5HQJA

Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
289
structure length
289
Chain Sequence
MKDAKDISVAVIPKVAVPFFDDCNKGAKTAADKAGVKYQWVVPQNTQGSTQVQIIEDLISRHVDGIAISVNEPKSVESVMKRAEQSGIKVLTYDSDSPKSGRSMYIGTNNEQAGATMAETMGKALNGQGEVAIITGQLGAVNLNERIAGIKKGLAKYPGIKVVETQGTDDDLARGVSVVETTLRAHPNLKGIFGVSQVGGPAVAKVLNTREFGAMKGKLEVLAFDDLPDTLKGLKDGYIQGIMVQRPVTMGSLAVDHLVAQIQGQEGQPKDIDTGVTVVTKDNMTSYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title Crystal structure of ABC transporter Solute Binding Protein B1G1H7 from Burkholderia graminis C4D1M, target EFI-511179, in complex with D-arabinose
rcsb
source organism Burkholderia graminis c4d1m
molecule tags Solute-binding protein
total genus 101
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hqjA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hqjA01
1JBEA 2IPMA 4IF4A 3B2NA 4MRMB 4ZPJA 5IBQA 4N41A 3OM0A 3ROFA 3L49A 1GCAA 2GBPA 3LUGA 4YRZA 3LKVA 3SAJA 1FSPA 4EGSA 1JDPA 2AYXA 5KC8A 2OENG 1M2FA 5DKFA 1ZVVA 4G0QA 2FQWA 1NXSA 1P6UA 1ZN2A 3QK7A 4MLDA 1DRKA 1ZHHA 4JA2A 3BREA 3RVQA 1ZITA 1LJUA 1USKA 4EYGA 1P8AA 3FDFA 3RVSA 4MYRA 4YCSA 1ZGGA 3Q7TA 5C5EA 2HSGA 4PICA 1ZDMA 5FWXA 4P98A 4IRXA 4PYRA 5DLEA 1LBHA 2LIVA 2FSPA 1DRJA 5TQJA 4YLEA 5BQ3A 2QVGA 3CNBA 3C97A 3KHTA 3E3MA 6CHYA 1F4VA 2ZAYA 4Q6WA 1TJYA 3HUTA 3MIZA 4G97A 4W5TA 2AYZA 2XDYA 2MYUA 1KRWA 2LUOA 3H6GA 4FE4A 4TLLB 3DBIA 1UDRA 1YS6A 3QLVA 4F06A 5IEJA 3HXMA 1GLGA 2PMCA 1YIOA 5TPWB 3LUHA 3KSMA 2BGGA 4MS1B 3IDOA 1DBQA 3VNAA 4YV7A 5JNSA 1RXEA 4OATA 4UHJA 3H1GA 4H3KB 3C3MA 2JVJA 3DGFC 3OO1A 4OBBA 3A10A 3OQOA 2PUAA 2X7XA 4OG2A 3N8IA 3JY6A 2R4QA 3MA0A 3VNBA 4EVSA 1U8TA 3SM9A 4JASB 4XFKA 4PEVA 5CNJA 5KQGA 5T3YA 5PNTA 3GWGA 1NXWA 3UUGA 1QQAA 4KRFA 4DADA 1Z13A 3F6PA 5F64A 1J56A 2PUFA 2VUHB 1BAPA 2A9PA 2M1ZA 1ZH4A 1YMVA 2ID7A 2JVIA 5IX8A 3M9XA 1W9HA 3N75A 3IPAA 5BRAA 5IC5A 4MS4B 1Z2DA 3SQNA 1OXKB 4L85A 4HNSA 4NCAA 1Z16A 2GWRA 3O21A 3LTEA 1MB0A 1NATA 4P1ZA 5TE9A 4MQEB 4FB4A 2M98A 3KYIB 3QELA 4RK0A 3KCNA 4OTZA 1VKRA 1KGSA 1YS7A 4O5AA 1BDJA 1USIA 4Z9BA 1NTRA 2FMFA 3JPWA 4LRQA 1QO0A 1EWTA 4RKRA 1CEYA 1A04A 4UHKA 3T95A 2L17A 4MR9B 2I6FA 2GI4A 3GRCA 3LUKA 3KS9A 4DN6A 5ED4A 4CBVA 5IEBA 3SNKA 4IMIB 4KFCA 3CTPA 1RZRD 2NZVG 1EWKA 3O1HB 5FBHA 1WETA 3HO1A 3OQNA 1SXGA 2FMIA 1L5ZA 4WUTA 3IP7A 2L19A 4W5NA 1ABEA 1EHCA 3NBMA 5BR1A 4EVRA 1TLFA 5HKOA 1KRXA 4RY0A 1YK0A 2NT4A 3T6KA 4RY9A 2E4UA 1JF8A 3CU5A 3F6CA 2RJNA 4KV7A 1QMPA 4LE0A 4RDCA 2FKAA 3KLOA 3LUDA 3Q41A 4N47A 3DZDA 4KQ9A 4MGEA 3EODA 3GT7A 4FE7A 3QX9A 4HNQA 4XASA 1JFSA 2CHEA 2FW0A 2E4XA 4HNRA 4KPYA 3KKEA 2FQYA 5FWYA 5KWSA 2WB4A 3C3KA 1EFAA 3GA5A 3EDCA 3R0JA 2WJWA 3I45A 7ABPA 3I42A 1K66A 5KQMA 2JRLA 4MS3B 1XHEA 2WJAA 4N76A 4EY3A 5TQ2A 1PUXA 4RKQA 4XXHA 1LK0A 1XHFA 3O2SB 3OLWA 3N0RA 5KC9A 2YHBA 3QLVC 3KLNA 3HJFA 5KQPA 1USGA 4ZYLA 3MYYA 4LX8A 3RVPA 3P9YA 5TQ0A 2IYNA 1JYFA 2NUBA 4NICA 4MQFB 1D2AA 1NXVA 1U2QA 4F12A 2V0NA 2JBAA 1I3CA 1AB5A 4O1IA 1VRVA 4MR7A 3O2JA 1TMYA 3HCWA 2IPNA 4TN5A 3O1IC 3A0UA 4N03A 3HSYA 3JTEA 1FFWA 1QQBA 3NHMA 2LPMA 4W5OA 1B00A 2R25B 3IP6A 3QEMB 2CWDA 4W5QA 2FLWA 4TLMB 5EWJB 5HSGA 4EUKA 1OXBB 1DCMA 3N0WA 1Z12A 1GUDA 5EWLB 2A9QA 3QX8A 2VUIB 5IUNC 1C4WA 1F51E 3CRNA 4Z9AA 3MM4A 3GBVA 2PUBA 2NZUG 2FVYA 2PUDA 3K9CA 3CG0A 2IOYA 4O1HA 3CFYA 4WWHA 3GV0A 3SY8A 1JFTA 4MR8B 3G1WA 2E4VA 3F7NA 1NXTA 5EWMB 1DZ3A 3C6QA 4MPTA 1ZH2A 1YMUA 1P2FA 1CYEA 4KK3A 1JLKA 1MAVA 3H1FA 3ROTA 3QEKA 3W9SA 4OLBA 3FMVA 3H6HA 2GKGA 4TMYA 3MMNA 1PHRA 3HDVA 3TMYA 3HEBA 3RVLA 3M6MD 3N53A 4DQDA 4HYEA 1GUBA 3TX6A 2O20A 3QLUA 5JNTA 2FEWB 1C0EA 1NXOA 2FXIA 1DCFA 1JH9A 3CZ5A 3LFTA 1LBIA 1FQWA 4ZJPA 3O2QB 2P4UA 2H3HA 3GBPA 1GCGA 4WXMA 4H60A 4Z0NA 4YS6A 2JB9A 2MSKA 3OMXA 3I09A 3S99A 1PEYA 2KYRA 3CKMA 2FTKE 2FEKA 2PLNA 1MVOA 1Z25A 2YHAA 1M5UA 2PE5A 4OLAA 4KNYA 2A9RA 1FFGA 4GPAA 4MRMA 5KQLA 2VK2A 1A0OA 5HQJA 3DLBA 2QVCA 3KTOA 3N0XA 1S8NA 3KJXA 5DTEA 4RXUA 4E7OA 5E3JA 1YTUA 1ZGZA 1AB6A 2FMKA 3CG4A 4Z4IA 4G0MA 3EGCA 5TPZD 1HEYA 3O75A 3O74A 2WMYA 2CHFA 4KVFA 5FWXB 4RK5A 1W25A 4S05A 1M5TA 3H5OA 2QZJA 4LE2A 5D2CA 3TO5A 4EVQA 1RPJA 2L18A 2N9UA 4Z4GA 2H0AA 3BILA 1Z17A 1TVMA 2LP4Y 5HM6A 2QU7A 2IPLA 2QV0A 3RVKA 2PUGA 4JB2A 1E6LA 1RZRA 3LUJA 2HQOA 3RVRA 3HZHA 1ABFA 3Q9SA 1DC8A 3CZCA 3EULA 5BRJA 3FGZA 4Z99A 3H5TA 1U2PA 1EWVA 4LZLA 4H3HB 6ABPA 3FFWA 4RSMA 3RQIA 2E4WA 2HQBA 3EQ2A 2PKXA 3D02A 2OQRA 3D8UA 3MF4A 3OLYA 1Z18A 5DGCA 1PEAA 3SG0A 1DG9A 3OM1A 4G86A 1SRRA 4XLTA 4RK6A 1YK1A 4Z4EA 5I4CA 2MSLA 3OLXA 3BRQA 4G0PA 2F8TA 5GQSA 2QXYA 4LDZA 3RH0A 5TPWA 3DGEC 3OLZA 2FLKA 2QSJA 1BVHA 1PNTA 1LJLA 1NXXA 3HS3A 5CNKA 1ISSA 1FFSA 2JVKA 1U04A 3H75A 3JPYA 3NNDA 4JP1A 3LUFA 4LDAA 4RU1A 1EAYA 4Y9TA 1JL3A 1VPWA 3GYBA 5B3JC 1PNRA 4YWHA 3A3KA 4NV3A 4QICA 1ZESA 4YR7A 3Q7RA 5IULC 1QP0A 1SXHA 3RVJA 4N0PA 2FN8A 4MS4A 4RZSA 3QELB 1ZY2A 3JS5A 1P6QA 2IPAB 1A2OA 2L2QA 1IIBA 3M9WA 3Q7SA 5JNVA 3CHYA 2NT3A 3QLUC 1E2BA 1JX6A 3EQZA 1M2EA 5JS2A 8ABPA 1BA2A 4S04A 1E6MA 4MQEA 3HDGA 4QPJC 2FEPA 4WXEA 4RWEA 2A9OA 1SXIA 2RDMA 2FQXA 4XAQA 2IDMA 5FBKA 2E4ZA 1XWWA 2ZWMA 1VLZA 3LUAA 4XARA 4D6XA 1QP7A 4GNRA 5T7BA 