5HR9A

The crystal structure of se-asfvpolx(l52/163m mutant) in complex with 1nt-gap dna1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDMLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKEMGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 41
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hr9A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hr9A01
3AQMA 3JPOA 5CWRA 2I9GA 4M47A 3JPTA 4R64A 2W9MA 8ICCA 4I27A 5DECA 1JAJA 2Q66A 2PFNA 8ICMA 4NM1A 8ICOA 4AT9B 4QZ9A 4KLFA 4QZAA 4X0BA 3HJ1A 4RPXA 4I2HA 1HUZA 2PXIA 4XA5A 1KEJA 1ZQXA 2GWSA 3WFSC 4KLEA 1MQ2A 4IQWA 2FMPA 4LVSA 5DBAA 9ICFA 2M2WA 4GXKA 4M5DA 3H39A 3B0YA 1KNYA 4I2FA 3MDCA 4MFCA 2DR9A 4FHYA 3RJEA 4UAZA 3PMNA 5DDYA 3H3AA 9ICTA 7ICFA 4FHVA 1MIVA 3AU2A 2ZH5A 4GXJA 3C5GA 4UB5A 4DOAA 4X4TA 5J0QA 4XRHA 1MIWA 4I2EA 1TVAA 5J2CA 4F5OA 5J29A 4I28A 4X4SA 3RJJA 4UBBA 2BCVA 1BPXA 4NY8A 4QZGA 9ICUA 7ICNA 4PGYA 4YMMA 3OUYA 3UXOA 3WFOA 2BE3A 3PNCA 4QZDA 3RJIA 3C2LA 4TUSA 2VANA 4O5KA 4KLOA 4RQ6A 5DB6A 4TUQA 4X4QA 5HRDA 3RJGA 3L9DA 4WC5A 4M0AA 5J0UA 5J0YA 2M2UA 4QZEA 9ICOA 5J2IA 7ICPA 1Q79A 3WFQE 4KLDA 3B0XA 9ICAA 2ZH6A 2O5AA 4F5RA 5IIOA 4NKTA 4JWMA 4WC4A 2ZH9A 4NLKA 3HX0A 1RPLA 1VJ7A 4P4OA 4WC2A 1R8AA 1ZQBA 4EBJA 4KLUA 5J2FA 4RQ3A 3C2KA 8ICAA 1ZQHA 4I2DA 5DKWA 4QZBA 3H37A 8ICIA 3JPQA 5J0PA 2ZH7A 1ZQWA 3AU6A 4I2GA 1ZQDA 4AT7B 4Z6EA 4S3NA 7ICTA 4M9GA 3RJHA 1ZQIA 5J0XA 2IHMA 7ICQA 9ICHA 4DOCA 1PX5A 4ATBA 7ICGA 4RWOA 4RQ0A 4K4GA 4P2HA 3HJ4A 4M2YA 1UETA 5J2GA 4E7XA 3V7JA 2FMQA 2DR8A 3LQCB 2BCSA 1ZQAA 4YD2A 3UPQA 5HRKA 5CJ7A 1HUOA 3MGHA 7ICMA 5HRHA 9ICBA 3AQKA 1ZQFA 5HRIA 3UQ2A 3C66A 4PHAA 2PFPA 2O1PA 2ZHBA 5HC9A 1ZQVA 4MF2A 5HHIA 4X4PA 4FO6A 5DB7A 4O5CA 4PHPA 4WC7A 2FMSA 4Z6DA 1R8CA 4WC0A 4RT2A 3UQ0A 4QZ8A 4JWNA 4RQ4A 3PMLA 4PPXA 3RH4A 4WCWA 4YD1A 8ICUA 4R65A 2BPFA 4PGXA 4XQ7A 3HWTA 3RJFA 4KLGA 2DR7A 9ICSA 5EOZA 9ICQA 1MQ3A 5J0RA 5DB8A 4QZIA 4I2JA 3V7LA 8ICXA 9ICPA 4RQ2A 5J2JA 4QZHA 5CA7A 7ICSA 4IQTA 1V4AA 4X5VA 1KDHA 7ICKA 7ICLA 4XQ8A 5J2HA 4LZGA 8ICKA 2NRKA 4Z6CA 4M04A 3WFPA 5IINA 4FH3A 3OVSA 2ZH2A 3AQNA 1OU5A 1TFWA 4E80A 3HW8A 3OV7A 5J2EA 4KLQA 4DO9A 4PHDA 4RWPA 4TURA 4YMOA 1ZJMA 7ICUA 4F5NA 9ICCA 5CHGA 4PHEA 1ZQMA 4AT8A 4KLTA 1ZQZA 2ISOA 2DRBA 5J0TA 5CB1A 1BPYA 4WC6A 8ICYA 3V72A 4RWQA 4X0AA 3OUYB 2ZH1A 4XUSA 8ICPA 3K75D 4O9MA 4X4VA 3UXNA 4KLSA 4GXIA 5D46A 8ICFA 1ZQUA 5J0SA 3AUOA 5HRGA 4I29A 5HRLA 3AQLA 8ICZA 4FHPA 3MDAA 7ICVA 2M2VA 1JMSA 1VFGA 2BPCA 4K4IA 1ZQQA 4YMNA 4FHWA 3NYBA 4NM2A 5D49A 2BCUA 2HHPA 4F5PA 1XSPA 3RJKA 5HRBA 5J2DA 1R8BA 4UBCA 4M9LA 1NOMA 4QZFA 4I2BA 1ZQEA 7ICOA 4I2CA 1ZQNA 1WOTA 4IQVA 3TFSA 5HREA 4WBYA 1ZQPA 1JN3A 2ISPA 4FHXA 4K4HA 5IIJA 4TUPA 5F2VO 4KLMA 4FH5A 4AT9A 8ICHA 9ICVA 1ZQCA 4KLHA 4NLNA 4F5QA 4EP7A 4ATBB 4MFFA 4PGQA 1BPBA 5J2AA 4KLLA 1JQRA 5J0WA 2PBEA 4UB3A 1ZQJA 3UPSA 3JPRA 7ICEA 3JYYA 3ISDA 4EBKA 9ICXA 3JPPA 3RH5A 8ICJA 4R63A 4PH5A 4UB4A 5DBCA 4M9NA 5HRFA 1UEVA 9ICKA 2DRAA 5HHHA 5CR0A 7ICJA 4M9HA 5CP2A 1ZQTA 4R66A 5DDMA 4MFAA 3C5FA 1ZQLA 4Z6FA 3OVAA 3JZ0A 2ZH3A 5BOMA 4UD5A 1R89A 2ZH4A 4UB2A 3MGIA 1UEUA 4O5EA 1MIYA 4X4OA 4YN4A 3GDXA 9ICEA 5J2BA 7ICIA 2DR5A 1ZQKA 4RT3A 2PFOA 4X4NA 4IQUA 8ICEA 5IIIA 9ICLA 3OVBA 9ICIA 4WC3A 4LT6A 8ICBA 4IG8A 4RPYA 5BOLA 1ZJNA 4DOBA 9ICWA 3C2MA 1Q78A 4UAWA 8ICQA 1BPEA 1TV9A 1ZQSA 3ISCA 2PFQA 3LK9A 1TFYA 3OGUA 2DVIA 9ICJA 1XSLA 2BCRA 1YLQA 5TZVA 1BPDA 3WFRE 9ICGA 4RQ7A 2BPGA 5DEDA 4RQ5A 8ICLA 8ICSA 1ZQGA 4WBZA 2BCQA 3V7KA 3MBYA 8ICGA 3C18A 1XSNA 3JPSA 1BPZA 5IILA 5DB9A 5IIKA 4KLIA 3H38A 4E8FA 1NO5A 1ZQOA 4AT8B 9ICMA 2ZHAA 8ICVA 2M2TA 9ICRA 3ISBA 4NKUA 5IIMA 1ZQYA 4P4PA 7ICHA 4I2AA 4AT7A 4QZCA 4NXZA 4KLJA 4P4MA 2ID1A 4NLZA 3HIYA 4M9JA 1RZTA 1FA0A 8ICNA 5J0OA 8ICWA 5HR9A 4LZDA 5DBBA 7ICRA 3UXPA 4RWNA 2P66A 4YCXA 4RPZA 5J2KA 4X4RA 9ICNA 1F5AA 3RH6A 8ICTA 4RQ1A 4RQ8A 3JPNA 3TFRA 2RFFA 4I2IA 4UAYA 2ZH8A 8ICRA 4X4UA 4UD4A 5BPCA 4UB1A 4MF8A 4WC1A 5D4BA 1ZQRA
