5FM8A 5B38A 1MFAL 2VLKD 4QRSA 2P48B 2YD9A 2AJYL 2OQJA 3DX7A 1AP2B 3CSYA 4XTRD 4YZFE 3CSGA 3RVTC 1JV5A 1MLBB 2YUWA 3D6GA 1HHGA 2CKBB 5I75B 4WRLA 4PB9H 3ZT7A 4E5XA 4EDXA 1AGCB 3LEXB 3MFGB 1AQDB 1YYLL 3JUYA 3V8OA 2FJHB 2P24A 2P5ED 5EOTB 2HG5A 1EEUA 4HDIB 3BPCB 2XWBB 5E2WH 5MEQA 4HWEL 2HKFH 4JEGB 4ORGA 1G0DA 5L2KB 4MAYB 5FCUL 4XH2A 1FNSH 1Q38A 5IFJA 3VXME 5E2UL 4KUCD 1O7SA 5DD3L 5KSBE 2YPKB 1SYVA 4FG6C 2R2EB 2YUXA 4U0RB 4R4BA 4Y1AE 4F2MA 2VR5A 3ESUF 4M6NH 2CIKB 4KJPD 1T0NB 3QEGH 3RWIB 5IQ9A 4G6AD 2R1XA 4R97C 4LDEB 4OBSA 5C0AD 4J3TA 4XNXH 3CZFB 5L88H 5HHMB 1UJTA 4D9RE 3VXPB 1TZHB 4X5WB 4OLEA 5I1LB 2OX5A 3HLAB 1WICA 3VGEA 2XY2A 3NFNB 1KIPA 5E0QA 1OM3L 4ONOA 1D3CA 5DHVB 2O5ZH 4F37K 5KS9E 5FDWA 3X13B 2CIKA 2AJZB 4JG1H 4NZUH 5GS2H 5IVXF 2A1WH 3PWVA 2P8LA 1FSKC 1A8JH 2EH7H 4R4FH 4RIRA 3U0TB 3MV8E 4OM0L 3BZEB 4J12A 4YK4C 3CXHJ 5LKNA 1ZKAA 2OL3H 4HCRA 1DQDH 1TVDA 2VLRD 2NR6C 3R06A 4KC3B 4RBPH 4Y2DB 5E2TL 4XCEB 1KN4H 1S9XB 2XQYK 5HHNB 2HKHL 4GUPA 5JW4R 3QHFL 4OAWB 3LZFL 2Z31C 5GHWL 3B3IB 5FGBC 5IB5B 3C6SA 2X4OB 1A7QL 1PLGL 4XBGB 3GEWB 4JFHD 2MOVA 4MJ5A 3SGDH 4Y2DA 1AKJB 7FABL 1AXSA 3HZKB 3U9UA 1MFCL 1ADQH 4J3VA 4KK9C 4GLRI 1X5LA 5D5MB 1U8IB 1BQHA 4NWUL 3MV9B 5HPMA 1WWAX 4HUNB 5ESAB 1VPOH 4HH9B 3ZHDA 1FG2A 1FGNH 3RIFK 4OT1H 3U30C 5I18H 3BD5A 1BWMA 3ULSA 5T3ZE 1GXEA 4J8RA 1JF5A 4OI7A 1G7JA 1T4KA 1AGEB 5J4MA 4NUGH 3CX5K 5AAMA 3KWWA 1KIQB 4I77L 1YMME 4GW4B 5EA0L 4NO0A 5HYSG 4WI6A 4WDIA 1CQKA 5C0FB 3ULUD 1KTLB 5F1IB 2ORBH 1PG7W 2ZG3A 1XH3A 5HHMD 4JM2C 2Q7YB 1T0PB 3MRGB 3NFNA 5GS2D 5GQBA 3LQMA 1YJDH 3IDMA 1FH5L 1CF8L 5E70A 2Z31A 4JKMA 3X12A 2P45B 3T3ME 3PWUB 4HV8B 2BNRB 3QXTA 5FA4B 1WF5A 4CVWA 