3HM9A 4G0ZA 4EYKA 1R8JA 4E7PA 3G85A 4Z4FA 1D4ZA 2R47A 1DP4A 2WWVD 4Q6BA 3H5LA 3HVRA 2IKSA 2VYCA 1ZAYA 1H9CA 2QW1A 1JDNA 3NHZA 3BRSA 2CD7A 4MR9A 5B3JA 2MYNA 2PL1A 4MAAA 1DC7A 1URPA 3JVIA 5CNIA 3C3WA 4KREA 1DJMA 3K4HA 5JS1A 4KK4A 3UK0A 1QP4A 3LUCA 3L6UA 3JVDA 2FN9A 3EJWA 3RVMA 4F11A 4G0XA 2J48A 4NQRA 5GOTA 1BDHA 5KI6A 4IMJB 4RXMA 4ML3A 5FWYB 3HV2A 5CNMA 2DRIA 4WT7A 1ISRA 3TD9A 2MYPA 1Y1LA 2MSWA 4G0OA 4RXTA 1L5YA 3RVNA 1SD5A 5DCLA 1QKKA 3O1JC 2RJOA 3H5IA 2P9HA 4PZ0A 3OMWA 3FFXA 3KG2A 5TQ2B 1D5WA 1JYEA 4ZMSA 3H1EA 4KZKA 1RXIA 3RVOA 2HPHA 3H5WA 3UKJA 1BDIA 5TQ0B 4MS3A 4N0QA 4EYOA 4MLCA 3IP5A 1MB3A 2JBAB 3OO0A 4JOQA 3BBLA 1APBA 1TM2A 2PAFA 1JFVA 4QYMA 3F73A 4MR7B 4ZMRA 3KYJB 1Z2EA 3HUUA 2E4YA 2F8SA 2B4AA 4RK4A 2JK1A 4Z4HA 1JWLA 1NY5A 1U0SY 4W5RA 5TPZA 4IILA 3CS3A 4LE1A 4ETNA 1YVUA 1Z15A 4MQFA 2JCGA 3E61A 4RV5A 3A0RB 4G0YA 3LOPA 2WY2D 2QR3A 3TB6A 1D1PA 1MIHA 3GL9A 3OQMA 3LKBA 1QPZA 1QO0D 3I5AA 4PE5B 3IPCA 3IP9A 2MYTA 2PJUA 4Q7EA 3QEMA 2B1JA 4D74A 5EWJA 4WZZA 4QYWA 3FFTA 5C5CA 1NXPA 4YO7A 4Z4CA 5JNUA 1DBWA 4JB0A 4KMRA 5EWLA 4IGAA 4KQCA 2R48A 1E6KA 3ILHA 4M88A 1DBPA 3MQ4A 4F8JA 4RK7A 5IUKC 1Z26A 2ID9A 2PL9A 1K68A 4JAVC 4ETMA 1D1QA 4MR8A 4D6YA 1KMIY 2PUCA 3URMA 3T8YA 2PUEA 1CHNA 5EWMA 4B09A 2GX6A 5JNWA 3EAFA 3QLTA 4MS1A 9ABPA 3NNNA 3ILYA 1JHZA 1QNLA 4RK1A 3HK2A 2TMYA 4L4UA 2LBPA 3Q15C 5CHYA 4EYQA 3NNSA 3H5VA 1T34A 4RS3A 2RGYA 2FMHA 4ETIA 5ABPA 4F3TA 1DCKA 4RY8A 4YGXB 5IUJC 3DLHA 4NCBA 3N6VA 5JNRA 1RNLA 3T38A 2W42A 3CLKA 2HJ9A 2Q5CA 2WRZA 4YP9A 3LMKA 2HQRA 3OLVA
chains in the Genus database with same CATH superfamily
1SVOA 1ZI8A 1GNRA 2FCAA 2JIOA 5IBQA 5JC1A 2HRZA 4YRZA 3OJOA 1UPFA 4ZI7B 1RAEA 5A3RA 2FDCA 2GZMA 3BCSA 4EMUA 2DMRA 4RHFA 1JMYA 3RAJA 1A9YA 1LSJA 5I9LA 2CE2X 4DA9A 2O8EA 3FMFA 1LFDB 3EFEA 3D54D 3TLCA 1WVIA 3DW3X 3HO6A 4Y7DA 3FDFA 2GOYA 1A4XA 1H8HD 3ROPA 1L6IA 3W8EA 4LX0A 5DHTA 4YCSA 4HXGA 1XRLA 3EWIA 2VA8A 4GC5A 4G0VA 5HIJA 4DR2B 3FDIA 4W8GA 4UDNA 3PQ4A 1COWA 1UMDB 2FWAA 1EFLA 5CU7A 3AIIA 5JFGA 5BN1A 1FTSA 3T15A 5I7VA 4M7OA 5GAJA 1I3LA 4YAJA 3QEAZ 1NYTA 1KJNA 2P1RA 3QVXA 2B83A 4N0MA 2ZJAA 1P4GA 1ITZA 1FMLA 4FLFA 2HPZA 3VO8A 2C00A 3BZWA 1S9DA 3TQQA 2LUOA 3G79A 5TF4A 1UADA 3SXUA 1KMCA 3C7AA 3OZBA 3OX3A 2BFMA 5DSXA 2VVTA 5KQRA 3SDSA 2LCFA 5JNSA 5JPCA 2OHVA 4E5KA 4G1MB 2GVZC 3L92A 2BKXA 3TAHA 1Z37A 1JIIA 1FLVA 1GO2A 1ZUD1 1MEOA 5BMOA 4KPEC 4MGYR 1IPFA 3CRMA 4OYLA 4RDHA 4CKEB 4MYDA 1O54A 3OPYB 4LJYA 2X0EA 3PQDA 1QU3A 4CPDA 5LPNA 1FFYA 3L5OA 1V43A 2FW9A 1TRKA 2R65A 2XODA 2Z83A 4I2VA 3TBHA 4TS3A 3X1MA 3U3KA 3CX3A 3VPFA 3CY6A 5ALDA 4FVTA 1SA0A 3SC4A 1JU3A 4F3RA 2YVQA 3DO8A 4OBEA 4URVR 2FMUA 2WDZA 2XIQA 4LRTB 1CQIA 5CA1B 2YC2C 3X1YA 3R7AA 1DV1A 4QAQA 1K4YA 2GWRA 3EE6A 1W36B 3ZE8A 2DECA 2OESA 2WM9B 1PIWA 4L4SA 4C5AA 3A3NA 4NX2A 1SCDA 1VYUA 3Q8WA 5DT9A 3RTCA 4DLSA 1CIPA 5DRTA 2YWFA 5FPHA 3NV7A 1NN1A 2H6EA 1PJCA 2RI0A 2ECOA 2FK8A 4MA5A 4A23A 4F6RB 4ZYVA 4Y9DA 1U2GA 5DM4A 5G0TA 1P9LA 4X8MA 5B58C 4F6CA 2HWWA 3BICA 2D0OB 1E5VA 1KPHA 1SKYE 1VIVA 2FG6C 3RWOA 2JATA 3LJKA 1NJ6A 5JSHA 3H8WA 4BO3A 3EVCA 4M9SA 2OAEA 2ODTX 1M6WA 5D87A 1T1SA 3AH8A 4OUKX 3M3DA 3ZI4A 4AG5A 1UBGA 5KB3A 4KP7A 2XQFA 4WK0B 1RHMA 1SC3A 3WIEA 2FE1A 1H94A 3PFNA 3RYHB 1DT5A 2C1ZA 1EWKA 2M2IA 1A98A 5E0OA 1RQ7A 1J39A 2CVOA 2FDXA 3LQYA 2L19A 3KTDA 2BMJA 4IHQA 2EIHA 4TVOA 1QYXA 1OGIA 2A67A 4JLDA 3C2QA 4WGGA 4WTOA 5KNDD 1G8AA 1LK5A 1GA1A 1KRXA 3I73A 4QGGA 3SE0A 3I4FA 4G85A 1WL8A 4RWZA 3EYAA 3RRZA 4K9LA 3EMBA 3D4NA 3EXG2 3TR0A 1WB6A 5HKLA 2PKQO 5KU7A 2VPZA 2CCGA 2HCJB 3SYNA 4FE7A 3BJIC 3VAAA 3UOAB 2CHEA 3P4XA 1KI6A 2E1RA 3T5DA 4DIFA 2QTGA 4QTYA 3LIIA 2VDQB 1YJBA 2CCKA 3OCXA 4KGZA 5REQA 1BFDA 3T9DA 3T9EA 1E7MA 4DGQA 5CDTA 4PHTA 1TFRA 3T61A 2JG3A 1T5HX 4BZWA 4DLZA 7ABPA 4N7BA 4LXTA 5BYAA 2ZI3A 1CJMA 3W3AA 3KOOA 1VMEA 4E5PA 4MZDA 4B8WA 4C29A 4C3UA 2PR7A 5JDIC 4WJKB 2XKJE 4LBWA 1CF4A 3ZDRA 1U0RA 4LZOA 4K03A 1DWOA 4AKIA 1WIWA 2RCYA 1LLUA 2V7BA 3NTXA 4UPDA 4LX8A 2UYOA 4GUAA 1ZSNA 2IYNA 2O2DA 2R68A 4L72A 1UKAA 4NICA 2VG8A 5IYZB 1D2AA 6Q21A 4TT8A 5IKMA 2V0NA 2VP3A 1K06A 3Q72A 1BC5A 1IHOA 2Q8QA 1NUSA 3GUCA 4GLFA 2ENUA 3F71A 2IU0A 4F86A 3VX4A 3KLMX 1MEEA 1NRWA 1Q0QA 3MB8A 4BDTA 2HJHA 1V96A 2R6R1 3CUTA 3S2IA 5EE1A 1E9SA 3G0GA 2W2VA 2CMKA 3JTEA 2UZ1A 4JEHA 4B0OA 4AYWA 4CG1A 5JJIA 1B3BA 3WDLA 2FSFA 4C0LA 1XZQA 1DWQA 1GKUB 1XJ0A 1Y3CE 2OBXA 1LPMA 3E0XA 3IXQA 3I58A 1SOMA 5LU9A 4LDRA 5I5GA 1RD4A 7AT1A 1Y7LA 4XIFA 3KUKA 2QRJA 2XWBF 4RYLA 3SIPA 3SZLA 3WWPA 1Y0BA 3PGJA 4KE7A 3HI6A 2OO5A 2ONJA 4D2IA 1Y82A 2C9OA 1G4AE 2GN6A 3OQIB 2H9IA 4LSMA 2ZIWB 5IKPA 4GPBA 3G1WA 3HHPA 5G4LA 1FOEB 4G89A 5EWMB 3GRUA 2NUTB 1TVKB 5K0FA 4A26A 4HQ6A 4W4TA 5I51A 4IKEA 1C9JA 2FEAA 2FQQA 5G0UA 3BJRA 2C5BA 3NKVA 3V4SA 4NG5A 4N3AA 1BZYA 1K63A 4FFNA 4Z7JA 4JCOA 4HF7A 4M22A 3LVFO 4CCSA 4ZCTA 1OIVA 2ZJ8A 4JUBA 2CMFA 2ILVA 2J7PA 4OSEA 5JHHB 4BHTA 2XE4A 3GNTA 3M82A 1C0EA 2C7RA 3C8ZA 3AP1A 1GP2A 4FS3A 3L02A 3UMBA 4DCCA 3LFTA 1DLIA 2NACA 4FFLA 1KH1A 4J43A 4M8NE 4Z3OA 1GCGA 3JVVA 5H9WA 4U7GA 2Y6VA 3Q40A 1JI0A 3MLAA 1UBOS 2IXFA 4Z3DA 5I3CA 4LDNA 4PM4A 3KD2A 4KN5A 1GXSB 