chains in the Genus database with same CATH superfamily
3AQMA 3JPOA 5CWRA 2I9GA 4M47A 4KB6A 3JPTA 4JLZA 2FCLA 4R64A 5B3PA 2W9MA 8ICCA 4I27A 5DECA 1JAJA 2Q66A 2PFNA 8ICMA 4NM1A 8ICOA 5D61A 4AT9B 4QZ9A 4KLFA 4QZAA 4K98A 4X0BA 3HJ1A 4RPXA 4I2HA 1HUZA 4JLXA 2PXIA 4XA5A 1KEJA 1ZQXA 2GWSA 3WFSC 4KLEA 2IUBA 1MQ2A 4IQWA 2HN2A 2FMPA 4LVSA 5DBAA 9ICFA 2M2WA 4GXKA 4M5DA 3H39A 3B0YA 1KNYA 4I2FA 3MDCA 4MFCA 2DR9A 4FHYA 3RJEA 4UAZA 3PMNA 5DDYA 3H3AA 9ICTA 7ICFA 4FHVA 1MIVA 3AU2A 2ZH5A 4GXJA 3C5GA 4UB5A 4DOAA 4X4TA 5J0QA 4XRHA 1MIWA 4I2EA 1TVAA 4LEVA 5J2CA 4F5OA 5J29A 4I28A 4X4SA 3RJJA 4UBBA 2BCVA 1BPXA 4NY8A 4QZGA 9ICUA 7ICNA 4PGYA 4YMMA 3OUYA 3CK6A 3UXOA 3WFOA 2BE3A 3PNCA 4QZDA 3RJIA 3C2LA 4TUSA 2VANA 4O5KA 4KLOA 4K96A 4RQ6A 5DB6A 4TUQA 4X4QA 5HRDA 3RJGA 3L9DA 4WC5A 4M0AA 2GAFD 5J0UA 5J0YA 2M2UA 4QZEA 9ICOA 5J2IA 7ICPA 1Q79A 3WFQE 4KLDA 3B0XA 9ICAA 2ZH6A 2O5AA 4F5RA 5IIOA 4NKTA 4JWMA 4WC4A 3NWIA 2ZH9A 4NLKA 3HX0A 1RPLA 3EF2A 1VJ7A 4P4OA 4WC2A 1R8AA 1ZQBA 4EBJA 4KLUA 5J2FA 4RQ3A 3C2KA 8ICAA 1ZQHA 4I0UA 4I2DA 5DKWA 4QZBA 3H37A 8ICIA 3JPQA 4OAFA 5J0PA 2ZH7A 1ZQWA 3AU6A 3ER8C 4I2GA 1ZQDA 4NXXA 4AT7B 4Z6EA 4WQLA 4S3NA 7ICTA 4M9GA 3RJHA 1ZQIA 5J0XA 2IHMA 7ICQA 9ICHA 4DOCA 4LEZA 5JTGA 1PX5A 4ATBA 7ICGA 4RWOA 4RQ0A 4K4GA 4P2HA 3HJ4A 4M2YA 1UETA 5J2GA 4E7XA 3V7JA 2FMQA 2DR8A 3LQCB 2BCSA 1ZQAA 4YD2A 3UPQA 5HRKA 5CJ7A 1HUOA 3MGHA 7ICMA 5HRHA 9ICBA 3AQKA 4O69A 1ZQFA 5HRIA 3UQ2A 3C66A 4PHAA 2PFPA 2O1PA 2ZHBA 5HC9A 1ZQVA 4MF2A 5HHIA 4X4PA 4FO6A 5DB7A 4O5CA 4PHPA 4WC7A 2FMSA 4Z6DA 4NXTA 1R8CA 4WC0A 4RT2A 3UQ0A 4QZ8A 4JWNA 3NKUA 4RQ4A 3PMLA 4PPXA 3RH4A 4WCWA 4K9BA 4YD1A 8ICUA 4R65A 2BPFA 4PGXA 4XQ7A 3HWTA 4HX0A 3OWGA 3RJFA 4KLGA 2DR7A 9ICSA 5EOZA 9ICQA 1MQ3A 5J0RA 5DB8A 4QZIA 4I2JA 3V7LA 8ICXA 5D62A 3K7DA 9ICPA 4RQ2A 5J2JA 4QZHA 5CA7A 7ICSA 4IQTA 1V4AA 4X5VA 1KDHA 7ICKA 7ICLA 4XQ8A 5J2HA 4LZGA 8ICKA 2NRKA 4K8VA 5CFTA 4Z6CA 4M04A 4K9AA 3WFPA 4NXUA 5IINA 4FH3A 3ERCC 3PHZA 3OVSA 2ZH2A 3AQNA 1OU5A 1TFWA 4E80A 3HW8A 3OV7A 5J2EA 4KLQA 4DO9A 4PHDA 4RWPA 5CFSA 4TURA 4YMOA 1ZJMA 7ICUA 3MCRA 4F5NA 9ICCA 5CHGA 4PHEA 1ZQMA 4AT8A 4KLTA 1ZQZA 2ISOA 2DRBA 2IHOA 5J0TA 5CB1A 1BPYA 4WOYA 4WC6A 8ICYA 4O67A 3V72A 4RWQA 4X0AA 3OUYB 2ZH1A 4XUSA 8ICPA 3K75D 4O9MA 4X4VA 3UXNA 4MKPA 4KLSA 4GXIA 5D46A 8ICFA 1ZQUA 5J0SA 3AUOA 5HRGA 4I29A 5HRLA 3AQLA 8ICZA 4FHPA 3MDAA 7ICVA 2BBHA 2M2VA 1JMSA 4KM5A 1VFGA 2EWRA 2BPCA 4K4IA 1ZQQA 4YMNA 4FHWA 3NYBA 4NM2A 5D49A 2BCUA 2HHPA 4F5PA 1XSPA 3RJKA 5HRBA 5J2DA 1R8BA 4UBCA 4OAHA 4M9LA 1NOMA 4QZFA 2GA9D 2B51A 4I2BA 1ZQEA 7ICOA 3JCFA 4I2CA 1ZQNA 4K99A 1WOTA 4IQVA 4XJEA 3TFSA 5HREA 4WQKA 4WBYA 1ZQPA 1JN3A 2ISPA 4FHXA 4K4HA 5IIJA 4TUPA 5F2VO 4KLMA 4FH5A 4AT9A 8ICHA 9ICVA 4EEDA 1ZQCA 4KLHA 4NLNA 4F5QA 4EP7A 4ATBB 4MFFA 4PGQA 1BPBA 5J2AA 4KLLA 1JQRA 5J0WA 2PBEA 4UB3A 1ZQJA 3UPSA 3JPRA 7ICEA 4WH5A 3JYYA 2B4VA 3ISDA 4EBKA 9ICXA 3JPPA 3RH5A 8ICJA 4R63A 4PH5A 4K97A 4UB4A 5DBCA 4M9NA 5HRFA 1UEVA 9ICKA 2DRAA 5HHHA 5CR0A 7ICJA 4M9HA 5CP2A 1ZQTA 4R66A 5DDMA 5B3QA 4MFAA 3C5FA 1ZQLA 4Z6FA 3OVAA 3JZ0A 2ZH3A 5BOMA 4UD5A 1R89A 2ZH4A 4UB2A 3MGIA 1UEUA 4O5EA 5CHEA 1MIYA 4X4OA 4YN4A 3GDXA 9ICEA 5J2BA 7ICIA 2DR5A 1ZQKA 