2EXWC 3HZVB 4LSUL 4WU5A 3FONB 2IEPA 1BBJA 4YHKL 4P4KB 1FDLL 3ZZ1A 3DMMA 1F4XL 5KSAB 3HNTH 1A7NL 2IANB 2X89D 4FS0A 5EZLB 4DKEH 2ZCLH 1TZIA 5JOPE 3GI8L 1GZQB 1ORSA 1Q0YL 4GAGL 1BF8A 3BP7A 2FATL 5FUOH 3GSQB 3MNWA 1QA9A 1ZAGA 2GJZB 3L3HB 4L9DA 2QQKL 2XTJC 4AL8L 2VE6B 1XCTA 4UILH 1B0GA 1IAKA 3S97C 1W72A 5L8JB 1S7SA 2DQGH 3HG1A 1TZIB 1ONQA 2BXZA 4R90L 4X6BA 4O4YL 5JHDB 2FYYA 3H8NA 1G9NC 4OCRL 3WJLC 4ODHL 1MH5B 2QKIA 1CGYA 1HI6A 3D3VB 2Q7NA 2AJVH 3SDAB 1OAQL 4R8WH 2O5XL 2CKBL 2VMFA 5EFIB 1K3IA 1MCOL 4ZQKA 1C5CH 4MNGE 3WFBH 4PJ5E 1U36A 4P5MB 4NO3A 3D0LB 4HUXB 4IRJB 4Z18A 1ZV5A 1NSNL 4PJBE 3KJ6L 3MYJB 4Z76A 5EUOF 4HIJB 4C56B 1VKXA 3UROR 4NQEE 3W9DA 3FB5B 5B3NA 5EZOL 1CT8B 1E4KC 4F33B 1MHEA 1A9BA 3NA9H 1F2XK 3MA9L 1R3IH 4JKKA 3KYMA 3KYAA 4IDLA 5CSZB 4R96A 1A4KB 5A2KH 3HN3A 3HC4H 3MREA 2VDML 2XWTB 3RU8L 5DA0B 1ZWIA 2R2EA 5E95B 5DHXB 2OTUA 2PW1B 3HG1D 3RWHB 1NMCB 1WSST 4NKIL 5HYSA 1JGVL 1KCRH 4MHHG 2JJUA 5I9QB 4OFKA 4QHMB 5MEPB 3MJ7A 4IJ3C 5FKAB 4OD3L 5CSZA 1M1SA 1T1WB 3B3IA 4NP4L 3U36B 3FFCD 1JFQH 5FYKU 1O5DT 1MJ7L 3CFKA 5MI0C 4X6EA 5E1AB 4U1KA 1HXMB 4X6CE 2BVEA 3UJIL 5D9SB 1S7TB 5E5MA 3VG9C 4Y5YA 3K8MA 3UC0L 4JQXC 4AEFA 4P4RB 2XNAA 4NC1C 4BK4A 1JRHH 5C92A 5TJWK 3JWDH 4B7IA 2DQIL 2BVYA 2ZUTA 5JIPA 4Q9QH 6FABL 1I8IA 4POUB 4ZO9A 5F7YC 3EOTL 1K6QL 2GSGB 5F3BB 2I5YL 3SCMC 4ZUUA 4YR6B 3LMJL 1AXTL 2V2XA 2AXFA 5E2TH 1IL1A 1NCTA 3EYOA 4J1UA 2W9EH 4OLXH 2W9DL 1DL7L 2KL6A 3TVMB 1IGJA 4Z6AT 3D69A 1OCWH 1JL8A 4AEHL 3DO7A 1I9RL 4YPGA 4FQCL 2IQAB 1MHCB 3TNMA 1T3FB 3H0TA 1DTUA 4M03A 2JJWA 4PRHB 5INDA 2NY0B 4CADA 3HAEB 3VFTA 1I3GL 2ICWJ 4YBLB 3ARDA 3S34H 2VISB 4IJ3B 4ODHH 4G6FD 5C7XH 4R96B 4S10A 1IAIM 3C87A 