2I71A 2D8MA 2WSMA 1G98A 1L7RA 2CXRA 8ATCA 5JQGB 2GD2A 3OE1A 1PD1A 3KPWA 3QE3A 4QO7A 2HA0A 5EFZA 4MV9A 4LYJA 5CVEA 4QNMA 4D97A 4JLOA 1GDHA 3DEYX 3M4XA 1LVGA 1Y98A 4NI5A 5AM1A 1HY3A 2DBZA 3KV3O 3IBSA 4ID3A 4DR6B 1UXKA 2ZU0C 3JD0A 4N5DA 2PBZA 4NAHA 2REQA 2VHJA 3DWGA 4DJDC 5CG1A 2NO0A 4UUNA 1TKAA 3G8YA 5U4XA 3UT6A 4G0MA 1FPMA 1JPNA 3EGCA 4QUJA 1A8QA 1P31A 1MOQA 4IDCA 1KAHA 3SZRA 3GJ8A 2O7SA 2JJQA 4B3SB 4A36A 3KFXA 3WJ7A 1WMSA 1KQOA 4HLQB 1SIOA 2OO7A 1XEFA 4KDEA 2JHAA 2W70A 4F4JA 2WZCA 1ML4A 3K9LA 4HEQA 2OYCA 3BFVA 3AJ8A 3JAMA 4E14A 2G0AA 3GD5A 2PDAA 2C2GA 3H8VA 1JB9A 3VC2A 4Q9AA 3ZOKA 5LDDC 1NNUA 4UQOA 3ZWNA 3BB3A 4JQSA 4RMGA 3PDJA 2Z4SA 3GEMA 2VATA 2PNJA 2FHPA 4B3GA 2I2FA 3I37X 1NVTA 4RTOA 3ZGOA 1M74A 4H3HB 2DJ5A 3P0HA 1NUQA 3HR7A 2G5TA 3IDQA 2GD6A 4HH1A 4UFPA 4ZZIA 4NJOA 5LQRA 1NUHA 1V3QE 1DWUA 4J90A 1SY7A 2X5OA 4WFJA 3PEVA 2Z57A 3AVQA 5ALIA 3R5KA 3KQUA 2JLSA 3D8UA 1H2XA 5DT2A 3UB2A 3NPAA 3ITEA 3IVXA 5L3RA 3K53A 2YXLA 2XDQB 3GRPA 1K7FB 4FNAA 1Y81A 2X4DA 1IHUA 5CCEA 2HHJA 3IVMA 5AXDA 4B4UA 2P6RA 1HTBA 4UTXA 2W9XA 4HI0E 4PZLA 3JAWB 1Z28A 5B30A 2B7BA 3K5HA 1GUZA 3WYGA 2HF7A 4G0PA 4YMSA 1R5JA 4MCJA 2LGJA 1BW9B 1WLSA 1YMQA 1ZHFA 1Y1PA 1KEUA 4WFKA 4MW0A 1M0TA 5KVVA 1QCCA 4UC0A 3RROA 2NGRA 2VJNA 2J9FB 2X9GA 4GVXA 2WF5A 3H3JA 1ORIA 2EF1A 1RWBA 2M6KA 3RD5A 5AK4A 1X1TA 1JDVA 4H1UA 3AHCA 4HGOA 4MWSA 2D0DA 3V8MA 1ZZEA 1YIAA 2IWRA 4LJRA 4IO1A 3AF4A 3IKVA 4C7MA 1J25A 1HE5A 4K6KA 4O2RA 4FI3C 5DK6A 2QMZA 5AXAA 1P0FA 3OQ6A 4RF2A 5DW0A 3KQHA 4JVMA 4QREA 4B4OA 2FUKA 4C04A 4CF4A 2WBLC 2ZRNA 1SXHA 4R31A 1MORA 3ADCA 2DC1A 4MAMA 3QTBA 4WBXC 4DQVA 1FE8A 4KR3A 3DCJA 1G9SA 3AOEA 3MWFA 3DDNA 2ORED 2WUDA 1EGAA 1WABA 2HA6A 3JASA 1JW9B 5KTKA 3F6SA 4IIDA 4JLJA 4WK2B 1BCSB 2ZUVA 3FDZB 3FPBA 1Z0KA 4KIUA 4OP3A 5FNVB 1N9GA 4JLBA 1LGYA 2AWNA 2JAOA 3GH3A 3WGYA 3RC3A 4ZQCB 1A8PA 3EY4A 2QY9A 5T7BA 4BKOA 4CCAA 2QN1A 4UOQA 2HI0A 3KYBA 1OCEA 5IVHA 4LF9B 1S5PA 4Z4FA 1AU9A 1D4ZA 4JJ8A 5I01A 4TMKA 4XYGA 1SD2A 2C1EA 1DHRA 1DP4A 1LPBB 2EARA 3RKUA 3U17A 4DLNA 5L53A 2EIXA 2HDOA 2Y1DA 1JKFA 1Q5PA 2WE7A 1X8LA 3GUZA 3R3XA 1WNTA 3IP8A 4A7PA 1XXHB 2R3SA 2I1QA 3HO8A 2HCTA 5GINE 1EZZA 3BIFA 4X20B 1QP4A 1UJ6A 1HQCA 1K8QA 3D64A 3BSSA 3EJWA 1PNOA 2A0FA 4UBIA 1YJCA 2JCYA 3CINA 1UBMS 4OV6B 2JAWA 4KFTA 5FXMA 3A58B 4RIFA 2G5GX 4XVCA 2GBLC 1FCJA 3CH5A 4RL4A 4FB5A 3I0ZA 3GW8A 5E6RA 4PX9A 1QPGA 1CTQA 4IOJA 3B5EA 5HK8A 1JSRA 3EDMA 2JFXA 2GAAA 3IQWA 4QBFA 3ZHXA 3GJQA 3OIFA 1TK3A 2C61A 3B9BA 1SG0A 2EG9A 1IHYA 4F04A 3T4PA 4JELA 5IDWA 2R9VA 4JJ6A 4PZ0A 4PFJA 4FT2A 3L82B 4BN4A 4MEBA 1M2JA 4GKJB 3KVNA 3WK9A 2GCPA 3WL8A 1T0IA 2B8WA 3OJEA 3WB9A 4EG7A 5AJUA 3OG9A 1E1QD 2D1QA 3R74A 2H4WA 2NU9B 2DQ4A 1GQ2A 3DR3A 1V26A 3UPTA 2ZZKA 3L41A 4KQXA 5JXHA 4ZI2A 1E89A 2Q29A 2Z3VA 3KR1A 4EENA 4YMTA 3KKNA 1X13A 1F5NA 3LLSA 4GOMD 4B3JA 2LD4A 3OC0A 4PNEA 2QPAA 4B34A 4LQ4A 4ZCQA 1LW7A 2D6FA 1U3WA 1Y8RA 2M6RA 4PYOA 2PANA 3R2JA 3SF8A 5JSUA 4BNJA 4RIEA 1YGYA 3P96A 4ALLA 1D1SA 4NJEB 3ZHVA 2HQ1A 1WJGA 2DJIA 1D2GA 5BYJA 5A5VA 2F4VB 4FW8A 2H4JA 1E79D 3BTOA 4R9SA 3FPGA 1XU7A 1E98A 4MZXA 4BMCA 5FKJA 3AETB 4B7UA 5GMOA 4Q24A 3EVFA 4HYTA 3RO7A 1VE5A 1ZUNA 4AVYA 4D4MA 4ZEMA 2I1WA 3NXKA 1LQTA 1AQUA 1IOZA 4HUQA 2ZQYA 1RJEA 2VDJA 3IJ5A 4I9NA 1JLHA 2ZR0A 2J30A 3ESAA 1I6MA 3TW0A 4XWAA 2C5LA 4CT5A 1G18A 3BGVA 1QLHA 1DVRA 1XN1A 4HB3A 3FCAA 3UAOA 5C4IA 4KRGA 2IZOA 3UJ8A 4GZ6A 1ENZA 1DE0A 2ID9A 5JY6A 2JFZA 2PZKA 4ZT2A 1WD7A 4TS9A 1Q0UA 4HLUA 4PAWA 2J5KA 3IT2A 1JKIA 5K01A 3U4HA 2RHLA 3B78A 1Y3HA 1M34A 3GLSA 1T4CB 3QLTA 2YDYA 5JRJA 2VSYA 3NW9A 3GFVA 4IINA 2CFSA 2FRVA 3O4HA 4W6ZA 1PUJA 2TMYA 1L9KA 2QV7A 3LFUA 4HX2A 4N9WA 4EYQA 4G5YA 1FSFA 4KO4S 1OLXB 2WYIA 4RIHA 5K1ZA 3SJZA 2Q9CA 3TOVA 5LZ2A 1PT5A 1ZGAA 1CS0A 3AHFA 1SK8A 2DX7A 2P6NA 3E53A 3HWX1 4Q9IA 2NNWB 3O9VA 5F5XA 3SPXA 3T5BA 3T38A 3TXYA 3CO5A 1USWA 3CLKA 4WPGA 2HJ9A 1R4ZA 4XQGA 3OIYA 1WMBA 2DFVA 4YQEA 5CM9C 3GEDA 5LYJF 1RRPA 2FK7A 4ROTA 4TWAA 3QW4B 4OIMA 4EUFA 4DR3B 3FA2A 5DI3B 1IPEA 3T99A 3TLKA 2I2BA 1GCAA 2X0IA 4N3NA 4QUBA 2O57A 1G9XA 2E3JA 3H9BA 2FPSA 2KS6A 3S40A 4G5GA 2JLVA 5IVDA 1JDPA 1XJCA 1Y3DE 3LE8A 2AYXA 4PHGA 4BU1A 1UBHS 2VTBB 1P1JA 3HP4A 2WUWE 3PDCA 4LXIA 3KUUA 2HYIC 3QMPA 4JITA 4P7BA 1TTQB 3COSA 1NJ1A 2XUGA 4G0QA 4LRXA 4HX5A 4TM7A 1E4OA 2P9EA 1G2QA 4NEHB 5DOZA 1QO7A 2AL7A 3RJZA 4E6EA 4WKPA 5F7JA 3M6AA 4YYEA 3WP1B 3NALA 5EP4A 1M2WA 3TVDA 3F5FA 1F1BA 1JQDA 1GGKA 1K8XB 3PRKE 4L6CA 5FWXA 4P98A 4W1PA 4CMIA 2IYEA 4ABTA 3SBOA 3B9PA 3JQ7B 3RIHA 3SYTA 3VGJA 4LSZA 1ZMOA 1EDOA 1I94B 2FOIA 5LWQA 3KOYA 3QE0A 1Y5NA 3R6DA 4GOND 2QTFA 4MV6A 1YDHA 2QD1A 3NAZA 1YR6A 3DOEA 3NJ4A 3R0XA 4F1JA 3ER8A 4LV6A 4X84A 3LIPA 3O3CA 1R7RA 2GUWA 5HDQA 2C3PA 1FTYA 4Y6PA 4Y18A 2JLWA 3T5AA 1NI4B 1VI2A 2C8JA 3OFNA 2XDYA 3PSAA 3IP1A 3U39A 4IIXA 2BGRA 4TLLB 2ZS7A 4M87A 3QLVA 4RD4A 5FB3A 4MVJD 3RWMB 3W9UA 5A02A 1NHWA 1BOOA 3D6UA 1BQ4A 3HKCA 4BGUA 2C7VA 1MGOA 4QBHA 4PCAA 2VUUA 2JIZD 2B5OA 1JLLA 1Y4AE 4KX5A 4N6GA 5AW1A 4PZAA 4UHJA 2OT3B 1RI1A 2OK7A 4YRLA 1B8PA 2BT4A 5BSMA 3VR6H 4B74A 4GBED 3LY5A 1CUAA 4IZHA 1X87A 1OLOA 5FTNA 4QRIA 4X8LA 4EJ0A 1I7SB 2PS3A 