4RT3A 2PFOA 4X4NA 4IQUA 8ICEA 4LEYA 4EGWA 5IIIA 9ICLA 3OVBA 9ICIA 4WC3A 4LT6A 8ICBA 4NXVA 4IG8A 4RPYA 5BOLA 4OAIZ 1ZJNA 4DOBA 9ICWA 3C2MA 1Q78A 4UAWA 8ICQA 4EEBA 1BPEA 1TV9A 1ZQSA 1GPJA 3ISCA 2PFQA 2HN1A 3LK9A 1TFYA 3OGUA 2DVIA 9ICJA 1XSLA 2BCRA 1YLQA 5TZVA 1BPDA 4O68A 3WFRE 2B56A 9ICGA 4RQ7A 2BPGA 5DEDA 4RQ5A 8ICLA 8ICSA 1ZQGA 4WBZA 2BCQA 3V7KA 3MBYA 8ICGA 3C18A 1XSNA 3JPSA 1BPZA 5IILA 5DB9A 4OAGA 5IIKA 4KLIA 3H38A 4E8FA 1NO5A 1ZQOA 4AT8B 9ICMA 2ZHAA 8ICVA 2M2TA 9ICRA 3ER9B 3ISBA 4NKUA 5IIMA 4FO1A 5CFUA 1ZQYA 4P4PA 7ICHA 4I2AA 4AT7A 4QZCA 4EV6A 4NXZA 4KLJA 4P4MA 2ID1A 5D63A 4NLZA 3HIYA 3NVOA 4M9JA 1RZTA 1FA0A 8ICNA 4O6AA 5J0OA 4N7RA 8ICWA 5HR9A 4LZDA 5DBBA 7ICRA 3UXPA 4RWNA 4NXWA 2P66A 4YCXA 4RPZA 2BBJA 4LEWA 5J2KA 4X4RA 9ICNA 1F5AA 3RH6A 8ICTA 4RQ1A 4RQ8A 3JPNA 3TFRA 2RFFA 4I2IA 4UAYA 2ZH8A 8ICRA 4X4UA 4UD4A 5BPCA 4UB1A 4MF8A 4WC1A 5D4BA 1ZQRA
chains in the Genus database with same CATH topology
3AQMA 3JPOA 5CWRA 2I9GA 4M47A 3JPTA 4R64A 2W9MA 8ICCA 4I27A 5DECA 1JAJA 2Q66A 2PFNA 8ICMA 4NM1A 8ICOA 4AT9B 4QZ9A 4KLFA 4QZAA 4X0BA 3HJ1A 4RPXA 4I2HA 1HUZA 2PXIA 4XA5A 1KEJA 1ZQXA 2GWSA 3WFSC 4KLEA 1MQ2A 4IQWA 2FMPA 4LVSA 5DBAA 9ICFA 2M2WA 4GXKA 4M5DA 3H39A 3B0YA 1KNYA 4I2FA 3MDCA 4MFCA 2DR9A 4FHYA 3RJEA 4UAZA 3PMNA 5DDYA 3H3AA 9ICTA 7ICFA 4FHVA 1MIVA 3AU2A 2ZH5A 4GXJA 3C5GA 4UB5A 4DOAA 4X4TA 5J0QA 4XRHA 1MIWA 4I2EA 1TVAA 5J2CA 4F5OA 5J29A 4I28A 4X4SA 3RJJA 4UBBA 2BCVA 1BPXA 4NY8A 4QZGA 9ICUA 7ICNA 4PGYA 4YMMA 3OUYA 3UXOA 3WFOA 2BE3A 3PNCA 4QZDA 3RJIA 3C2LA 4TUSA 2VANA 4O5KA 4KLOA 4RQ6A 5DB6A 4TUQA 4X4QA 5HRDA 3RJGA 3L9DA 4WC5A 4M0AA 5J0UA 5J0YA 2M2UA 4QZEA 9ICOA 5J2IA 7ICPA 1Q79A 3WFQE 4KLDA 3B0XA 9ICAA 2ZH6A 2O5AA 4F5RA 5IIOA 4NKTA 4JWMA 4WC4A 2ZH9A 4NLKA 3HX0A 1RPLA 1VJ7A 4P4OA 4WC2A 1R8AA 1ZQBA 4EBJA 4KLUA 5J2FA 4RQ3A 3C2KA 8ICAA 1ZQHA 4I2DA 5DKWA 4QZBA 3H37A 8ICIA 3JPQA 5J0PA 2ZH7A 1ZQWA 3AU6A 4I2GA 1ZQDA 4AT7B 4Z6EA 4S3NA 7ICTA 4M9GA 3RJHA 1ZQIA 5J0XA 2IHMA 7ICQA 9ICHA 4DOCA 1PX5A 4ATBA 7ICGA 4RWOA 4RQ0A 4K4GA 4P2HA 3HJ4A 4M2YA 1UETA 5J2GA 4E7XA 3V7JA 2FMQA 2DR8A 3LQCB 2BCSA 1ZQAA 4YD2A 3UPQA 5HRKA 5CJ7A 1HUOA 3MGHA 7ICMA 5HRHA 9ICBA 3AQKA 1ZQFA 5HRIA 3UQ2A 3C66A 4PHAA 2PFPA 2O1PA 2ZHBA 5HC9A 1ZQVA 4MF2A 5HHIA 4X4PA 4FO6A 5DB7A 4O5CA 4PHPA 4WC7A 2FMSA 4Z6DA 1R8CA 4WC0A 4RT2A 3UQ0A 4QZ8A 4JWNA 4RQ4A 3PMLA 4PPXA 3RH4A 4WCWA 4YD1A 8ICUA 4R65A 2BPFA 4PGXA 4XQ7A 3HWTA 3RJFA 4KLGA 2DR7A 9ICSA 5EOZA 9ICQA 1MQ3A 5J0RA 5DB8A 4QZIA 4I2JA 3V7LA 8ICXA 9ICPA 4RQ2A 5J2JA 4QZHA 5CA7A 7ICSA 4IQTA 1V4AA 4X5VA 1KDHA 7ICKA 7ICLA 4XQ8A 5J2HA 4LZGA 8ICKA 2NRKA 4Z6CA 4M04A 3WFPA 5IINA 4FH3A 3OVSA 2ZH2A 3AQNA 1OU5A 1TFWA 4E80A 3HW8A 3OV7A 5J2EA 4KLQA 4DO9A 4PHDA 4RWPA 4TURA 4YMOA 1ZJMA 7ICUA 4F5NA 9ICCA 5CHGA 4PHEA 1ZQMA 4AT8A 4KLTA 1ZQZA 2ISOA 2DRBA 5J0TA 5CB1A 1BPYA 4WC6A 8ICYA 3V72A 4RWQA 4X0AA 3OUYB 2ZH1A 4XUSA 8ICPA 3K75D 4O9MA 4X4VA 3UXNA 4KLSA 4GXIA 5D46A 8ICFA 1ZQUA 5J0SA 3AUOA 5HRGA 4I29A 5HRLA 3AQLA 8ICZA 4FHPA 3MDAA 7ICVA 2M2VA 1JMSA 1VFGA 2BPCA 4K4IA 1ZQQA 4YMNA 4FHWA 3NYBA 4NM2A 5D49A 2BCUA 2HHPA 4F5PA 1XSPA 3RJKA 5HRBA 5J2DA 1R8BA 4UBCA 4M9LA 1NOMA 4QZFA 4I2BA 1ZQEA 7ICOA 4I2CA 1ZQNA 1WOTA 4IQVA 3TFSA 5HREA 4WBYA 1ZQPA 1JN3A 2ISPA 4FHXA 4K4HA 5IIJA 4TUPA 5F2VO 4KLMA 4FH5A 4AT9A 8ICHA 9ICVA 1ZQCA 4KLHA 4NLNA 4F5QA 4EP7A 4ATBB 4MFFA 4PGQA 1BPBA 5J2AA 4KLLA 1JQRA 5J0WA 2PBEA 4UB3A 1ZQJA 3UPSA 3JPRA 7ICEA 3JYYA 3ISDA 4EBKA 9ICXA 3JPPA 3RH5A 8ICJA 4R63A 4PH5A 4UB4A 5DBCA 4M9NA 5HRFA 1UEVA 9ICKA 2DRAA 5HHHA 5CR0A 7ICJA 4M9HA 5CP2A 1ZQTA 4R66A 