3FONA 1SY6L 1MPAH 1KT2B 2AJVL 5FUOL 3QUZD 4K23L 1RHHA 4RGMB 3WSQL 3HC0A 1KN2L 5DK2A 4R3SB 1AGFA 4M7ZB 1K4CA 3C5SA 2X9YA 1J5OH 1D6VL 5GRZA 1Y6NR 1GOFA 1A7BA 4DGVL 2ADJA 1IAKB 3LHPL 3CFJB 3O3EA 3SDXA 1IC5H 5BW7A 1F90H 2H26A 1WFOA 4NRZB 4V1DD 3FKUS 3BSZH 4U1GB 5CD5D 3AAZA 4Y4KC 4JFDB 2DQTL 3MCLL 3I9GH 5T1KA 3QG6B 3QQ4B 2G2RA 3B8SA 1MH5A 1EPFA 3D85B 4NQEA 3NAAL 5F89B 3HNTL 3SCMD 3GO1L 3O9WC 4PJBA 4NKIH 5FM4A 1RUAH 4P2OB 5TF1L 2UWEA 1T04A 3QDAA 5F9JB 3IDYC 3MRHB 2IMMA 1UWGL 4PY7B 4G42A 4FQQB 2QQKH 3OJDB 3ARVA 3OMZA 3C60D 3TFKC 1P2CA 2X5PA 4WVRA 4PJFF 2P1YA 3DGGB 5TE4L 1B9ZA 3O4LE 5KZCB 4J3UA 4R7NB 2PKDA 1P1ZB 4GW1B 5TQ0H 3GSXA 1FCCA 3UZEA 3WS3A 2W65B 3T09A 1A1NA 4M7ZC 5ILTH 1BD2D 2PYFB 3GSVB 4CVXA 3VFTB 4IIQB 4RMWA 1QLRB 3VGAC 4OKVB 3MFFA 4UINH 4PS4H 1A6WL 4QKXB 4XVUD 3U6RA 4OZHF 2G9HB 4F7CB 3QRGH 1FNHA 4GQ9H 3W82A 4WTZG 3RKPA 5IVZA 2AK4B 3S37X 1D9KD 4FFWD 1L7IH 3T4AA 1S9VA 3L3GB 3LY6A 1NAMH 4CNIA 1KGCD 1W2KT 2JLLA 5D7IF 1PG7X 3RVXC 1QVOA 3PV7A 3MR9A 5SWSE 3RX8A 3H3BC 1EAPA 1IM9D 4WWKD 2J4WL 3DYMA 3WJJC 2O5YH 2VZSA 4F7TB 2R69L 3IXAA 3LH2L 4H20H 3STZA 5IESH 5JPMB 3RBGA 4CNIB 3O6KL 4FQXA 4HMEA 3VMNA 1UM6H 1I8IB 3CAFA 5DC4B 3QH3A 4XP1L 4LHUG 1MJ8L 3H3PH 3H2WA 1OD7A 2P49B 4P59H 2FEEI 3L5XL 2UWEB 3RIAK 4ZAKC 4H1LA 1PJ9A 4QHUA 2F5AH 5B4MD 1D5MA 3SOBH 2VLKB 3TBSA 5HHNA 1JF1B 4UB0L 5ICXB 5EN2A 5FUZH 5F1NB 5HDQL 4EDXB 3S3JA 4YBHA 1R5VB 4O58L 1MHPL 5DTFA 4UV4L 5F88B 4ZFGL 3IFNH 1A7OL 1QZ1A 4XPFH 3GB7B 3S37H 1YQVH 4Y16A 3ULUC 4Y88A 3OKEA 1NGPL 1KELH 3TJHD 1C7SA 2APVA 4NQVA 1NBYA 3TIDB 1QFUL 2DMCA 3MMEB 1KACB 2CD0A 3MXVH 4WGWB 1FO0L 2EDDA 5DHYB 3HI5H 5FB8B 4DCQB 3ZO0A 2EIEA 5D2NA 5C6PB 2Z35B 