4OLJA 3ENNA 2Z2IA 4Y9RA 4YRIA 2EBFX 4KBYA 1MJGM 2G08A 4Q93A 3F6PA 1L9XA 1WHTA 5F64A 2PUFA 3O9ZA 5LQDA 1OZAA 1YMVA 3S8YA 2C5EA 4PGGA 2P90A 5SY4A 3GAAA 3ELDA 3M9XA 2XE6A 1O95C 2WSLA 2WAAA 4P5DA 2VP0A 4Q7JB 4TTTS 4Y2JA 4DQUA 4L85A 5GZ6A 1JXQA 2XMGA 2FPKA 1RMYA 1PFYA 2XTMA 3BKXA 3QU7A 3R5XA 5CD1A 4NWIA 2WUVA 5G3YA 3IT3A 2LDXA 1M7GA 1JQBA 4L76A 1PW5A 3DLCA 4ZI3A 3PFGA 1T25A 4XX1A 3ZG6A 3ZIAA 1VGVA 2JFHA 2J09A 3EK2A 4F2GA 4M1MA 4OJMX 4TSFA 1JR3A 1RABA 1FW8A 1MW8X 1YQUA 2GZ3A 2F00A 3KYIB 4JLSA 4D8YA 4E32A 4I5IA 4AJ2A 1N5OX 4PNHA 4WZBA 5JH7A 2O7VA 4ERXA 2CXUA 3W8DA 5KKNB 3ZLVA 3MMSA 3NWBA 1OH7A 1KBQA 5DX1A 4IIVA 5E9JA 3SHTA 5A7FA 2P6OA 2X14A 2VTVA 5FJJA 4OMDA 3GRCA 1KMHA 3R5SA 3RG2A 2FU5C 3H6KA 3RU2A 1RFGE 2CNLA 2JGLA 1RKUA 2B2CA 3HLKA 4PZCA 5K3CA 3ETJA 2NTEA 4X97A 3IKJA 4JKIA 1J2RA 2JJ1A 1XZHA 1YRWA 2QR5A 3DZGA 2ZE8A 5FUWA 3RRBA 5LMUB 3RKRA 3NI2A 1KJIA 4ZIRA 3GLRA 1N6HA 3FWHA 2IXAA 2RONA 5KYVA 1T24A 2I66A 3ME5A 3P2KA 1T2AA 4LDQA 4P38A 4K0RA 5GJWC 4KPUB 2WJHA 5I4IA 3TX2A 5BUQA 3PE4A 1XDDA 4CKWA 1GAWA 5DNAA 3PFIA 3LUDA 3Q41A 4AK9A 5JZ9A 3ABOB 3DM5A 3K0HA 2ZOSA 4QJBA 1UINA 4YCLA 3VPHA 1CY6A 1F9AA 3QX9A 4HNQA 4F9TA 3N3AC 4R0VA 4Z6KA 4EB3A 1NN5A 3PUYA 1VHWA 3K0EA 4JBIA 3AJDA 1EUDB 3H0EA 3T5GA 2WB4A 4F2PA 5TEWA 1Q77A 2WJWA 3GGCA 3UHFA 5BW8A 4QDZA 4MP8A 2G6BA 3HJTA 2NSYA 3ND6A 1ICIA 4I6GA 2FW8A 4L15A 10MHA 1OYVA 2XTAA 3QMMA 5CT6A 2KPOA 3COYA 5AUOB 1AGXA 1GHTA 3NZEA 1CUWA 3RS9A 2G8LA 2P2YA 1XHFA 2CZCA 2VK4A 4MWGA 4UNNA 1ZD2P 1SB8A 4WOKA 4B5LA 5M7EA 3JWHA 1DTWB 1N9KA 3S1LA 5LQUA 1WP9A 3H0CA 3ZWPA 1KZ4A 1HZZC 1L5OA 3NDIA 4GWGA 2EZ8A 4HQNA 2PKWA 3BQNB 4RTRA 1JYFA 3UA4A 2O19A 3MXOA 4IRMA 5B7PA 1ZPDA 4TLBA 5EJ4A 4Y6QA 1DV2A 1RWVA 3BJZA 4PHCA 5JR3A 3GQVA 3EQ9A 2IPNA 1KY4A 2ZSJA 3FNIA 1XTQA 2AH5A 2Z3ZA 4PPNA 3DP7A 4B83A 3LLCA 1XNQB 1KFJB 1N3IA 3FJYA 5E1OA 3AM4A 2GR9A 3PA8A 1P3JA 3FH0A 1PYOA 3PYMA 4ICIA 3IHLA 3QE4A 3AW8A 5T57A 3WJAA 5FULA 3AEUB 3ZQKA 4TMVA 4EG0A 4JEIA 2XZOA 5L3SB 4Z4QA 3RBXA 2HNAA 1C3OA 2VWHA 4RCZA 4U7JA 5CT5A 4EF6A 5DHRA 4X44A 3AYXB 1Q1ZA 3VC1A 1NLUA 1UDWA 2QM3A 5J59A 3WV5A 3IAFA 4BO0A 3N28A 1P4AA 2HA5A 1TYAE 3N5KA 1MCZA 2JLQA 2P3LA 3DFKA 3P9KA 4FMCB 5CLHA 4TRMA 4MTCA 3S68A 1XTTA 4HJXA 1AN9A 4FR0A 4O63O 5L3VA 5DX0A 1YZKA 2ETVA 3CNNA 3VNVA 2JK0A 5KHOC 3E3AA 1ZINA 4QFBA 1BMDA 2G80A 2WFZA 4XFDA 4YFYA 1C1YA 5EIWA 1O6BA 2C2YA 4HB0A 1GIAA 3F5SA 1PAUA 2PBFA 2G40A 3DDWA 2WUGA 2WWYA 1CJVC 4YMIA 1HG1A 1QE0A 1XCBA 2Z5LA 1DAGA 4FFMA 1N2CB 1Z34A 2QENA 3E9NA 4JY7A 4MYUA 3WWEA 4O4LF 5JNTA 5U1PA 3ZUGA 4F8EA 1UWCA 3R75A 3FD8A 3VR3A 3VKHA 1UZLA 1N4AA 2R79A 2Y4OA 1O3YA 3F96A 1NYRA 2O3QA 3NPMA 4BMZA 2E9SA 2QU8A 3X1KA 4G1FA 2H5JA 2P8JA 2JB9A 3C39A 4GH5A 4LYAA 1DXQA 2X8LA 3H7AA 3G2MA 2XLBA 3U4GA 2WJJA 2ICAA 3T1QA 2FW7A 3GMDA 3LV8A 1CR0A 1V16B 1J21A 3OTGA 3SBEA 2B2XA 3WLSA 5JVDA 4LHXA 1ZVKA 4UBJA 2PE5A 4OLAA 3K8ZA 1ADGA 1IZZA 2WAOA 3H17A 3KAKA 3G3EA 2E89A 5CGZA 4DLTA 4QU5A 5GTDA 3LQ4A 5HQJA 4K2HA 2XWQA 3OE7A 5TJ9A 3BRWA 3KKKA 5JV5A 4ZI7A 1QHYA 3MPUA 3L7CA 3K9HA 3IPRA 5L6LB 1V37A 3FAZA 5TF0A 2JASA 5B6IA 4H18A 2ZSFA 4FOOA 3HCCA 4AY4A 3OQHA 5LBUA 5D6NA 1ST3A 4IG4A 1GFSA 4W9MC 5J47A 4BB0A 5HKAA 2B98A 2IVFA 3VUEA 2X1MA 2Y1EA 1DMRA 2V55B 4ITVA 1Y37A 1SQSA 3N76A 2PD4A 5IBCA 2WIJA 2DLDA 2VEDA 1UOEA 4IMPA 1YAJA 3IB6A 1NM5C 4RAQA 1CY4A 3HJHA 3VZSA 5M29A 3WNQA 3S7TA 5CX4A 5ICEA 2C3UA 3AHJA 1ZLXA 2PYDA 4DXAA 2IPLA 4MUNA 2WK1A 3NKLA 4ZDWA 2PUGA 3I61A 1O97D 3LUJA 3OZGA 2HX1A 2VXOA 2FJPA 3H9EO 3ORSA 4LFCB 4C03A 3RIEA 2CE7A 1OD6A 1CEQA 1PQYA 3C3BA 4B73A 2Q27A 1UMDA 4YMWA 2R1UA 4M49A 1T5IA 2JZNA 1QQ5A 5AHRA 1QTRA 1L7VC 1QH1B 2VQDA 5EXEA 2H4ZA 5A06A 3ZW7A 1GPDG 2H9YA 1O95D 2VHEA 1KTIA 1L4BA 1WY5A 3SWWA 2X22A 4B85A 1RHJA 2IYVA 3STVA 3SHFA 2WTEA 5LLDA 1C41A 3GFPA 5HS6A 3H4MA 1SRRA 1EE1A 2PUJA 4DMKA 3DB2A 1A9ZA 2ZSIA 3DKVA 2BCJQ 1HLGA 1P7CA 3HVJA 4PQRA 5BV0A 2ZTMA 3RH0A 3V2HA 4C43A 2AEFA 5HFNA 3SJBA 4CR7A 2I6SA 5JASA 4EPRA 2BFDB 3WGLA 1PNTA 3I6YA 1I6WA 5KTMA 5E4JA 2CMHA 1TO6A 2I3ZA 1F14A 5EE0A 1H65A 2DUUA 3OPYA 4LJLA 4CKEA 3BGDA 3PJGA 4BNWA 1U04A 4UARA 2UYGA 1QZTA 1TJ3A 2HXYA 2IIPA 1YJ5A 5BSRA 1XVAA 1XVIA 5H7XA 3LUPA 4G0NA 1QHEA 1PNRA 4HAIA 3OM9A 1M9NA 1Y3BE 4POAA 2JGNA 4HDKB 4TUYB 3IHWA 2AZMA 5DLQC 4PGHA 4YR7A 5IULC 3TNLA 2KBFA 2OP0A 4YP7A 3WB1A 3GJ6A 4X61A 3GEIA 1KEZA 3B6JA 4JS0A 3GG2A 5CA1A 1UBCA 2I29A 3QLUC 3OUTA 2OGUA 4HXFB 4D9JA 3SM3A 3R4VA 3AEQB 5CB6A 1EVEA 4YUYA 8ABPA 5HCUA 1UBTS 4ZGWA 1XZFA 4S04A 3A9UA 1WMAA 4RWEA 3WRXC 1SXIA 3FOWA 4CT4B 2V0GA 2I4TA 3AUFA 4OL9A 4BTLA 5B1YA 2Q1WA 4INOA 4F6RA 2QTMA 2Q4DA 4GNRA 2CFOA 5DEOA 4E94A 1R8JA 4E7PA 2EWWA 4BO9A 5A4AA 4RVOA 3JD1A 3HCDA 3WBBA 4US1R 1I0LA 2WWVD 3LYUA 2VYCA 1XRJA 5JE8A 3HCRA 1EHIA 1W4BA 2P2DA 1PP4A 3F78A 4FHEA 4ZVPA 4RVDA 4DV3B 1H66A 5AVSA 2ZUEA 1M1YB 2OBNA 4XX0B 4OQZA 4KK4A 4QECA 4R71A 3E0QA 4QQ8A 3RYHA 4DGSA 2PWYA 3NEYA 4OQMA 4UBOA 4WOBA 4KUGA 4M9QA 1THZA 3RAPR 2QNBA 3VU3A 4BLOA 3EPHA 1S2IA 1OH5A 5GOTA 1QIJA 1D6NA 1G6Q1 4TT3A 3T3DA 3KJGA 3PNYA 5I7OA 3W9BA 2IYZA 2OP1A 4OQLA 3PXEA 2WHXA 3V97A 2ERCA 1I0IA 3JWEA 2IY7A 2JJ2A 2BZSA 3EG9B 4HS9A 3D8RA 2HF2A 