5DDMA 4MFAA 3C5FA 1ZQLA 4Z6FA 3OVAA 3JZ0A 2ZH3A 5BOMA 4UD5A 1R89A 2ZH4A 4UB2A 3MGIA 1UEUA 4O5EA 1MIYA 4X4OA 4YN4A 3GDXA 9ICEA 5J2BA 7ICIA 2DR5A 1ZQKA 4RT3A 2PFOA 4X4NA 4IQUA 8ICEA 5IIIA 9ICLA 3OVBA 9ICIA 4WC3A 4LT6A 8ICBA 4IG8A 4RPYA 5BOLA 1ZJNA 4DOBA 9ICWA 3C2MA 1Q78A 4UAWA 8ICQA 1BPEA 1TV9A 1ZQSA 3ISCA 2PFQA 3LK9A 1TFYA 3OGUA 2DVIA 9ICJA 1XSLA 2BCRA 1YLQA 5TZVA 1BPDA 3WFRE 9ICGA 4RQ7A 2BPGA 5DEDA 4RQ5A 8ICLA 8ICSA 1ZQGA 4WBZA 2BCQA 3V7KA 3MBYA 8ICGA 3C18A 1XSNA 3JPSA 1BPZA 5IILA 5DB9A 5IIKA 4KLIA 3H38A 4E8FA 1NO5A 1ZQOA 4AT8B 9ICMA 2ZHAA 8ICVA 2M2TA 9ICRA 3ISBA 4NKUA 5IIMA 1ZQYA 4P4PA 7ICHA 4I2AA 4AT7A 4QZCA 4NXZA 4KLJA 4P4MA 2ID1A 4NLZA 3HIYA 4M9JA 1RZTA 1FA0A 8ICNA 5J0OA 8ICWA 5HR9A 4LZDA 5DBBA 7ICRA 3UXPA 4RWNA 2P66A 4YCXA 4RPZA 5J2KA 4X4RA 9ICNA 1F5AA 3RH6A 8ICTA 4RQ1A 4RQ8A 3JPNA 3TFRA 2RFFA 4I2IA 4UAYA 2ZH8A 8ICRA 4X4UA 4UD4A 5BPCA 4UB1A 4MF8A 4WC1A 5D4BA 1ZQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQM A;  3JPO A;  5CWR A;  2I9G A;  4M47 A;  3JPT A;  4R64 A;  2W9M A;  8ICC A;  4I27 A;  5DEC A;  1JAJ A;  2Q66 A;  2PFN A;  8ICM A;  4NM1 A;  8ICO A;  4AT9 B;  4QZ9 A;  4KLF A;  4QZA A;  4X0B A;  3HJ1 A;  4RPX A;  4I2H A;  1HUZ A;  2PXI A;  4XA5 A;  1KEJ A;  1ZQX A;  2GWS A;  3WFS C;  4KLE A;  1MQ2 A;  4IQW A;  2FMP A;  4LVS A;  5DBA A;  9ICF A;  2M2W A;  4GXK A;  4M5D A;  3H39 A;  3B0Y A;  1KNY A;  4I2F A;  3MDC A;  4MFC A;  2DR9 A;  4FHY A;  3RJE A;  4UAZ A;  3PMN A;  5DDY A;  3H3A A;  9ICT A;  7ICF A;  4FHV A;  1MIV A;  3AU2 A;  2ZH5 A;  4GXJ A;  3C5G A;  4UB5 A;  4DOA A;  4X4T A;  5J0Q A;  4XRH A;  1MIW A;  4I2E A;  1TVA A;  5J2C A;  4F5O A;  5J29 A;  4I28 A;  4X4S A;  3RJJ A;  4UBB A;  2BCV A;  1BPX A;  4NY8 A;  4QZG A;  9ICU A;  7ICN A;  4PGY A;  4YMM A;  3OUY A;  3UXO A;  3WFO A;  2BE3 A;  3PNC A;  4QZD A;  3RJI A;  3C2L A;  4TUS A;  2VAN A;  4O5K A;  4KLO A;  4RQ6 A;  5DB6 A;  4TUQ A;  4X4Q A;  5HRD A;  3RJG A;  3L9D A;  4WC5 A;  4M0A A;  5J0U A;  5J0Y A;  2M2U A;  4QZE A;  9ICO A;  5J2I A;  7ICP A;  1Q79 A;  3WFQ E;  4KLD A;  3B0X A;  9ICA A;  2ZH6 A;  2O5A A;  4F5R A;  5IIO A;  4NKT A;  4JWM A;  4WC4 A;  2ZH9 A;  4NLK A;  3HX0 A;  1RPL A;  1VJ7 A;  4P4O A;  4WC2 A;  1R8A A;  1ZQB A;  4EBJ A;  4KLU A;  5J2F A;  4RQ3 A;  3C2K A;  8ICA A;  1ZQH A;  4I2D A;  5DKW A;  4QZB A;  3H37 A;  8ICI A;  3JPQ A;  5J0P A;  2ZH7 A;  1ZQW A;  3AU6 A;  4I2G A;  1ZQD A;  4AT7 B;  4Z6E A;  4S3N A;  7ICT A;  4M9G A;  3RJH A;  1ZQI A;  5J0X A;  2IHM A;  7ICQ A;  9ICH A;  4DOC A;  1PX5 A;  4ATB A;  7ICG A;  4RWO A;  4RQ0 A;  4K4G A;  4P2H A;  3HJ4 A;  4M2Y A;  1UET A;  5J2G A;  4E7X A;  3V7J A;  2FMQ A;  2DR8 A;  3LQC B;  2BCS A;  1ZQA A;  4YD2 A;  3UPQ A;  5HRK A;  5CJ7 A;  1HUO A;  3MGH A;  7ICM A;  5HRH A;  9ICB A;  3AQK A;  1ZQF A;  5HRI A;  3UQ2 A;  3C66 A;  4PHA A;  2PFP A;  2O1P A;  2ZHB A;  5HC9 A;  1ZQV A;  4MF2 A;  5HHI A;  4X4P A;  4FO6 A;  5DB7 A;  4O5C A;  4PHP A;  4WC7 A;  2FMS A;  4Z6D A;  1R8C A;  4WC0 A;  4RT2 A;  3UQ0 A;  4QZ8 A;  4JWN A;  4RQ4 A;  3PML A;  4PPX A;  3RH4 A;  4WCW A;  4YD1 A;  8ICU A;  4R65 A;  2BPF A;  4PGX A;  4XQ7 A;  3HWT A;  3RJF A;  4KLG A;  2DR7 A;  9ICS A;  5EOZ A;  9ICQ A;  1MQ3 A;  5J0R A;  5DB8 A;  4QZI A;  4I2J A;  3V7L A;  8ICX A;  9ICP A;  4RQ2 A;  5J2J A;  4QZH A;  5CA7 A;  7ICS A;  4IQT A;  1V4A A;  4X5V A;  1KDH A;  7ICK A;  7ICL A;  4XQ8 A;  5J2H A;  4LZG A;  8ICK A;  2NRK A;  4Z6C A;  4M04 A;  3WFP A;  5IIN A;  4FH3 A;  3OVS A;  2ZH2 A;  3AQN A;  1OU5 A;  1TFW A;  4E80 