1F8TH 4DKFH 4Z7VA 5DI8B 3EFDL 3HMXH 3N85L 4NQCA 4JO2H 1SJHB 4F7PB 4JGJA 1NL0H 1YYLH 4P99A 4V2BA 4P3CL 5F7DA 1Q94A 2YMXL 5CGYC 1KIQA 2VLKE 2R1XB 5L7XL 3B83A 2A6DA 1F3RB 5DQ9B 3ZTJH 4KRPD 3OJ2C 1RMFH 1WAAE 3WFCL 1KF9B 3VGAB 1ES0B 4Q58C 1JZ7A 5C0CD 5I16B 2OP4L 3UAJD 1AE6L 1TETH 4IS6B 4QXTA 1ZHBA 4ZFOL 3E6FA 2WNGA 4XCYA 2G75B 5IB3A 1XGPA 5C0BB 1N6QL 4PJ8D 3L5HA 5IJVB 1LVEA 5ISZE 4XC3H 5DWUL 2MMXA 3FOLA 4TVSa 1VENA 4JFED 3IYLW 3PUCA 2COQA 1PY4A 4XNXL 3RHWF 4GRWE 1UWGH 3X14A 4LSRH 3CK0H 5B3JF 5A2JH 4HK0B 1CZ8L 4AYFA 3AXLB 4M8VA 4KXZH 1S9XA 4PB0H 1EERB 1EGJL 3N1MC 3EZJB 3PWPE 2DWDB 5KJRL 2ZCHL 4RGNB 3DGGA 4FFYL 5FF6A 4PRAA 4D9RD 3BIBX 3N0PB 4FTVE 4I9WD 4WHYH 4K2UH 4QWWC 3K0WA 4IRZH 3VFWB 3V7AE 4M1DL 5JW5B 4YHZL 4YQXL 5DVKA 5GGTL 4YHLH 2ZUVA 4OKVA 1QFPA 4IOIB 4Z77A 2Y4SA 4X4XB 5DQDH 3TIEB 3BYYA 1BZQK 4PG9A 2DTMH 3MUZ1 3QUXD 4YHMH 2CLVA 5GJTH 1G7HA 3GSOB 5DYOA 5EFIA 3P9LB 3JWDC 4NO0B 4PJ8A 2I60L 2OJZL 4BFEA 1FAIH 3QSKB 4ZO6A 3JV4B 4PJXB 2XIDA 2RHEA 2QR0B 4QY8B 4P3WA 4O58H 1SQ2N 3L3DA 5ITFB 3I02A 4PJBF 4TUOA 5TFSH 4A6YA 2FX9L 2IPUK 4L4TE 4OIBA 2XRAL 1OTTC 2UY7A 3T2NH 3VI3F 4L4JA 5JQ6L 1I1RA 1L6ZA 4OLYH 5IQ9B 1Z9SA 1L9MA 2QR0A 5FO7A 4PYHA 3QRGL 1JUFB 32C2A 1QEWA 1NFIA 1CFVL 3C6SB 4Y4KD 4NJ9L 5HI5C 4B0MM 4JANA 2IC2A 4QYOA 4CADB 1HH9B 4PGEB 4F9PC 1D5BA 5TDOA 1YEGH 1YC7A 5HHOD 2AP2A 1RJYB 3WXWL 1G7IA 1JPTH 2ESVB 2OM5A 5D2LA 5C0GA 5TQ0L 4W4OC 1BX2A 5I8KH 3MLVH 3FO1B 4LPXA 4HF5H 1S7UA 1QFUH 4OZHA 4PJEF 2EDBA 2EYSB 1BIHA 4HPYL 1NGYA 3LD8B 1MF2H 1MFBL 2MWCA 3ULSB 5E2JA 4PBXA 1JNHB 4FABH 4HHAB 2E9JA 4WUKH 1IM9B 1I7UA 4LGSB 1HOCB 3B9DA 5GGQH 5JR1L 5EUKB 1RFDL 5D2NB 3FQWA 4M48L 3F5WB 4PRIA 4NNXB 