4DIDA 2OO3A 2QYTA 4JMPA 1IM8A 1FL9A 2I5PO 1HL7A 2OV2A 2P1DA 2V74B 4L0DA 3RVNA 2NZJA 3SC2B 1UPXA 2MMGA 3DW1X 3QBTA 4MW7A 3ZVLA 1X2EA 3TD6A 4MVWA 4P93A 3KG2A 5K6RA 4MUBA 3I6ZA 4HJRA 4MQLA 1MJFA 5K4HA 3G8DA 4LCEA 4KZKA 2O8DB 1RXIA 1WUIS 2QYOA 2WU0A 2O2JA 4PN7A 4GL2A 2XIJA 4CRWB 3ORQA 4IIJB 2BI4A 4WY8A 5IK2D 1APBA 1F2TB 3EIXA 3B3QA 3A4IA 4LY3A 3HKBB 2RHJA 1P2DA 4MR7B 4PLYA 4D6PA 1NL3A 2B4AA 4YXFA 4RZ3A 1ESEA 1X94A 3MTIA 1ZK4A 2F3PA 1RQXA 4UMFA 2LWIA 5IYZA 1YA6A 2NG1A 3E23A 5A04A 3TFQA 1L1QA 3MCWA 4LKOA 5KKAA 2DPLA 3TB6A 2J6HA 2I9KA 1V8FA 1ZR2A 2DFTA 3HVUA 4MDYA 4I14A 3I2YX 2DEUA 4LVCA 5E6SB 3HFGA 1N2JA 1HDYA 3RE1A 4LOHA 3CBGA 3PE6A 2X3FA 1D2EA 2L69A 3S4YA 4BNYA 4QYWA 4DA7A 2ZCUA 1RYDA 2FUG6 5CYOA 4DA6A 4M0LA 4PGMA 1W8IA 3AXTA 3FF4A 1TW2A 4CF7A 1V39A 2C2MA 2J0UB 4FSDA 4PRLA 2AJBA 5AW9A 3OQIA 5IZCC 3UY4A 3KE9A 4GWKA 2PX0A 2Q9BA 4BB6A 4UTVA 1IXZA 1HO3A 3ZYZA 1Z6GA 3U1VA 5EWMA 2C03A 5DGTA 1YSCA 3PKIA 1TVKA 4I1UA 4CFSA 1SHKA 1Z8FA 4ZOCA 2OPHA 2YIMA 1JDBB 2ZJ7A 4UBNA 1P9WA 4CTMA 4ZQFA 2AKEA 3BXXA 2KBEA 4Z1MA 1Q22A 3AG6A 1GZUA 1R5NA 1VMDA 1S01A 2P2LA 1KMMA 3B1JA 2YMLA 3NIGB 4R1MA 5EE9A 3CEJA 3BE6A 2GGSA 5FLXA 1ZICA 1LVUA 3RJTA 4G2TA 4Q01A 2P65A 1NT4A 2I99A 1C9DB 5KNBD 5E1BA 4X64B 1W2GA 2JJYA 2N1MA 1HNZB 2ZUSA 1H2YA 4ARUA 3QWFA 1K4MA 1LTKA 1E1MA 4BN5A 3NVAA 2HIMA 3L6OO 1HZJA 4DB4A 1GXSA 5C52B 2IV2X 3PC4A 2X5KO 4FTWA 4RFVA 1IJKA 2Q6OA 5HPYB 3V1NA 5A4JA 5B5SA 4O5OA 4PO9A 5JQGA 1VGRA 1ENYA 4HZUB 4RLFA 1R0WA 2GHRA 2I7XA 4GAEA 3F3SA 1U4OA 3KB6A 4IDPA 2CSXA 1N6KA 2F48A 2POCA 4I9UA 1JVNA 3I2FA 4MV0A 1DAKA 4J7AA 4YONB 4KAAA 4YUWA 2XDAA 4UDYX 4WH0A 1P6UA 2GFQA 3W5UA 1Z6PA 3UGQA 1QYCA 2R8EA 2HFJA 3GRVA 2BKAA 1JVSA 3ONNA 3P26A 1ZM4A 2C0QA 4NRDA 2EHDA 1N2EA 3H86A 4MVJG 4CLHA 3I2IA 1FU7A 3FWYA 4L16A 3QNMA 4Y2HA 3FI9A 5JAUA 3CLRC 2IXTA 1RKQA 4C30A 1FS5A 5CDYA 1QC5A 4QNNA 4RADA 4RVCA 3DLAA 1F2VA 4X1IB 3ZBPA 1TGYA 2XEXA 2ZAMA 3GPIA 4ZU3A 5BQ3A 5GM2A 3ESZA 3H04A 4WY2A 4EZIA 3STUA 2P68A 3HJAA 3WO0A 1RWPA 4WKGA 3W2TA 5B7GA 1R5OA 4JHLA 5EJIA 2QUAA 1NUTA 5JD3A 4BO8A 5A4FS 2ZRHA 4P80A 4W99A 1T5BA 5AW6A 1WXDA 1GV1A 3VPAA 5JO0A 1BJTA 1U6JA 4P3PA 1Z4JA 1G291 1YQQA 3ZWBA 2DHQA 3LUHA 4MS1B 3PWZA 5DXFA 4CHGA 2P5UA 1LVHA 1FUUA 2G83A 4HATA 2QYSA 3FI0A 4FILA 3RIGA 2XDQA 5EMJA 3OIVA 3VV2A 3VGPA 2CT8A 2QDXA 1BU5A 3L8GA 4EPTA 2E4AA 3EWAA 3PXAA 3OQJA 2X7XA 3S2ZA 2WJZB 3JAWA 3OWHA 4BFYA 1EVYA 5ALUA 3ANLA 1G64A 1P2GA 1LXCA 1LJ8A 2FSVC 2PLWA 3L3BA 4PR0A 1BW9A 3ZGLA 5CNJA 3RANA 5IKEA 3GDOA 4RORA 5PNTA 5B3KA 5DTRA 5L9AA 4JZKA 1NFQA 4PAOA 5TSDA 2J9FA 3IMEA 2R6GA 1F8FA 2A9PA 3H2SA 3O7MA 1CZHA 1V7CA 2JLZA 3ZGZA 2HSDA 5FO1A 3PIRA 1AM4D 5WRFA 3VBCA 2FR8A 2J31A 5G41A 5ALWA 2DFDA 2JEYA 2J45A 3H83A 4S24A 2W2KB 1R3DA 1PR6A 2AN1A 4P2BA 3DOUA 4UTRA 3BIWA 3IJEB 2CDAA 1NATA 1CS4C 1VC2A 2BC9A 1KIFA 4MUHA 1W4ZA 1WCIB 4BE4A 4IGEA 2WSSA 3SI7A 3IO5A 1R9GA 4S0XA 3AF1A 3IBCA 4I36A 2FXVA 2I4NA 1UJNA 3JQDA 4Z9BA 4KVAA 4FE3A 3C0KA 1RYHA 4B45A 5KTTA 1N8TA 3T1HB 4HVLA 1CRZA 1UR5A 1BCSA 3FDZA 1CD5A 2C2KA 2Q49A 2YRFA 3AB8A 3M5WA 4QLAA 5FNVA 1CIJA 1JHOA 5C51B 3LRPA 1XCJA 3R77A 1QOPB 4N54A 5EHXA 3DT8A 1Y6QA 3JQAB 4IQFA 4L9RA 3FPJA 4U9UA 1D8TA 4MUGA 3WX0A 2ADFA 4JC4A 1OX4B 4EGJA 4MUAA 4UHFA 1K2WA 1NPYA 4URZR 3ACDA 2FB9A 1RPTA 3OOSA 4C21A 1ID1A 3SC6A 1XXHA 4LZPA 4H0NA 2O0MA 4YRFA 3ZCVA 1XA4A 3F6CA 4X20A 5LM3A 2FKAA 4F84A 2JD1A 1S8FA 3WLAA 2JL1A 2Y9PB 5IT4A 1H23A 4WCFC 2D59A 4MGEA 1Z08A 2FP4B 4V39A 3PWTA 1E2QA 1Z0UA 1I6LA 1PHPA 2FW0A 4QODA 1U7WA 2PJRA 2FFQA 4XIGS 1I0ZA 4KI0A 4Q9KA 2XRZA 4CL3A 3QVUA 3ESDA 3MQ2A 1RLTA 3P94A 4P7JA 4D81A 1A5BB 4PNZA 5FUYA 4LQLA 4C2AA 4WE3A 1PJLA 4YXWA 2BVNA 4GU5A 3R3UA 4BN0A 1PR4A 1QRAA 1FUYB 1EFVB 2QI9C 5JLJA 1FZTA 3AI2A 3DDOA 3KWMA 4FMDF 1DAMA 5C32A 3UBTA 1GPLA 4OM8A 1V2GA 1J7KA 2C58A 1JEOA 2M1XA 3CJRA 1WCXA 5FAXA 3U5ZB 1VPWA 2NU9A 1HGXA 2J4CA 3L8ZA 1CWUA 4DG8A 2NUBA 3H3FA 3MTJA 2GESA 4DEVA 4H1WA 4RQTA 1E5TA 2YJ4A 4QTUB 2W6NA 2DBVO 3PUIA 4O1IA 1UQRA 2B9VA 1Y63A 3M4ZA 3VSAA 4KPFC 1TMYA 1T35A 2BR3A 1JQLB 3KC2A 1P1CA 1OPRA 2Y1WA 4OYHA 2QN3A 4RKFA 3TZEA 3NGXA 3KAPA 3RIXA 3W9YA 4YDRA 2WKQA 1Y3FE 2PMEA 1QQBA 2GN1A 3DVSX 3AUKA 4WKBA 4PPQA 1D4AA 3ELUA 4N48A 3BTUA 2H51A 2FLWA 3H2KA 4NJEA 4XOIA 2R00A 5E0KB 4R8VA 3ZCSA 3GLGE 1F38A 1U3GA 1KPIA 4J6EA 2IHUA 1NVEA 1J0CA 4EHIA 4FX2A 2EZUA 4NH4A 4ZMBA 3AETA 1KI9A 1OXVA 1VLMA 3A36A 2PJDA 1QTQA 1CZNA 3DMYA 3GJXC 2G1AA 2Q1TA 5IS2A 5ADVA 3DD5A 1LTHR 1JB1A 3LECA 1B0AA 2HUNA 3EGDB 3N0TA 3V1TC 4B81A 3A4MA 1B6GA 3L1IA 4J2OA 4I1VA 3P2MA 4KL8S 3QPUA 4TYMA 5G53C 1T4DA 5INTA 2WF7A 4RIGA 1P5FA 1XZDA 1KBOA 1INLA 4FFWA 3NBYC 2CHQA 4OH1A 4OQNA 4CEHA 1TQ2A 3H6HA 4L2IB 1O0SA 1AD2A 4TMYA 4HDMB 2VOEA 1VCNA 3MMNA 4I3GA 3HDVA 5LQAA 2QT9A 2XE7A 4RH0A 1EBUA 2JGAA 1NQTA 4DQDA 1H9AA 2ZR8A 1KH3A 4IICA 1XMXA 3WGVA 3GJZA 1WPRA 1X7WB 1NXOA 1T4CA 2XWSA 4BVJA 4E4RA 1D2RA 1QV6A 2JIDA 1JH9A 3MTEA 3Q0IA 4WADA 3GVPA 5DM70 1TUIA 3L7NA 1L4HA 4H6WA 1AKMA 1Z4IA 2ST1A 3DONA 4JLVA 4EY8A 3GC6A 1OLXA 4NVRA 5EQFA 2V8BA 2O8FB 4X63A 1HBJA 2RKOA 2C20A 3WNBA 4LMBA 4K9KA 5E7IA 1T9GR 4HNHA 1VP9A 2A5FA 2DTEA 2CLMB 3IIMA 1MVOA 1AXRA 