A;  3HW8 A;  3OV7 A;  5J2E A;  4KLQ A;  4DO9 A;  4PHD A;  4RWP A;  4TUR A;  4YMO A;  1ZJM A;  7ICU A;  4F5N A;  9ICC A;  5CHG A;  4PHE A;  1ZQM A;  4AT8 A;  4KLT A;  1ZQZ A;  2ISO A;  2DRB A;  5J0T A;  5CB1 A;  1BPY A;  4WC6 A;  8ICY A;  3V72 A;  4RWQ A;  4X0A A;  3OUY B;  2ZH1 A;  4XUS A;  8ICP A;  3K75 D;  4O9M A;  4X4V A;  3UXN A;  4KLS A;  4GXI A;  5D46 A;  8ICF A;  1ZQU A;  5J0S A;  3AUO A;  5HRG A;  4I29 A;  5HRL A;  3AQL A;  8ICZ A;  4FHP A;  3MDA A;  7ICV A;  2M2V A;  1JMS A;  1VFG A;  2BPC A;  4K4I A;  1ZQQ A;  4YMN A;  4FHW A;  3NYB A;  4NM2 A;  5D49 A;  2BCU A;  2HHP A;  4F5P A;  1XSP A;  3RJK A;  5HRB A;  5J2D A;  1R8B A;  4UBC A;  4M9L A;  1NOM A;  4QZF A;  4I2B A;  1ZQE A;  7ICO A;  4I2C A;  1ZQN A;  1WOT A;  4IQV A;  3TFS A;  5HRE A;  4WBY A;  1ZQP A;  1JN3 A;  2ISP A;  4FHX A;  4K4H A;  5IIJ A;  4TUP A;  5F2V O;  4KLM A;  4FH5 A;  4AT9 A;  8ICH A;  9ICV A;  1ZQC A;  4KLH A;  4NLN A;  4F5Q A;  4EP7 A;  4ATB B;  4MFF A;  4PGQ A;  1BPB A;  5J2A A;  4KLL A;  1JQR A;  5J0W A;  2PBE A;  4UB3 A;  1ZQJ A;  3UPS A;  3JPR A;  7ICE A;  3JYY A;  3ISD A;  4EBK A;  9ICX A;  3JPP A;  3RH5 A;  8ICJ A;  4R63 A;  4PH5 A;  4UB4 A;  5DBC A;  4M9N A;  5HRF A;  1UEV A;  9ICK A;  2DRA A;  5HHH A;  5CR0 A;  7ICJ A;  4M9H A;  5CP2 A;  1ZQT A;  4R66 A;  5DDM A;  4MFA A;  3C5F A;  1ZQL A;  4Z6F A;  3OVA A;  3JZ0 A;  2ZH3 A;  5BOM A;  4UD5 A;  1R89 A;  2ZH4 A;  4UB2 A;  3MGI A;  1UEU A;  4O5E A;  1MIY A;  4X4O A;  4YN4 A;  3GDX A;  9ICE A;  5J2B A;  7ICI A;  2DR5 A;  1ZQK A;  4RT3 A;  2PFO A;  4X4N A;  4IQU A;  8ICE A;  5III A;  9ICL A;  3OVB A;  9ICI A;  4WC3 A;  4LT6 A;  8ICB A;  4IG8 A;  4RPY A;  5BOL A;  1ZJN A;  4DOB A;  9ICW A;  3C2M A;  1Q78 A;  4UAW A;  8ICQ A;  1BPE A;  1TV9 A;  1ZQS A;  3ISC A;  2PFQ A;  3LK9 A;  1TFY A;  3OGU A;  2DVI A;  9ICJ A;  1XSL A;  2BCR A;  1YLQ A;  5TZV A;  1BPD A;  3WFR E;  9ICG A;  4RQ7 A;  2BPG A;  5DED A;  4RQ5 A;  8ICL A;  8ICS A;  1ZQG A;  4WBZ A;  2BCQ A;  3V7K A;  3MBY A;  8ICG A;  3C18 A;  1XSN A;  3JPS A;  1BPZ A;  5IIL A;  5DB9 A;  5IIK A;  4KLI A;  3H38 A;  4E8F A;  1NO5 A;  1ZQO A;  4AT8 B;  9ICM A;  2ZHA A;  8ICV A;  2M2T A;  9ICR A;  3ISB A;  4NKU A;  5IIM A;  1ZQY A;  4P4P A;  7ICH A;  4I2A A;  4AT7 A;  4QZC A;  4NXZ A;  4KLJ A;  4P4M A;  2ID1 A;  4NLZ A;  3HIY A;  4M9J A;  1RZT A;  1FA0 A;  8ICN A;  5J0O A;  8ICW A;  5HR9 A;  4LZD A;  5DBB A;  7ICR A;  3UXP A;  4RWN A;  2P66 A;  4YCX A;  4RPZ A;  5J2K A;  4X4R A;  9ICN A;  1F5A A;  3RH6 A;  8ICT A;  4RQ1 A;  4RQ8 A;  3JPN A;  3TFR A;  2RFF A;  4I2I A;  4UAY A;  2ZH8 A;  8ICR A;  4X4U A;  4UD4 A;  5BPC A;  4UB1 A;  4MF8 A;  4WC1 A;  5D4B A;  1ZQR A; 
#chains in the Genus database with same CATH topology
 3AQM A;  3JPO A;  5CWR A;  2I9G A;  4M47 A;  4KB6 A;  3JPT A;  4JLZ A;  2FCL A;  4R64 A;  5B3P A;  2W9M A;  8ICC A;  4I27 A;  5DEC A;  1JAJ A;  2Q66 A;  2PFN A;  8ICM A;  4NM1 A;  8ICO A;  5D61 A;  4AT9 B;  4QZ9 A;  4KLF A;  4QZA A;  4K98 A;  4X0B A;  3HJ1 A;  4RPX A;  4I2H A;  1HUZ A;  4JLX A;  2PXI A;  4XA5 A;  1KEJ A;  1ZQX A;  2GWS A;  3WFS C;  4KLE A;  2IUB A;  1MQ2 A;  4IQW A;  2HN2 A;  2FMP A;  4LVS A;  5DBA A;  9ICF A;  2M2W A;  4GXK A;  4M5D A;  3H39 A;  3B0Y A;  1KNY A;  4I2F A;  3MDC A;  4MFC A;  2DR9 A;  4FHY A;  3RJE A;  4UAZ A;  3PMN A;  5DDY A;  3H3A A;  9ICT A;  7ICF A;  4FHV A;  1MIV A;  3AU2 A;  2ZH5 A;  4GXJ A;  3C5G A;  4UB5 A;  4DOA A;  4X4T A;  5J0Q A;  4XRH A;  1MIW A;  4I2E A;  1TVA A;  4LEV A;  5J2C A;  4F5O