2DQFB 3EYSL 3QULB 5F1KC 5I1HH 1TZGL 5IMMA 3QWRD 3VD5A 4LPTA 2NTSP 2FHFA 3QG7L 4JFPB 4HIIA 5T33H 2AXGB 2JJSA 3GRWA 4YBQC 3TH3T 1PKQA 2A38A 4IRSD 2A9NH 4U05A 3OGCA 3P73A 1P9MA 4IRSB 4PBVC 3EDJA 4HJ0D 1XR9B 4MJ6B 5CILH 1HEZA 2XZCH 1SMAA 2AEIT 1XGPB 3MMEA 2HAZA 3TCLA 2OI9C 4YDIL 4UBDD 1NEZB 4PJCB 3RZWA 4NHUA 4DCQA 2CK0H 4GSDL 1IKNC 5CLWA 3BN3B 3PWVB 3BPNC 4ORGB 4YC2B 4UTAH 5KVFH 1JI2A 3QNXB 2ATPA 5FYKE 4P5KB 5I74B 3IAGC 2IAMA 5E8NB 4WJ5B 3KXFE 1U8QA 2IALB 2FR4B 2WV3A 4PTUB 2ED7A 3R06B 5EZOH 1FAKT 3VCLB 1Q9KB 2VXQL 4HXAL 1T2QL 4L5FL 5TFSL 5F71A 1NAKL 1U8JA 4PLJD 4J2XA 3W11C 1Q9OB 3D3VA 2YC1A 1T66C 2H26B 2VDMH 2VXSH 3EW3B 4JFDD 5C0BA 1XIWB 1DFBH 3MUGA 1MCOH 4CN6A 5EO1A 4P49A 1JZ3A 1KULA 3GI8H 5I1JL 4FP8H 4YHIA 2B2XH 2KUTA 4NP4H 2Z93A 5HVFB 1LD9A 1AI1H 4RZCA 3GIZH 3EOYG 4DTGH 5E6YA 3C5ZA 1HILA 4OF8A 4NQXA 5EU6D 2F15A 5IVXB 2D4FA 2VDPL 3QDHA 4MJ4A 4R90H 3BVNA 1KSRA 1T1ZB 2BSRA 1IEHA 5MENE 5EPMA 4AMKL 4P2RB 1MIEH 5EOQH 3FFCE 3LKQA 3MREB 2Y06H 3MLZH 1ZK9A 5IK3B 2E7MA 4JPWH 1RZJH 4XMLL 1X5YA 1U8HB 5TH2B 2KQNA 3QXVA 1NCWH 3JVGC 1I7ZB 1EMTH 3MSPA 4PRHD 1TPXB 1AXTH 4F7MB 1HINH 2NX5E 3FN9A 3FL7A 3LRSA 3Q1SH 3WFEL 4L29A 5K9OA 1NGXA 2X4NB 5HD8D 4YNYA 2BNRA 1ZT7A 5I1HL 3O3AB 3KPRE 4GT7A 2WQRA 3C6LD 3WXWH 5I8KL 4ODVL 4X7SH 1BZ7B 1YYMH 2Z91A 1ACYH 3FHQA 3MJ8A 3RWGB 2VITB 3D9AL 2IJ0C 4K2UL 3SKOB 3SKUD 3IETB 1PGRB 1UH3A 1QHPA 1JE6A 4KMTL 4HC1H 4G9FE 3B9KB 4OGYL 5IBLC 4Z7VF 1DLFH 4Y5YC 1SVZA 3QO0B 1KCUH 1LK3L 3M8OL 3EYOB 1ZLWK 3MGOA 1M4KA 2R9HD 2XKNA 3BZFB 4RSVA 3TESA 5FKAA 1GGCH 4NN6C 5D7IB 2R0ZL 5FA4A 3L3JB 4JZJB 5EOCH 4X6DA 5IMMB 4LAJH 4ZUTA 1ZHBB 4LLYB 3QIBA 4NJAL 3ZE2F 4PRHA 3RA7H 3ZDXE 1R3IL 