1ZWLA 4V24A 2NVBA 1S02A 1XDZA 2ARKA 3AR5A 4UE2A 3LXRA 3SOZA 4Z9YA 4CM9A 4N5HX 2A9RA 2ZULA 4XZ3A 1SU6A 5DI3A 2GYWA 2J6BA 2RGAA 4F93B 1GZSA 4YT4A 3L8FA 2QRLA 3B1VA 4MUFA 5EG5A 5BNIA 1OC4A 3CG4A 3OZVA 2VTBA 2H48A 2JC3A 5T4EA 4KITB 1DFGA 3O74A 4KVFA 2PR2A 3F49S 2LCQA 2YNMC 1P0IA 1MX3A 2EOAA 4H16A 2PUHA 2PEYA 3U9LA 1XN4A 4MOWA 1DJQA 4MPJA 4G4GA 4X71A 3KRTA 1SVUA 1UOPA 1H9BA 2HADA 5B4UA 3F9CA 3R5JA 2GEDA 4R5MA 1D3AA 2QTBA 1MQ8B 4I5FA 5JATA 1E6LA 3K7EA 1JA0A 3R8XA 4MVXA 3JQ7A 5KNDH 5KWVA 1K7SN 2X9VA 2ZJ5A 3H99A 4Z9FA 1P7VA 3KNZA 4RENA 1OB5A 4MX8A 4E46A 2VHYA 3SHWA 3VSCA 5JTUA 2ID4A 3RQIA 2IHVA 2GJ9A 3S2FA 2E4WA 4OJQA 3IVAA 3V1KA 3AUAA 1SU7A 1NI4A 2B35A 1W5AA 5F35A 5I6DA 1X3SA 2JKVA 2ORYA 4BNIA 2PQ6A 2G6TA 2GVNA 3PV0A 1D6JA 1AQ6A 3BRQA 2FFHA 3OY2A 3N87A 2ASVA 1BE1A 5BQFA 3HXTA 2DCUA 2DSTA 4DQKA 3B52X 5H80A 1Q0SA 4N82A 1ZMRA 4HT3B 3LK7A 1JYSA 1K88A 3HB4X 4XOUA 3N2KB 4UEQA 4V2UA 2C4HA 3JQBC 3EVAA 3X2EA 3BMNB 1CR4A 3TM4A 2H11A 2DFLA 3DOFA 1XU4A 1WCYA 1Z0FA 2Q5LA 3EIFA 4YACA 1G5FA 4B5KA 1R0LA 3UJCA 1I80A 9GPBA 5C2JB 5B3JC 1E63A 4FHZA 5BW6B 1T15A 2VZ8A 1YV9A 5F73A 4NDZA 4ZK6A 1Z73A 3GEBA 1II8B 4U2BA 1BQ3A 4JXJA 2BPOA 4X90A 1A97A 2G1UA 3LCJA 3ZCXA 1GNQA 1IATA 1PJRA 3JS5A 3NHJA 3STXA 4HGRA 3X1JA 2JFYA 3ZWVA 2YJ6A 1GAXA 3LYAA 2G9ZA 4M0CA 3U4CA 4N7MA 4J49A 2WAYA 5DCUA 5L45A 2WU1A 3BWYA 3EXEB 3FN4A 4GNKA 3CUSA 4HQOA 2XB9A 1PT8A 4HRVA 2L42A 1TL7C 1XZPA 1XCLA 3AFGA 3BWBA 4B80A 4DMHA 4ZYYA 4XGIA 1J7JA 3PQCA 1VYTA 4GR5A 4JHXA 3OH8A 4MP6A 3CBQA 1ZM3A 3TQOA 2BZ0A 4XAQA 2PSFA 3PDHA 2N1BA 2PMFA 1M0WA 2WWTA 1AGPA 3DAYA 4QARA 2PN1A 1W1IA 2R8OA 4MV4A 3HFRA 4AAYA 3DXXA 3I64A 4OQPA 1K6JA 3LHFA 4DG5A 1IHDA 3CGWA 4J0GA 4BKPA 5C7IO 4TKVB 4YT5A 4XJSA 5K51A 2YOFA 2FGKA 8ADHA 4LF7B 2QQ0A 1WDKA 1DMSA 1SC6A 1WB4A 3PC8C 3LYHA 1HE4A 4LMPA 5A4DA 3O4JA 3C8HA 1DO2A 3ADDA 2I2XB 2JHFA 4GMDA 3NJ8A 5CFZA 2NMVA 1BS2A 3VR5D 2PFGA 4EKDA 4NQRA 1BDHA 1J8QA 1V5WA 2EKLA 1U9IC 3G89A 4PZZA 4BUJA 3UATA 2IEAA 4KPUA 1T6BY 2COKA 2WG2A 2SHKA 3G49A 4CM4B 4D8VA 3IHTA 3MWEB 4J94A 5EXSA 4XWOA 1CT9A 4ZZ2A 4BLPA 3SIRA 4DQ0A 2FZEA 4U02A 5HZHA 3LC0A 3KSDO 2PRIA 4ANFA 5KOIA 3VA7A 3GGSA 1VIDA 4C6TB 3IH5A 3B3FA 1EUDA 1M76A 4J3NA 1LLFA 4I66A 5AVRA 2IT1A 5JSFA 1E20A 3Q2KA 5CVDA 3B12A 4QFMA 1B0ZA 5HIMA 3EEOA 2AMYA 2K5UA 5K3FB 4KHPB 3PXGA 1ORVA 2C95A 2FWRA 1O6FA 3ND7A 2MTBA 4FDTA 4JOQA 3MAAC 1VJCA 2QZZA 2RHCA 4MUMA 4TV8B 3DDZX 3AO0B 1GT91 4Z7OB 4BLSA 1CZRA 5K0CA 4IHAA 1DTWA 4OGWA 3HUUA 3HXPA 4BFXA 1I2DA 1U5CA 1DQNA 2JK1A 3DVAB 3OUZA 4HGNA 4ZPXA 5EKUA 4CKBA 1U0SY 4E5UA 5HCNA 4IILA 3CS3A 1W75A 2ZIGA 4ETNA 3HYCA 3KQMA 1XDUA 4O2AF 5CUQA 1B16A 1KZYC 1T1GA 5DNDA 5M04A 4G1CA 1Y5RA 2DZDA 3QXXA 5MN6A 5T8KA 3BHMA 4L5AA 1Y4DE 3OURA 2VUSA 4U00A 1IU9A 4R1SA 4QJIA 2AX3A 3QHQA 3RQSA 4K8RB 2MYTA 2UKDA 4ROSA 5GZ3A 4NMXB 4NAUA 1UJ4A 3KVOA 3ADKA 2ZUUA 3LPLA 3BTSA 4HK4A 2YFQA 4OFBA 5HILA 3CNHA 2H7YA 3KSBC 3AEUA 4UUPA 4X45A 1T6XA 4MITA 1NVGA 4D8WA 4ATNA 4ECEA 4Z4CA 5L3SA 1JZTA 1JQAA 1XA3A 1DIHA 4D9BA 2BP7B 4U7FA 4HVCA 1DHTA 1L1RA 2HJVA 2G9NA 1U8CB 1YVEI 1MHPA 3E5NA 3WSVA 1D1QA 1KMIY 5HW0A 4BUCA 5K8CA 1Q11A 4G07A 3R3ZA 2QL7A 4EMBA 2GX6A 4F8YA 1HNXB 1FXWA 3ZZ0A 9ABPA 1VYHA 3WLLA 2V6FA 1J90A 1U8EA 2DG2A 4RH3A 4EQ6B 4AY5A 3DOCA 5EIEA 3DOOA 4NZYA 3GJSA 3LWNA 3ES9A 5JAIA 1IJBA 4RTQA 3OSZA 4KXLA 3ZQJA 1FU4A 1XXLA 4OSOA 1AMNA 1N2CA 2NZWA 2DT5A 5JNRA 3SSMA 2KJQA 3FFAA 1WNFA 2YNMD 4BQNA 2G04A 1YL7A 2R7NA 3C6MA 3IURA 3MBKA 4MO2A 4U2FA 3T5MA 3VR0A 3ZWMA 1QIGA 4AJ9A 1LDNA 3E9EA 4NL4H 1MN6A 3EEYA 4MGHA 1HYEA 3VM6A 3ZDBA 4TQ9A 3ROFA 3NMUF 4RABA 2AUMA 4RFLA 5IZ4A 1SHZA 3LUGA 2AQKA 2P3OA 2ODPA 3C85A 1XL1A 2IPXA 2DETA 4AWXA 2RHOA 2J33A 3I12A 1V16A 3R0VA 1X1EA 4I1PA 3G82C 3OPNA 2CJXA 5DHUA 4Q82A 2WTXA 4MB0A 3QPCA 4DA8A 4NFHA 3VZBA 5TNXA 3D3JA 3KJZA 2P6UA 2GARA 5EOVA 2PYZA 4BQEA 3N2YA 5CPBA 2B1RA 2OCBA 2JKYA 3T3MB 4JWTA 1I4OA 1I4TD 1G16A 4LCJA 4MW2A 4OBXA 3DAOA 2Q3FA 3DNMA 4Y30A 1QV7A 3BAFA 5LQJA 9LDBA 3NTLA 1H69A 3BS4A 1GTL1 4GRIA 4BBZA 1E2MA 2HSGA 3AF5A 3G5UA 4KO3S 1QFZA 3AT1A 1YDWA 5EJAA 2EGGA 1GPJA 4G09A 3VC7A 1H6CA 1PJZA 4IXMA 3I04A 3ENQA 1E9FA 2HK7A 1A5SB 1H2EA 2QTWB 3K20A 2ZIFA 4ITRC 5ER9A 3ZV5A 5BPHA 4AMVA 1G6HA 3IT1A 4BECA 4ZOQI 5JNLA 2ZYDA 3VH3A 5FHRA 3PP8A 1UQTA 3RC9A 1PRYA 1YBMA 3JAKB 1XNGA 4NPAA 3RHFA 4Q4CA 3DVLA 4GFDA 3NGLA 3WFJA 5BW5A 1UK6A 1XMIA 3CE6A 4D0GA 4GL4A 2ZW9A 3RK4A 3ROZA 3GJ0A 3LU1A 3ND9A 1F7VA 3VXKA 1QH1A 3RADC 3DKKA 1H5UA 3DUFB 3FSGA 1Q0TA 3HVIA 3S55A 3QKRB 2O5EA 2WIBA 3IT0A 1CUXA 2Q6VA 1YD7A 3HBLA 4FOPA 4IUDS 2QN2A 3FR7A 3HCBA 2VQ3A 2WG0A 3Q3EA 4H3KB 3DWIA 3SR0A 4N3BA 1AKVA 3NYQA 4BX0A 3BT7A 4XIIA 5H4HA 4OCZA 2DKOA 3NEJA 4ZC8A 5GV7A 3FOEC 1P1KA 5EMLA 2GWHA 1KVTA 3N7UA 3RSFA 4KWHA 1SXQA 3NBUA 1M1UA 1NBMA 2BFDA 4F5EA 1CJSA 1QGZA 2W2TA 3RGGA 1XEWY 2HPVA 2ZSEA 1QIFA 3L0ZA 1HUQA 3H9GA 4CMBA 1RLMA 2WP8J 2OD7A 2ZT6A 3C1AA 3DLPX 4ZO6A 3RF7A 3SQNA 3GFSA 1IDOA 1Y1KE 2H2IA 3ZX5A 2GXAA 1KDPA 1KP3A 3IAUA 4HDKA 4TUYA 5EIFA 1FP2A 4X8OA 2VNKA 1RCTE 4TTQA 5B53A 1AKQA 5H0IA 2VXYA 3OZ7A 2WJGA 3H3XA 4QXMA 5EIHA 3V2UA 4EBFA 3C41J 3RFVA 3MHTA 1KDVA 4FCWA 3OP4A 1T9CA 