A;  5J29 A;  4I28 A;  4X4S A;  3RJJ A;  4UBB A;  2BCV A;  1BPX A;  4NY8 A;  4QZG A;  9ICU A;  7ICN A;  4PGY A;  4YMM A;  3OUY A;  3CK6 A;  3UXO A;  3WFO A;  2BE3 A;  3PNC A;  4QZD A;  3RJI A;  3C2L A;  4TUS A;  2VAN A;  4O5K A;  4KLO A;  4K96 A;  4RQ6 A;  5DB6 A;  4TUQ A;  4X4Q A;  5HRD A;  3RJG A;  3L9D A;  4WC5 A;  4M0A A;  2GAF D;  5J0U A;  5J0Y A;  2M2U A;  4QZE A;  9ICO A;  5J2I A;  7ICP A;  1Q79 A;  3WFQ E;  4KLD A;  3B0X A;  9ICA A;  2ZH6 A;  2O5A A;  4F5R A;  5IIO A;  4NKT A;  4JWM A;  4WC4 A;  3NWI A;  2ZH9 A;  4NLK A;  3HX0 A;  1RPL A;  3EF2 A;  1VJ7 A;  4P4O A;  4WC2 A;  1R8A A;  1ZQB A;  4EBJ A;  4KLU A;  5J2F A;  4RQ3 A;  3C2K A;  8ICA A;  1ZQH A;  4I0U A;  4I2D A;  5DKW A;  4QZB A;  3H37 A;  8ICI A;  3JPQ A;  4OAF A;  5J0P A;  2ZH7 A;  1ZQW A;  3AU6 A;  3ER8 C;  4I2G A;  1ZQD A;  4NXX A;  4AT7 B;  4Z6E A;  4WQL A;  4S3N A;  7ICT A;  4M9G A;  3RJH A;  1ZQI A;  5J0X A;  2IHM A;  7ICQ A;  9ICH A;  4DOC A;  4LEZ A;  5JTG A;  1PX5 A;  4ATB A;  7ICG A;  4RWO A;  4RQ0 A;  4K4G A;  4P2H A;  3HJ4 A;  4M2Y A;  1UET A;  5J2G A;  4E7X A;  3V7J A;  2FMQ A;  2DR8 A;  3LQC B;  2BCS A;  1ZQA A;  4YD2 A;  3UPQ A;  5HRK A;  5CJ7 A;  1HUO A;  3MGH A;  7ICM A;  5HRH A;  9ICB A;  3AQK A;  4O69 A;  1ZQF A;  5HRI A;  3UQ2 A;  3C66 A;  4PHA A;  2PFP A;  2O1P A;  2ZHB A;  5HC9 A;  1ZQV A;  4MF2 A;  5HHI A;  4X4P A;  4FO6 A;  5DB7 A;  4O5C A;  4PHP A;  4WC7 A;  2FMS A;  4Z6D A;  4NXT A;  1R8C A;  4WC0 A;  4RT2 A;  3UQ0 A;  4QZ8 A;  4JWN A;  3NKU A;  4RQ4 A;  3PML A;  4PPX A;  3RH4 A;  4WCW A;  4K9B A;  4YD1 A;  8ICU A;  4R65 A;  2BPF A;  4PGX A;  4XQ7 A;  3HWT A;  4HX0 A;  3OWG A;  3RJF A;  4KLG A;  2DR7 A;  9ICS A;  5EOZ A;  9ICQ A;  1MQ3 A;  5J0R A;  5DB8 A;  4QZI A;  4I2J A;  3V7L A;  8ICX A;  5D62 A;  3K7D A;  9ICP A;  4RQ2 A;  5J2J A;  4QZH A;  5CA7 A;  7ICS A;  4IQT A;  1V4A A;  4X5V A;  1KDH A;  7ICK A;  7ICL A;  4XQ8 A;  5J2H A;  4LZG A;  8ICK A;  2NRK A;  4K8V A;  5CFT A;  4Z6C A;  4M04 A;  4K9A A;  3WFP A;  4NXU A;  5IIN A;  4FH3 A;  3ERC C;  3PHZ A;  3OVS A;  2ZH2 A;  3AQN A;  1OU5 A;  1TFW A;  4E80 A;  3HW8 A;  3OV7 A;  5J2E A;  4KLQ A;  4DO9 A;  4PHD A;  4RWP A;  5CFS A;  4TUR A;  4YMO A;  1ZJM A;  7ICU A;  3MCR A;  4F5N A;  9ICC A;  5CHG A;  4PHE A;  1ZQM A;  4AT8 A;  4KLT A;  1ZQZ A;  2ISO A;  2DRB A;  2IHO A;  5J0T A;  5CB1 A;  1BPY A;  4WOY A;  4WC6 A;  8ICY A;  4O67 A;  3V72 A;  4RWQ A;  4X0A A;  3OUY B;  2ZH1 A;  4XUS A;  8ICP A;  3K75 D;  4O9M A;  4X4V A;  3UXN A;  4MKP A;  4KLS A;  4GXI A;  5D46 A;  8ICF A;  1ZQU A;  5J0S A;  3AUO A;  5HRG A;  4I29 A;  5HRL A;  3AQL A;  8ICZ A;  4FHP A;  3MDA A;  7ICV A;  2BBH A;  2M2V A;  1JMS A;  4KM5 A;  1VFG A;  2EWR A;  2BPC A;  4K4I A;  1ZQQ A;  4YMN A;  4FHW A;  3NYB A;  4NM2 A;  5D49 A;  2BCU A;  2HHP A;  4F5P A;  1XSP A;  3RJK A;  5HRB A;  5J2D A;  1R8B A;  4UBC A;  4OAH A;  4M9L A;  1NOM A;  4QZF A;  2GA9 D;  2B51 A;  4I2B A;  1ZQE A;  7ICO A;  3JCF A;  4I2C A;  1ZQN A;  4K99 A;  1WOT A;  4IQV A;  4XJE A;  3TFS A;  5HRE A;  4WQK A;  4WBY A;  1ZQP A;  1JN3 A;  2ISP A;  4FHX A;  4K4H A;  5IIJ A;  4TUP A;  5F2V O;  4KLM A;  4FH5 A;  4AT9 A;  8ICH A;  9ICV A;  4EED A;  1ZQC A;  4KLH A;  4NLN A;  4F5Q A;  4EP7 A;  4ATB B;  4MFF A;  4PGQ A;  1BPB A;  5J2A A;  4KLL A;  1JQR A;  5J0W A;  2PBE A;  4UB3 A;  1ZQJ A;  3UPS A;  3JPR A;  7ICE A;  4WH5 A;  3JYY A;  2B4V A;  3ISD A;  4EBK A;  9ICX A;  3JPP A;  3RH5 A;  8ICJ A;  4R63 A;  4PH5 A;  4K97 A;  4UB4 A;  5DBC A;  4M9N A;  5HRF