5FO9B 3TN0C 1ED3A 1CFQB 1HSBA 1V7NH 4FQQA 1GZQA 4HQQL 5HYJB 4L1HA 3H42L 2FEDC 4P46C 5I19H 4HF5L 2NW2B 3P73B 4M43L 5DS8A 3UYOD 4FNLL 1IGFH 1NCUA 3BO8A 3W39B 2DWEB 5KSBB 4P5TB 3TZVA 1INDH 3K1DA 4JQVA 4YDIH 4RAUA 3MJGX 3MYJA 1E28B 5KSUB 3O6ML 3WS3B 2DQDH 5FXCH 2Q76A 4LARH 5DD1H 2EIDA 1FFRA 1RZ8A 4PGBA 5D1ZC 3PDOB 4PLNC 5GGRY 3LEYL 1U8IA 5ISZD 1AJ7H 3FZUC 2VKXA 5BZWB 1FYTB 1NC2A 2GK2A 5GGUB 3HFMH 4G8IA 4HXBL 4KK9D 1NFKA 5DJYA 2E7CA 4P2QA 5EU5A 3U4EB 1FFOA 3RGVC 1XGUA 2IBBA 3QJHB 5HVHC 1E6OH 1AGEA 4U1JA 5CIPH 2GHWB 4NQCB 5GJSL 3UTSB 3RY5A 1Z0MA 2R8SL 4YDKL 3PWPD 4ORZC 1UM4H 5JXEC 1V3MA 4KK6C 4X9BA 1Y0LA 3V6BR 2VDQL 3G5XB 4OCXH 4APQC 1F4YL 4JFEA 2YPLD 5D6DC 2A6KB 2JCCA 3ECBA 4ENED 4M6NL 1SYVB 3BD3A 5C2UB 3BAEH 1I1FA 1KFAL 1NC4A 3G08A 4P57A 4R4BB 4F2MB 3FO0H 1J7VR 4XP6H 1IT9H 4JVPA 1NLDL 4I5BB 4JDZB 3OJDA 4U2ZA 5KS9B 2R1WA 4R4ND 2VDLL 1D5IL 4JFXB 5EUOB 4PPTA 4A6YL 1BJ8A 5TDPB 3LHPH 4JN2A 1B88A 2GFBA 3O6LH 3QEQE 1CL7H 4MS8C 4AH2B 1D5MB 3MQIA 1BVLA 1K85A 4NQCD 2YD8A 3IDUA 3TVMA 3CXDH 4ZODA 3CSYB 2Y7QA 3KPQA 4MSWB 3HPJA 3QEGL 4P2QD 4NZRH 2XT1B 3L1OH 3V6OC 1SBSH 4ETQA 1QKZH 5DJ8A 1I7ZA 1RZJC 4MB4A 4Z7NF 4P3DA 5TDNA 3H3PL 1S7TA 5E5MB 1AY1H 1WGOA 5CBEA 1GOHA 1I8KA 2XNAB 1CD1B 4KKAD 8CGTA 3GI9L 3P4LA 5AG9A 4NO5A 4M1CD 2DI7A 1GRWA 1M7IA 3WIHA 1DANT 1MFCH 2NY3D 2PN5A 2Y5EA 3GJFH 3LKRA 4BH7A 4UV7H 3EO9H 1MAML 4YE4L 5HHOE 4MZ2A 1AXSB 3HZKA 1U8OB 3TBWA 3BE1H 3SGKA 2AJYH 4S1SH 3FO9B 4TQEL 3U6RB 4ELKB 2FGWH 4IS6A 2X4QA 3JV6A 5DD5L 5JORA 5SX4H 3T0DA 3DXAD 4HWBL 3H0TB 1U3JA 1Z9MA 3FQTB 4F37F 1A02N 4K55A 5LAXA 4KAQL 5CD3A 5HY9B 1CVRA 2BJMH 5EOCL 5HHOA 5J89A 3DVIA 3CLEH 5FFLA 2BSTB 5LVEA 2Y36L 1ACZA 3HNVL 