4JI7B 2YN0A 4F0JA 5LFAA 1JEYA 1B0UA 4CTKA 3IAS6 4AJOA 3RAFC 4HAYA 3LOQA 3AEQA 2FMFA 2R60A 3HDQA 5A0VA 4YBZA 4EO7A 2X8BA 4C0JA 4OHBA 2P35A 1OU4A 1I4WA 2PZMA 1T2NA 1ESZA 3K9BA 1UKCA 4EY7A 2O3RA 1D4FA 1R5BA 3DDCA 5FADA 4QDXA 1U2DC 1IFXA 2G1KA 3WG9A 4KFCA 1BS1A 3OOEA 1AURA 1O4VA 2NZVG 2EBWA 2YWJA 4YRDA 1CB7A 5EYPB 1CLUA 2IYPA 4BE7B 1W0JD 1U3UA 2FMIA 2PCJA 3CNQS 1QVWA 1U4NA 2C3MA 2I80A 2ZRQA 3E70C 4K26A 3PQ7A 3C98A 5K0BA 1ABEA 1CSEE 3RU3A 3ZBQA 1GGEA 1H05A 1M1YA 2XCQA 2Y05A 3JR7A 4RH1A 4XX0A 5E9AA 1EIWA 2VP5A 1HDCA 4RY9A 1JAXA 1IY9A 1OSNA 2QM8A 1AKEA 1WSDA 2BFNA 2G72A 1DC3A 3E27A 4PSUA 1DELA 3UJDA 4A10A 3ULKA 3L7KA 4BB9A 4EGCB 4OHZA 1AXGA 3CUEF 1ZGCA 2PRKA 3P8ZA 4QSMA 5FLKA 3RV4A 3V48A 4DMRA 2AW3A 2AOWA 3WRYA 1G8YA 1MC5A 2Z09A 3QPDA 4GI2A 1TQ8A 1J1IA 1ULHA 1VKJA 2B78A 3G6WA 2GNPA 1R6AA 3OETA 4KGVA 1FNDA 2WAXA 2R2GA 1NHGA 3EG9A 2JZCA 4XUGB 4HDSB 1GSOA 3JWPA 1GRNA 1ZGHA 3TFOA 1OFGA 3AUSA 3OC6A 5THQA 4KR9A 3SC2A 4CLOB 5I5EA 1Q7CA 2BFFB 3W6ZA 4OXNA 1TQ4A 4NOJA 4RKQA 2VHTA 4L4XA 4C1BA 3VUFA 1NNI1 4AJHA 2QX8A 1JXOA 2RH9B 4L6IA 1ST2A 4EKIA 2IV3A 5KJ6A 4AQDA 2OCLA 2XA1A 3C1OA 2O8DA 2FPOA 1G5IA 5I7AA 1P5RA 3KQWA 4YI5A 4LJ6A 4BEVA 3MAJA 2I67A 4C0XA 3LS2A 4IIJA 5C7OO 5CA0B 1U31A 2IOQA 2V58A 1YB7A 3K8OE 5T5QA 1F2TA 1IY0A 3AM3A 3WMXA 2GXQA 4ARAA 4N18A 3QUBA 1JIXA 3HKBA 3PXCX 3DAPA 4MR7A 1J1ZA 3N58A 1SBYA 1Q17A 1TIPA 3D2BA 4OOFA 3CVYA 2DWPA 4QJ4A 4NCJA 4XRRA 1H4VB 3FWKA 4TGLA 4HQLA 1DTEA 3IQIX 1ODFA 2ZWPA 3L1JA 4W5OA 5B55A 2AR0A 2B4KA 2J3LA 2Q3JA 4AJEA 2NOAA 4OJTA 4BMDA 3TW6A 3MB5A 3L4JA 5J4LA 3NM5A 1I1NA 1QGYA 2QYHA 3RC7A 1C7QA 1F8GA 1Q2XA 2D54A 2YHSA 3F1LA 3N0WA 4CV0A 1CE8B 3FPKA 5EWLB 3L8MA 4I4TB 1FX1A 1GARA 3MGAA 2AEEA 1P4JA 4V0QA 5E6SA 5K05A 5DXJA 4BVKA 2D3TA 2VCYA 1CR1A 1N1MA 1NSFA 5BP7A 4OU4A 4ZVRA 1ZVQA 2VYNA 3LPAA 4NDAA 1NR5A 5HUJA 4OK6A 1CYEA 3I62A 1MAVA 5ARCA 3IXLA 5B3LA 3ROTA 5DULA 3U7EB 1I5EA 2J0UA 4H31A 2NQ2C 2R8XA 4P4LA 2J6CA 3T4EA 4YJ2A 3ZLUA 4D92A 2NTYC 3N53A 1Q0ZA 1YAHA 3GLGB 1IWBB 2JAQA 3TX6A 2E7ZA 4FIDA 1DSSG 2DBYA 1YZNA 5FOQA 1XSEA 3GRZA 3IHKA 3WK6A 3CZ5A 4KQJA 1L5VA 4G2NA 3QJYA 3MRTA 1RU3A 1YRYE 4HWSA 4LRUA 3GZ4A 4B3FX 2LXNA 4QTTB 4KMMA 3QVSA 4CIVA 3G8BA 1EJBA 2HK9A 2P9GA 3Q3VA 3OMXA 5KQSA 2QQ5A 3CPJB 3FIJA 1L4YA 2QX7A 3IVRA 5FA5A 5KYYB 3DEZA 2FNAA 1TVCA 3L9WA 2WQ6A 1NG9A 2W37A 1GNLA 1YXMA 2YWCA 4LJAA 2FWIA 1J8YF 1N9ZA 4X41A 4C3VA 2ODEA 1DWPA 1KZGB 3G5TA 1R00A 1Z07A 2PVSA 5HVNA 3E5HA 3HUEA 2FZWA 4J0DA 2V7TA 1JJFA 4CN9A 1I10A 1Z4LA 4X95A 2Y6UA 4NF2A 1K7CA 1YTUA 1ZGZA 3T9FA 2I6TA 3QU9A 4C4RA 3L4SO 4HZUA 5F7ZA 4YJ3F 2ISQA 2DY1A 1KI2A 5ARDA 5J9FA 1SIBE 5ECWA 3W4JA 1HSOA 2WMYA 3HB0A 2X6RA 2GZRA 1RP1A 5KYKA 4ISCA 1C9MA 1SZJG 1KZ1A 4L4RA 3NIDB 4JROA 4DCOA 3WLKX 3E9MA 3C24A 1CW2B 4ND6A 3G9ZA 2J46A 2PSSA 1RXSA 2Q62A 2QV0A 3RVBA 3IMFA 4AS3A 1BVYF 3SVTA 2AHOA 5AIAA 3A6GA 5E6UB 1G63A 2V7PA 4AZTA 2F3QA 4HMQA 2Y66A 2XB6A 5BRJA 2XYVA 3PRJA 5KNCD 2IW3A 2TMDA 1CQJA 1U2PA 2QJWA 4UD6A 1BO6A 2Z2YA 4X1IA 5EPOA 2FW6A 2J9RA 1T6ZA 1CZUA 2B4TO 1FMTA 1BX1A 5DCYA 5G3ZA 1QR2A 2O3SA 1GL9B 4B3RB 3M81A 2GB4A 3LC7O 3L7YA 3ONWA 3NBZC 3OLYA 3TW8B 1HYHA 1I2ZA 3BD8A 2NUAB 1FSZA 2NWQA 2RHHA 1KSHA 3FYTA 3FGOA 2WD7B 5EHNA 4N3GA 5A03A 1EFUA 4FBLA 4XLTA 4UHBA 1YK1A 3QENA 3KQVA 4PC3A 1Z83A 1SOAA 3JW8A 4EB6B 4KLRA 3T7TA 1UJBA 3UXMA 1ZN8A 1PLKA 1UCFA 2C4WA 2GFIA 5ALNA 3GLQA 3VU8A 4BJ3A 3RBZA 2ZS8A 2DPHA 5AIBA 1SWVA 3G8CA 5HBRA 2VXBA 5CNKA 2FPXA 5D8DA 2H3EA 1IHXA 3G13A 1OHHD 1H0SA 4CTNA 2WEKA 1O1YA 4L22A 2GM9A 2FPUA 4UBMA 3MJTA 1PR2A 3RNOA 5BOSB 3BPSA 2WVAA 1R0CA 2PT6A 4XIYA 2QMQA 2BUAA 2ZITA 3JQFA 4G1EB 2A3RA 3FRJA 4FC7A 2P9YA 5BSGA 3G6KA 1PQ4A 5FOXA 5LMZA 1MP0A 1VBKA 4RA6B 1Q19A 5DHFA 2CL7X 3RIYA 5AW2A 3BOSA 3A6PC 5CLIA 2QXTA 3ZCTA 2GAFA 3G02A 4DMFA 3H5RA 3IDAA 2ZSAA 2L2QA 3CUWA 4J29A 5I7HA 2W2KA 2NVOA 2BGMA 3FOAA 4TTAA 3SZMA 4F3YA 3OKCA 3RRYA 4GBJA 5JS2A 5ESRA 1EEHA 4QUKA 2QLFA 5CJ2A 3T5TA 1UM8A 2VT6A 1U9YA 4BVGA 1HDXA 1S7GA 5ICFA 4OX9B 1BHSA 1ZUIA 1P3Y1 1WCIA 4I81A 1ZD1A 1O8BA 2JAPA 1MFPA 1KOGA 4KKXB 1L3IA 3OCUA 4B46A 5B57C 1K75A 4JOBA 4YCCA 5HFJA 3ANNA 1PZXA 1JJ7A 1K5DA 3SYLA 1L5SA 3JQ9A 3MOSA 3U13A 3F2IA 4CKCB 2B21A 4RW0A 1FFCA 4FCTA 5HUHA 3L4BC 2PX6A 1AS2A 4HDQB 4I1IA 4MAAA 5DN6D 5LWHA 4MVJA 1UBUS 2R5NA 3OZAA 2GD0A 4J0IA 4NFSA 4RQUA 1KAMA 3JQAA 3DAFA 5JCZA 4Q4DA 3P20A 5BWOA 5JYBA 4MLZA 1BYUA 8MHTA 3IOCA 2FPIB 1OX4A 2UVQA 2G09A 1KSGA 3RVMA 2ZRLA 4MP3A 3W3ZB 3C8MA 3DBOB 4RY2A 5CK5A 4Q9JA 4C06A 1FYXA 4PQFA 2QE7A 5CM8B 5AVZA 3V6LA 3AKZA 1UAGA 1SUIA 2JIBA 1LY1A 2Z2XA 3LW7A 1LQ2A 1OOEA 2GBIA 1YIDA 5FQNA 1DJLA 4RZQA 1KVUA 3CONA 2FP4A 5E1MA 3QU5A 1VSBA 2R96A 5CH3A 2A86A 1A88A 1OY1A 1U90A 1VMIA 1XAIA 5AR1A 1D5WA 1KYYA 3U19A 1FNMA 2ZVQX 1DU4A 1T36B 2Z5FA 1DFIA 1ZGJA 4LPSA 2BEUB 3L6DA 5BR7A 1A95A 4HWGA 4HNTA 1MW9X 1YRLA 4V0OA 4CLXA 1O89A 5C7LO 3KPVA 3DAHA 1XQ9A 3O94A 1BYIA 2EJVA 4XI9A 2P11A 2XH8A 1EFVA 1K6EA 4CN8A 2ANBA 2HPAA 1UMKA 1E59A 2PAFA 2V1XA 3AHHA 3LHDA 5AKJA 2QD2A 2HBRA 2ZK7A 3LT1A 1OZGA 3ZY6A 5AOCA 4D9EA 1G7RA 1V8DA 2EKPA 2MR6A 3WB2A 2E6UX 2GBLA 1AO3A 3EYWA 4LSWA 5L3QB 2QUHA 4ZEWA 1NY5A 4F4IA 1Q1QA 