5HR9A

The crystal structure of se-asfvpolx(l52/163m mutant) in complex with 1nt-gap dna1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDMLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKEMGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 41
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hr9A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hr9A01
5J2JA 2M2VA 4FO6A 5J0PA 4X4UA 3MDCA 4IQWA 3RH6A 5HRIA 4KLSA 4EBKA 4XQ8A 4DO9A 1FA0A 5J0SA 7ICGA 4LVSA 1HUOA 3MDAA 5EOZA 4WC0A 4RPXA 4P4PA 3V7LA 4QZHA 3UXOA 5J0WA 5BPCA 3C2MA 8ICKA 4AT7B 1XSPA 4GXKA 5J2AA 1YLQA 4KLQA 2PFOA 5HC9A 3ISBA 5HRFA 5DBAA 9ICLA 4FH5A 4RWQA 2Q66A 4TUPA 8ICYA 9ICEA 5J2GA 1XSLA 9ICIA 4RQ7A 9ICPA 2FMSA 1VFGA 4WC2A 3OVAA 4NM2A 4RQ2A 8ICZA 1ZJNA 3C2LA 3RJFA 8ICJA 3JPPA 5CWRA 4F5PA 5HRBA 4O5CA 8ICEA 1ZQKA 2PBEA 4AT9A 4I27A 1BPBA 4M47A 4PHPA 8ICBA 4RQ8A 1ZQEA 4NLKA 4Z6CA 3HX0A 2ZH2A 2ZH1A 1BPDA 1PX5A 4Z6FA 9ICXA 2ZH4A 4FHXA 1WOTA 4YMMA 3UQ0A 1ZQSA 4M9NA 4GXJA 4R65A 3HJ1A 4P4MA 2W9MA 9ICCA 3V72A 3PNCA 9ICNA 1ZQTA 4MFFA 4I2GA 1RZTA 4O9MA 5CB1A 4QZEA 1ZQIA 9ICQA 5DEDA 4EBJA 4TURA 2RFFA 5CA7A 4LZDA 4X5VA 4KLGA 7ICUA 4R66A 3UPQA 4KLHA 3K75D 4PPXA 5HRLA 1JQRA 3C66A 9ICTA 5DDMA 7ICPA 2ZH3A 1Q79A 4P4OA 1R8CA 9ICHA 3JPQA 5IIJA 5D49A 4X4SA 4WC4A 2BPFA 2BCSA 4UAZA 3RJEA 4I2JA 4WCWA 3L9DA 4KLTA 5HREA 1NOMA 3UQ2A 7ICMA 4M9LA 3HIYA 9ICWA 2PFQA 4ATBA 4EP7A 4XQ7A 4UBBA 4NKTA 9ICBA 8ICQA 4P2HA 5J0QA 3AQNA 4NLNA 1Q78A 1JMSA 5HRGA 4YN4A 3C5FA 5HR9A 5J2DA 4WC7A 4WC3A 3C2KA 9ICSA 4RQ3A 8ICOA 4FHPA 3AU6A 1ZQGA 5IIKA 3HW8A 4M9JA 4NLZA 5CHGA 3ISDA 2FMPA 3LQCB 4FH3A 2IHMA 4Z6EA 4X4QA 3JZ0A 1ZQCA 4X4TA 4UD4A 3OUYA 4RT3A 9ICGA 5CJ7A 4IQTA 5DDYA 3JYYA 2M2UA 1TVAA 4IQUA 3OUYB 4QZ8A 4RQ1A 5CP2A 1MIWA 2ZH9A 2ZHAA 1NO5A 2BCQA 3NYBA 3HWTA 4I2IA 5J0UA 