3U82B 4K3DL 1R3JB 3RP1A 1QO3B 3C9NB 3ARYA 4Q2ZB 3QIWB 2XPGB 5JPMA 4QYOB 1C12B 2OQJB 1JK8B 3LDBB 4ZPTB 5HPOA 3PWJB 4ERSL 1QD0A 2DQUH 2DWDA 2DL2A 3GJFB 1F4YH 1V3KA 4R9HA 1QSEA 3TZVB 4GQ9L 4X6EB 2LFGA 3QAZC 5JUEL 2QQNL 4RISL 3QHTC 2GT9B 15C8L 2IANA 5HDBE 4UI2A 5EBLB 5E9DE 2FR4A 3RKDC 1IT9L 2GK0A 1ZLVH 4MLIA 2PXYD 2H1PH 3QUMB 1TENA 1FO0A 2YA0A 1ZTXH 3SJVD 5C0JB 4OLVL 2GSIA 1CFNA 1A14L 1V3LA 5IR1A 3RWCA 2E6JA 5TPWH 5C0CB 2V17L 1IQWH 2CLRA 3DXAA 4UT7L 4HCRL 5HHVH 4N8CL 4XHQA 2Y6SC 3ORJA 3O6KH 4KKBD 3GJEA 1FJ1A 3IFOB 2X4PA 3NCJL 1T7YA 4M43H 3MRLA 3OV6A 3FRPG 4XC3L 5DWUH 2RB8A 1EZVX 1PKQB 1KJ2L 4I8DA 2B1AH 4LHJB 1RUKH 4R8WL 1JHLL 3TLRA 3BISA 2D7OA 4MJIA 3GBLA 1U91A 2C7UA 5ENWA 3QUZA 3RNQA 1CGWA 1A3QA 4R7NA 2Y6SD 5IIEA 4KY1L 4FTVD 5F6HI 3TFKD 4ISVB 4Y89A 3BQUC 2F9BT 1ZGLP 2BP3A 4S1RH 1A3RL 4PJEE 3UJTH 2VDKH 5KS9A 4NT6A 4NO3B 4NJAH 3T0WA 5E8DL 4XNZB 2R56L 5DVNA 3DGCR 3W9EB 1H5BC 5EU5B 3KLHC 4GRLA 4U1MB 1NFIB 5DO2C 2AV7B 3RPIB 3QQ3B 3TWCH 1U0QA 4R3SA 2EC9T 3IKKA 3RDTC 2VLJD 2YA1A 4J3XA 3F8UB 5L0QC 3AS1A 1GPOH 3BZDA 3DBXB 2DQJL 1X5GA 5BS0B 4XWOC 1WITA 1U9KA 3ZDYF 2VLKA 4PJCF 2E5EA 3FFCB 5ACZA 3QRFM 4EUPH 5GSRA 5ELIA 1FLTX 3C2SA 3GMOA 1N7ML 3HI1B 5DUBB 3VXMA 3TV3L 3NCYP 1U8JB 1HYSD 4OD3H 3KS0J 3OWEA 1OAXH 4DN4H 5ETUB 5F9OL 2GKIA 3GSOA 5DYOB 4H0IA 1FNLA 4GG6F 1M6OB 1EH9A 3QUMA 3VRIB 1GGBH 4TTDD 4EN3A 3CIQA 1X5KA 4JKPL 3K80A 5CKGA 1EFXD 4EN3D 1AGCA 4MXQD 1F5WA 2F19H 4UOW0 3SDCD 4G8EB 1DEEB 5IVOA 3CUPA 3GJEB 5LWYL 5ESQB 3FO9A 3VXTB 3PGDA 1FHGA 5T5FL 4LSQL 4YGVB 2FDBP 3FAWA 4PJ7A 1P7HL 2V5RA 2QQNH 4GMTL 3GSNB 4I18B 4YBLC 4LQFL 4HAFA 1C5CL 4HUWB 1XH3B 3PWLB 2UUDH 3GSNH 3PNWB 4D94A 3CFIC 3D3VD