A;  1UEV A;  9ICK A;  2DRA A;  5HHH A;  5CR0 A;  7ICJ A;  4M9H A;  5CP2 A;  1ZQT A;  4R66 A;  5DDM A;  5B3Q A;  4MFA A;  3C5F A;  1ZQL A;  4Z6F A;  3OVA A;  3JZ0 A;  2ZH3 A;  5BOM A;  4UD5 A;  1R89 A;  2ZH4 A;  4UB2 A;  3MGI A;  1UEU A;  4O5E A;  5CHE A;  1MIY A;  4X4O A;  4YN4 A;  3GDX A;  9ICE A;  5J2B A;  7ICI A;  2DR5 A;  1ZQK A;  4RT3 A;  2PFO A;  4X4N A;  4IQU A;  8ICE A;  4LEY A;  4EGW A;  5III A;  9ICL A;  3OVB A;  9ICI A;  4WC3 A;  4LT6 A;  8ICB A;  4NXV A;  4IG8 A;  4RPY A;  5BOL A;  4OAI Z;  1ZJN A;  4DOB A;  9ICW A;  3C2M A;  1Q78 A;  4UAW A;  8ICQ A;  4EEB A;  1BPE A;  1TV9 A;  1ZQS A;  1GPJ A;  3ISC A;  2PFQ A;  2HN1 A;  3LK9 A;  1TFY A;  3OGU A;  2DVI A;  9ICJ A;  1XSL A;  2BCR A;  1YLQ A;  5TZV A;  1BPD A;  4O68 A;  3WFR E;  2B56 A;  9ICG A;  4RQ7 A;  2BPG A;  5DED A;  4RQ5 A;  8ICL A;  8ICS A;  1ZQG A;  4WBZ A;  2BCQ A;  3V7K A;  3MBY A;  8ICG A;  3C18 A;  1XSN A;  3JPS A;  1BPZ A;  5IIL A;  5DB9 A;  4OAG A;  5IIK A;  4KLI A;  3H38 A;  4E8F A;  1NO5 A;  1ZQO A;  4AT8 B;  9ICM A;  2ZHA A;  8ICV A;  2M2T A;  9ICR A;  3ER9 B;  3ISB A;  4NKU A;  5IIM A;  4FO1 A;  5CFU A;  1ZQY A;  4P4P A;  7ICH A;  4I2A A;  4AT7 A;  4QZC A;  4EV6 A;  4NXZ A;  4KLJ A;  4P4M A;  2ID1 A;  5D63 A;  4NLZ A;  3HIY A;  3NVO A;  4M9J A;  1RZT A;  1FA0 A;  8ICN A;  4O6A A;  5J0O A;  4N7R A;  8ICW A;  5HR9 A;  4LZD A;  5DBB A;  7ICR A;  3UXP A;  4RWN A;  4NXW A;  2P66 A;  4YCX A;  4RPZ A;  2BBJ A;  4LEW A;  5J2K A;  4X4R A;  9ICN A;  1F5A A;  3RH6 A;  8ICT A;  4RQ1 A;  4RQ8 A;  3JPN A;  3TFR A;  2RFF A;  4I2I A;  4UAY A;  2ZH8 A;  8ICR A;  4X4U A;  4UD4 A;  5BPC A;  4UB1 A;  4MF8 A;  4WC1 A;  5D4B A;  1ZQR A; 
#chains in the Genus database with same CATH homology
 3AQM A;  3JPO A;  5CWR A;  2I9G A;  4M47 A;  3JPT A;  4R64 A;  2W9M A;  8ICC A;  4I27 A;  5DEC A;  1JAJ A;  2Q66 A;  2PFN A;  8ICM A;  4NM1 A;  8ICO A;  4AT9 B;  4QZ9 A;  4KLF A;  4QZA A;  4X0B A;  3HJ1 A;  4RPX A;  4I2H A;  1HUZ A;  2PXI A;  4XA5 A;  1KEJ A;  1ZQX A;  2GWS A;  3WFS C;  4KLE A;  1MQ2 A;  4IQW A;  2FMP A;  4LVS A;  5DBA A;  9ICF A;  2M2W A;  4GXK A;  4M5D A;  3H39 A;  3B0Y A;  1KNY A;  4I2F A;  3MDC A;  4MFC A;  2DR9 A;  4FHY A;  3RJE A;  4UAZ A;  3PMN A;  5DDY A;  3H3A A;  9ICT A;  7ICF A;  4FHV A;  1MIV A;  3AU2 A;  2ZH5 A;  4GXJ A;  3C5G A;  4UB5 A;  4DOA A;  4X4T A;  5J0Q A;  4XRH A;  1MIW A;  4I2E A;  1TVA A;  5J2C A;  4F5O A;  5J29 A;  4I28 A;  4X4S A;  3RJJ A;  4UBB A;  2BCV A;  1BPX A;  4NY8 A;  4QZG A;  9ICU A;  7ICN A;  4PGY A;  4YMM A;  3OUY A;  3UXO A;  3WFO A;  2BE3 A;  3PNC A;  4QZD A;  3RJI A;  3C2L A;  4TUS A;  2VAN A;  4O5K A;  4KLO A;  4RQ6 A;  5DB6 A;  4TUQ A;  4X4Q A;  5HRD A;  3RJG A;  3L9D A;  4WC5 A;  4M0A A;  5J0U A;  5J0Y A;  2M2U A;  4QZE A;  9ICO A;  5J2I A;  7ICP A;  1Q79 A;  3WFQ E;  4KLD A;  3B0X A;  9ICA A;  2ZH6 A;  2O5A A;  4F5R A;  5IIO A;  4NKT A;  4JWM A;  4WC4 A;  2ZH9 A;  4NLK A;  3HX0 A;  1RPL A;  1VJ7 A;  4P4O A;  4WC2 A;  1R8A A;  1ZQB A;  4EBJ A;  4KLU A;  5J2F A;  4RQ3 A;  3C2K A;  8ICA A;  1ZQH A;  4I2D A;  5DKW A;  4QZB A;  3H37 A;  8ICI A;  3JPQ A;  5J0P A;  2ZH7 A;  1ZQW A;  3AU6 A;  4I2G A;  1ZQD A;  4AT7 B;  4Z6E A;  4S3N A;  7ICT A;  4M9G A;  3RJH A;  1ZQI A;  5J0X A;  2IHM A;  7ICQ A;  9ICH A;  4DOC A;  1PX5 A;  4ATB A;  7ICG A;  4RWO A;  4RQ0 A;  4K4G A;  4P2H A;  3HJ4 A;  4M2Y A;  1UET A;  5J2G A;  4E7X A;  3V7J A;  2FMQ A;  2DR8 A;  3LQC B;  2BCS A;  1ZQA A;  4YD2 A;  3UPQ A;  5HRK A;  5CJ7 A;  1HUO A;  3MGH