2DR8A 4WC1A 4UBCA 7ICLA 2M2TA 4M0AA 3AQMA 4Z6DA 4AT9B 8ICRA 5J2BA 9ICUA 4M9HA 2FMQA 4KLLA 3WFQE 4X4RA 4X4VA 4F5NA 4E8FA 1ZQDA 4X4PA 7ICSA 1BPZA 3OVSA 1KNYA 3OV7A 1ZQXA 1ZQYA 7ICTA 7ICEA 9ICKA 4JWMA 4UB3A 4PGXA 4I2AA 2BPCA 4F5OA 5J0OA 2I9GA 4RT2A 4F5RA 4PGYA 4QZBA 4RQ5A 4RWPA 4UAYA 2HHPA 7ICJA 1ZQLA 7ICQA 5J2KA 4TUSA 1ZQRA 5TZVA 2ZH5A 4AT8A 2P66A 1ZQNA 1ZQPA 2GWSA 3MGHA 4RPZA 3RJKA 1RPLA 5HHHA 2M2WA 4GXIA 3H39A 3H3AA 8ICHA 4M04A 7ICNA 5D4BA 4MF2A 1R89A 4DOAA 4QZAA 4JWNA 5BOMA 3H38A 3C5GA 1BPYA 1ZQFA 8ICFA 1MQ3A 4RPYA 5DECA 3V7KA 1JAJA 3AQLA 4UB5A 4R63A 1ZQAA 9ICFA 1KEJA 2PXIA 3RH5A 1JN3A 1ZQQA 1MQ2A 4IG8A 4F5QA 2BE3A 4WC5A 5IIIA 4NKUA 5HRKA 3UPSA 5F2VO 1ZQOA 1ZQBA 4I29A 4KLJA 5D46A 4I2HA 3PMNA 4FHVA 2BPGA 4FHWA 4QZDA 4R64A 4ATBB 4UB1A 9ICRA 1UEUA 4X0BA 5DB7A 4UAWA 1ZQJA 7ICKA 4NXZA 3TFSA 4KLIA 4KLOA 4UB4A 2O1PA 4MFCA 3JPOA 2ISOA 4PHEA 4MFAA 4I2CA 5HRHA 4PHDA 7ICFA 3RJGA 3JPNA 4DOCA 4RQ4A 5HHIA 5J29A 2BCRA 1UETA 5DB9A 3B0XA 2ID1A 2ZHBA 1ZQWA 2VANA 3WFPA 5J0RA 3RJIA 3TFRA 3AUOA 4M9GA 4PH5A 4NM1A 4YMNA 4X4OA 9ICMA 1MIVA 9ICAA 4I2EA 1ZQVA 4AT7A 2ZH8A 2DRAA 8ICAA 1UEVA 4PGQA 3C18A 5IINA 5DB8A 1ZQZA 5BOLA 3JPSA 4WC6A 2DRBA 4LT6A 1MIYA 5IIMA 4RQ6A 1ZQMA 1ZQUA 3ISCA 4X0AA 4I2DA 4E80A 1ZQHA 3AU2A 7ICIA 1HUZA 8ICNA 8ICWA 4MF8A 4DOBA 3RJJA 4WBYA 2BCVA 7ICRA 3RJHA 8ICMA 4YCXA 4QZIA 5DKWA 1XSNA 4TUQA 4RWNA 3HJ4A 4M5DA 1KDHA 4XRHA 2BCUA 4YD1A 3GDXA 3UXPA 8ICTA 4QZCA 4UB2A 3V7JA 2DR7A 5J0YA 5J2FA 4O5KA 9ICJA 3OGUA 2PFPA 1BPEA 5DBBA 4I2FA 7ICHA 4RQ0A 2DR5A 4K4IA 1ZJMA 1R8AA 8ICVA 5DBCA 3MBYA 4O5EA 4KLEA 4KLUA 7ICVA 4X4NA 4RWOA 3RH4A 4UD5A 9ICOA 9ICVA 7ICOA 8ICUA 4YD2A 8ICIA 4QZGA 2ISPA 4WBZA 4I2BA 3AQKA 3LK9A 1OU5A 8ICSA 4AT8B 2O5AA 3WFSC 4KLDA 4NY8A 4KLMA 5DB6A 5IILA 4QZFA 5J2HA 4PHAA 4I28A 3UXNA 3PMLA 4LZGA 2ZH6A 