1RYZA 3MERA 3KIPA 4LYGA 3ZQUA 4K6CA 2JCGA 3E61A 3H18A 1CK4A 4A8PA 1D2HA 5KKCA 4M0EA 5NULA 4I5GA 5LQSA 1FF9A 4DV2B 4LGMA 2I3BA 4CHTA 2Y0DA 2I8LA 3GXBA 2FI1A 2CVQA 4OA8A 4QXAA 3TSCA 3U49A 1KEWA 3IBFA 5JTTA 2PZJA 3HGQA 2GJ8A 2XUKA 1O6GA 1SELA 1U94A 2XMQA 1KI3A 3AR9A 1IZ9A 1QHNA 4BNVA 4FWBA 5IN5A 1NP3A 4QIHA 1W85B 1NW5A 1SHTX 5IVKA 3C87A 2GZDA 4RD2A 1DKLA 2COEA 3EQ7A 4AZVA 2OFWA 1AF4A 2VLIA 1PO7A 3UO8B 5BORA 3GCXA 1KU0A 3IR7A 1XD8A 1TZKA 4M88A 2PLRA 1VM6A 1C7EA 2Q3BA 1QE3A 2OECA 3JQ6A 4DEXA 4CG2A 3OLQA 1Y1TA 2AC4A 1W1WA 3EGDA 3I30X 1NC3A 3PHBE 2CD9A 3QI7A 3T8YA 3URMA 5KO2A 2PUCA 3B5JA 1K97A 2GEVA 4R3NA 5JCOA 4U2CA 5F4ZA 1OWMA 4GZ3A 4D56A 4RD6A 2R8BA 4L1KA 1BFKA 1RYMA 2NV6A 3AYZB 5JSKA 1W5TA 2B1QA 2JGJA 5L7TA 4L2IA 2GO1A 1NVFA 4HDMA 1KZ9A 3IL2A 2Z1DA 3MRVA 3KYCB 4QRHA 2P27A 3EA0A 4FFDA 2BFWA 2CK3A 3IGFA 4W63A 3WGHA 2RB4A 4KQ6A 1WD5A 1FSGA 1OFVA 2I6GA 3BK1A 2RFLA 1X7WA 2HCBA 4M1TA 1N1DA 2W0SA 2BN4A 3QUAA 4TSKA 3TPCA 4YIHA 2ZGVA 3CLSC 3WSTA 1MX5A 1JKJB 3Q9NA 1GPWB 2IPMA 2B20A 3PSHA 1GPAA 4JC8A 1U2TA 2HA3A 4PHHA 5BURA 1LDEA 2O8FA 4G65A 3UMCA 3UK2A 3LQ2A 2H5IA 3T34A 1WB9A 2EW1A 2YY7A 2BFBB 3GVHA 4OAQA 3O0DA 4L57A 1X9GA 4QPNA 4WL0A 3WL6A 3Q1KA 1XQWA 1NFFA 1WV0A 1H0RA 3QVGB 5LLSA 4YJHB 4XR9A 4ASUA 1O87A 3S0JA 2W2NA 4M0PA 3E9QA 4UJ3A 1ENPA 4A9AA 4Y6RA 1KVQA 2G9UA 2Q5JA 1UJ5A 2A7XA 3INYA 4Q3OA 4HAWA 4WACA 2FN7A 1QIHA 1YI0A 3DC2A 3KQQA 1W0KA 2QLJA 4ENSA 1RBQA 4ALNA 1XQ1A 3LHSA 1EQUA 4QYTA 2MMCA 4RSGA 5JADA 1TCCA 1WOMA 4ZAYA 5DYWA 3V00A 4DSUA 4JSYA 1C8LA 3L7OA 5DV9A 1XJQA 2GRUA 2X0NA 2OZPA 3MXTA 2IYFA 5IC6A 4HSGA 3TRJA 2RGRA 3W2GA 2FSUA 3PC7A 4QKQA 3A9RA 4EAQA 3SQWA 5KYTA 1Z5UA 5EKTA 5D1NA 1XA0A 3F9IA 1IN4A 3O8OB 4GECA 3Q8LA 1B26A 1GYPA 3ZR4B 1HETA 4E1VA 4HAVA 3VDQA 1CBUA 4TTJA 4YQZA 2FF5A 4XVRA 1O94A 3IQHX 3VNRA 4DQXA 1A69A 2IBTA 4IFEA 3TYXA 3R9XA 3U26A 1HNWB 4O33A 1HK7A 4Y6GB 1YS1X 4LG1A 2CYCA 4G1BA 2AOUB 5LC1A 3R7DA 1OV6A 1KHTA 3MA0A 4PLZA 3IQEA 3X0DA 1J2JA 5I9NA 4BFLA 4EO9A 1NPDA 5MGNA 1F3OA 2HK8A 1UC5B 3UUGA 1I3MA 1DX9A 1ZI9A 2B7CA 4CM6A 2Z2JA 4IGKA 1BX0A 4M76B 5TT1A 3N2KA 1J5PA 5I7UA 1EG7A 2ZXUA 3BMNA 1TEHA 1V95A 4H9GA 3VR2D 3ZZ1A 1T0HB 2IWHA 2NQ8A 1Q7EA 2BGWA 1F9EA 4GMXA 3GEHA 3KSZO 4ZVMA 2C8VA 2FKNA 2AXPA 1G5QA 5B64A 1OIWA 1AGRA 2DM6A 3MT8A 1GA4A 4WXPA 4NU0A 2JCBA 4RUKA 1WG8A 2BH2A 3HJBA 1XHLA 1ZD9A 5CTAA 3UJPA 3O3NB 2M98A 1II8A 3FUUA 4E12A 2R2AA 4LS3A 4P4NA 3U0BA 1WXXA 2WIAA 4QZVA 2GTPA 5LP6F 5J3JA 4LZNA 4NYMR 1S4QA 1SK9A 4OTZA 4ARIA 1W46A 1E5QA 3PA6A 4ZO4A 1USIA 2XWPA 1IXRC 3AZQA 3EXEA 4KUHA 4WIAA 2XVYA 2B9EA 4OHFA 1JMKC 4UUOA 3NRJA 1SD1A 2YWEA 2GRJA 2WZQA 4C78A 2UZAA 4P4SB 3PQEA 2YWGA 3BF7A 4I9HA 1VKHA 2PZLA 1F5SA 3GLFB 2WIKA 3DTVB 4B7CA 3AR4A 4IMIB 4XD7A 4ACAA 2UUAB 1Q3HA 3K5WA 3KYDB 3NTQA 3UCFA 2YVLA 2OV4A 5C46F 1AKNA 2BAGA 3VDNB 2DBQA 1VL5A 1LI5A 1KO4A 2O5RA 2IYLD 2ETXA 1VSUA 2YL2A 4JVNA 4TKVA 5U9CA 4QASA 2QPTA 2UXDB 1TLFA 3G2LA 1B93A 4RY0A 1YC5A 2XUDA 1XI2A 3O9MA 1U2RA 3T6KA 1SM4A 1ULBA 3SHOA 1ZZGA 2JNWA 3IIIA 3TEFA 2Q1YA 5FUMA 1ODJA 5EUCA 2QMOA 2WSBA 3UMVA 2RG7A 5IMBA 5F12A 2FN4A 4RMIA 2XVMA 3MQFA 4J0CA 4XASA 5F78A 3WMRA 1IN7A 5HBGA 2C9YA 1VDZA 4HADA 4J3JA 5H68A 2XXAB 3HZRA 5CP8A 1R6DA 3KZXA 3B3AA 4NBKA 1CUHA 1E2FA 3IC5A 4G5QA 4GG1A 2GJ4A 4CM4A 1JV2B 2C7PA 4TYWA 3MWEA 3ZZTA 1SOVA 4NSNA 2XUFA 1OBCA 1ZJ6A 3I6IA 2QTHA 1Z8NA 1OTXA 1N6RA 4BQOA 4EI7A 1DEOA 2UVPB 3VPCA 1JHUA 4LRSB 1GSHA 3ZUPA 4C6TA 1HF3A 3J80A 2VFAA 1SQ0A 1L7EA 2VOJA 3E1SA 4I3HA 3HNPA 3PEFA 3ZDDA 1ZI6A 2IH5A 3L0SA 2VPXA 5CLLA 2ANCA 1U8XX 3RRMA 5H4GA 3QE2A 2BTOA 3BFPA 4XDZA 3HC7A 5K3FA 3OD5A 3WMEA 3BEOA 4YV0A 1OA0A 3Q8MA 1Z4OA 2B6HA 1P44A 4TV8A 4KYVA 2GEFA 5FEMA 1H5QA 4IUCS 4EJSB 4UU8A 3FUVA 1E6UA 4IIHA 5H81A 3R3JA 3EFOA 3HLTA 1O58A 2XBLA 2IC5A 1FYDA 1XQXA 5BNTA 3M6IA 5HTOA 3GFOA 3DVAA 2Z6AA 2LPMA 5A3QA 3TLGB 3ABSB 3DCNA 1ZAKA 2GF9A 2VNSA 4XGRA 4N9QA 1DRUA 2J5RA 2ZUDA 1J07A 4KIWA 2RK4A 4MARA 1T2EA 5JO9A 4Y2VA 4V0MA 3OIWA 1AV6A 1TT7A 1BRTA 5FFFA 1GUDA 1N5KA 1Q1NA 4K8OA 4EYSA 1BRMA 1JLRA 2C29D 4JODA 3AVVA 3CRNA 4OA5A 3ZDZB 5AUPB 5I47A 4WX2B 2A14A 1GZDA 4XCXA 3FPLA 5F2NA 2PUBA 2PM8A 1X1DA 1IC6A 4HAZA 4NCNA 1V1RB 1KQ3A 3CLSD 5HJEA 1STOA 3F7NA 1AKYA 2OCDA 1UDAA 1H2HA 2NLOA 2GZ1A 1HZZA 3BA1A 4WBNB 2YZKA 1JLKA 3HCPA 4PLVA 3ISJA 4D82A 2BP7A 4EHDA 4IIEA 1GR1A 1HE8B 3TNYA 4AJJA 5ESXA 2QRZA 2BJVA 3FNFA 2JCXA 4IWXA 2NYAA 2DULA 4HYEA 1ULSA 2ZUWA 4J91A 1LBEA 2DT8A 5C18A 4MICA 3M2TA 4OY3A 2Z8YM 1JECA 1ODIA 2YYAA 2XJ4A 3K35A 4XYBA 4EQ6A 1XCPA 1G3IA 1NTOA 1RAAA 2DQSA 2P79A 2X6QA 3C15C 1ODLA 3D8NA 5JZMA 1HA3A 1VE6A 2VDLB 2QLMA 2XXBA 1G0NA 3AUJB 3L06A 5JC8A 4JOSA 5CIYA 2YJZA 4DJ5X 2O3JA 5H70A 1WDTA 2I3GA 5MGBA 1EHYA 1FUKA 1C7ZA 1SEVA 3GNQA 2P40A 1T2UA 1Z25A 2R86A 2YHAA 2R6AA 1VLVA 1TA9A 2DERA 1ORTA 2QD3A 3DE6X 4BGEA 3AFHA 4C2BA 2CHGA 3JWIA 5JWRA 2YBDA 4IRUB 4ZAFA 2XD9A 1EAMA 1NKTA 3UGKA 2VK2A 1R9NA 3PNKA 4FYYA 4GI7A 4NYMQ 4NG4A 4PG7A 3DLBA 2FZVA 4QFCA 4E7OA 3A1VA 2WA1A 3BDAA 1PQUA 3DDUA 4ER5A 2B1GA 4MUXA 4D3XA 5CFPA 1NVDA 3L8DA 3EZ6A 5DLPA 5LA6B 1U3FA 2JA1A 1TYDE 5F5NA 4ZZ0A 2ADMA 3H84A 3SBXA 3L05A 5BN5A 5A0TA 3A6DA 4NNPA