A;  7ICM A;  5HRH A;  9ICB A;  3AQK A;  1ZQF A;  5HRI A;  3UQ2 A;  3C66 A;  4PHA A;  2PFP A;  2O1P A;  2ZHB A;  5HC9 A;  1ZQV A;  4MF2 A;  5HHI A;  4X4P A;  4FO6 A;  5DB7 A;  4O5C A;  4PHP A;  4WC7 A;  2FMS A;  4Z6D A;  1R8C A;  4WC0 A;  4RT2 A;  3UQ0 A;  4QZ8 A;  4JWN A;  4RQ4 A;  3PML A;  4PPX A;  3RH4 A;  4WCW A;  4YD1 A;  8ICU A;  4R65 A;  2BPF A;  4PGX A;  4XQ7 A;  3HWT A;  3RJF A;  4KLG A;  2DR7 A;  9ICS A;  5EOZ A;  9ICQ A;  1MQ3 A;  5J0R A;  5DB8 A;  4QZI A;  4I2J A;  3V7L A;  8ICX A;  9ICP A;  4RQ2 A;  5J2J A;  4QZH A;  5CA7 A;  7ICS A;  4IQT A;  1V4A A;  4X5V A;  1KDH A;  7ICK A;  7ICL A;  4XQ8 A;  5J2H A;  4LZG A;  8ICK A;  2NRK A;  4Z6C A;  4M04 A;  3WFP A;  5IIN A;  4FH3 A;  3OVS A;  2ZH2 A;  3AQN A;  1OU5 A;  1TFW A;  4E80 A;  3HW8 A;  3OV7 A;  5J2E A;  4KLQ A;  4DO9 A;  4PHD A;  4RWP A;  4TUR A;  4YMO A;  1ZJM A;  7ICU A;  4F5N A;  9ICC A;  5CHG A;  4PHE A;  1ZQM A;  4AT8 A;  4KLT A;  1ZQZ A;  2ISO A;  2DRB A;  5J0T A;  5CB1 A;  1BPY A;  4WC6 A;  8ICY A;  3V72 A;  4RWQ A;  4X0A A;  3OUY B;  2ZH1 A;  4XUS A;  8ICP A;  3K75 D;  4O9M A;  4X4V A;  3UXN A;  4KLS A;  4GXI A;  5D46 A;  8ICF A;  1ZQU A;  5J0S A;  3AUO A;  5HRG A;  4I29 A;  5HRL A;  3AQL A;  8ICZ A;  4FHP A;  3MDA A;  7ICV A;  2M2V A;  1JMS A;  1VFG A;  2BPC A;  4K4I A;  1ZQQ A;  4YMN A;  4FHW A;  3NYB A;  4NM2 A;  5D49 A;  2BCU A;  2HHP A;  4F5P A;  1XSP A;  3RJK A;  5HRB A;  5J2D A;  1R8B A;  4UBC A;  4M9L A;  1NOM A;  4QZF A;  4I2B A;  1ZQE A;  7ICO A;  4I2C A;  1ZQN A;  1WOT A;  4IQV A;  3TFS A;  5HRE A;  4WBY A;  1ZQP A;  1JN3 A;  2ISP A;  4FHX A;  4K4H A;  5IIJ A;  4TUP A;  5F2V O;  4KLM A;  4FH5 A;  4AT9 A;  8ICH A;  9ICV A;  1ZQC A;  4KLH A;  4NLN A;  4F5Q A;  4EP7 A;  4ATB B;  4MFF A;  4PGQ A;  1BPB A;  5J2A A;  4KLL A;  1JQR A;  5J0W A;  2PBE A;  4UB3 A;  1ZQJ A;  3UPS A;  3JPR A;  7ICE A;  3JYY A;  3ISD A;  4EBK A;  9ICX A;  3JPP A;  3RH5 A;  8ICJ A;  4R63 A;  4PH5 A;  4UB4 A;  5DBC A;  4M9N A;  5HRF A;  1UEV A;  9ICK A;  2DRA A;  5HHH A;  5CR0 A;  7ICJ A;  4M9H A;  5CP2 A;  1ZQT A;  4R66 A;  5DDM A;  4MFA A;  3C5F A;  1ZQL A;  4Z6F A;  3OVA A;  3JZ0 A;  2ZH3 A;  5BOM A;  4UD5 A;  1R89 A;  2ZH4 A;  4UB2 A;  3MGI A;  1UEU A;  4O5E A;  1MIY A;  4X4O A;  4YN4 A;  3GDX A;  9ICE A;  5J2B A;  7ICI A;  2DR5 A;  1ZQK A;  4RT3 A;  2PFO A;  4X4N A;  4IQU A;  8ICE A;  5III A;  9ICL A;  3OVB A;  9ICI A;  4WC3 A;  4LT6 A;  8ICB A;  4IG8 A;  4RPY A;  5BOL A;  1ZJN A;  4DOB A;  9ICW A;  3C2M A;  1Q78 A;  4UAW A;  8ICQ A;  1BPE A;  1TV9 A;  1ZQS A;  3ISC A;  2PFQ A;  3LK9 A;  1TFY A;  3OGU A;  2DVI A;  9ICJ A;  1XSL A;  2BCR A;  1YLQ A;  5TZV A;  1BPD A;  3WFR E;  9ICG A;  4RQ7 A;  2BPG A;  5DED A;  4RQ5 A;  8ICL A;  8ICS A;  1ZQG A;  4WBZ A;  2BCQ A;  3V7K A;  3MBY A;  8ICG A;  3C18 A;  1XSN A;  3JPS A;  1BPZ A;  5IIL A;  5DB9 A;  5IIK A;  4KLI A;  3H38 A;  4E8F A;  1NO5 A;  1ZQO A;  4AT8 B;  9ICM A;  2ZHA A;  8ICV A;  2M2T A;  9ICR A;  3ISB A;  4NKU A;  5IIM A;  1ZQY A;  4P4P A;  7ICH A;  4I2A A;  4AT7 A;  4QZC A;  4NXZ A;  4KLJ A;  4P4M A;  2ID1 A;  4NLZ A;  3HIY A;  4M9J A;  1RZT A;  1FA0 A;  8ICN A;  5J0O A;  8ICW A;  5HR9 A;  4LZD A;  5DBB A;  7ICR A;  3UXP A;  4RWN A;  2P66 A;  4YCX A;  4RPZ A;  5J2K A;  4X4R A;  9ICN A;  1F5A A;  3RH6 A;  8ICT A;  4RQ1 A;  4RQ8 A;  3JPN A;  3TFR A;  2RFF A;  4I2I A;  4UAY A;  2ZH8 A;  8ICR A;  4X4U A;  4UD4 A;  5BPC A;  4UB1 A;  4MF8 A;  4WC1 A;  5D4B A;  1ZQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...