3OVBA 3H37A 8ICXA 2ZH7A 5J2CA 4M2YA 3B0YA 4K4GA 1F5AA 5J2EA 4KLFA 8ICGA 1TFYA 4FHYA 8ICLA 5J2IA 2PFNA 3WFOA 5J0XA 4YMOA 2DR9A 1BPXA 4S3NA 5J0TA 4E7XA 1VJ7A 3JPTA 4XA5A 4QZ9A 3JPRA 3WFRE 4IQVA 1TV9A 1R8BA 4K4HA 4XUSA 1TFWA 5HRDA 2NRKA 8ICCA 5IIOA 3MGIA 1V4AA 8ICPA 2DVIA 5CR0A
chains in the Genus database with same CATH superfamily
5J2JA 2M2VA 4FO6A 5J0PA 4X4UA 3MDCA 4IQWA 4N7RA 3RH6A 4NXUA 5HRIA 4KLSA 4EBKA 4XQ8A 4DO9A 1FA0A 5CFUA 5J0SA 7ICGA 4LVSA 1HUOA 3MDAA 5EOZA 4WC0A 4RPXA 4FO1A 4K9AA 2GAFD 4P4PA 3V7LA 4MKPA 4QZHA 3UXOA 5J0WA 5BPCA 3C2MA 8ICKA 5CFTA 4AT7B 1XSPA 4GXKA 5J2AA 1YLQA 4KLQA 2PFOA 5HC9A 3ISBA 5HRFA 5DBAA 4O67A 9ICLA 4FH5A 4RWQA 2Q66A 4TUPA 8ICYA 4K8VA 9ICEA 5J2GA 1XSLA 3K7DA 9ICIA 4RQ7A 3CK6A 9ICPA 2FMSA 1VFGA 4WC2A 3OVAA 4NM2A 4O6AA 4RQ2A 8ICZA 1ZJNA 3C2LA 3RJFA 8ICJA 3JPPA 5CWRA 4F5PA 5HRBA 4WQKA 4O5CA 8ICEA 1ZQKA 2PBEA 4AT9A 4I27A 1BPBA 4M47A 2BBJA 4PHPA 2B4VA 8ICBA 4RQ8A 1ZQEA 3NWIA 4NLKA 4Z6CA 3HX0A 2ZH2A 4K96A 2ZH1A 1BPDA 1PX5A 4Z6FA 9ICXA 2ZH4A 4KM5A 4FHXA 1WOTA 4YMMA 4HX0A 3UQ0A 1ZQSA 4M9NA 4GXJA 4R65A 3HJ1A 4P4MA 2W9MA 4EV6A 9ICCA 3V72A 3PNCA 9ICNA 1ZQTA 4MFFA 4I2GA 2HN2A 1RZTA 4O9MA 5CB1A 4QZEA 1ZQIA 4OAIZ 9ICQA 5DEDA 4EBJA 4TURA 2RFFA 5CA7A 4LZDA 4X5VA 4KLGA 7ICUA 4R66A 3UPQA 4KLHA 1GPJA 3K75D 4PPXA 5HRLA 2HN1A 1JQRA 3C66A 9ICTA 5DDMA 7ICPA 2ZH3A 1Q79A 4P4OA 1R8CA 9ICHA 2FCLA 3JPQA 5IIJA 4I0UA 5D49A 4X4SA 4WC4A 2BPFA 2BCSA 4UAZA 3RJEA 4I2JA 4WCWA 3L9DA 2B51A 4KLTA 5HREA 1NOMA 3UQ2A 7ICMA 4M9LA 3HIYA 9ICWA 2PFQA 4ATBA 4EP7A 4XQ7A 4UBBA 4NKTA 9ICBA 3JCFA 8ICQA 5B3QA 4P2HA 4OAHA 5J0QA 3AQNA 4NLNA 1Q78A 1JMSA 5HRGA 4YN4A 3C5FA 5HR9A 5J2DA 4WC7A 4WC3A 4WOYA 3C2KA 4NXXA 9ICSA 4RQ3A 8ICOA 4FHPA 3EF2A 3AU6A 1ZQGA 5IIKA 3HW8A 4M9JA 4NLZA 5CHGA 3ISDA 2FMPA 3LQCB 4FH3A 2IHMA 4Z6EA 4X4QA 3JZ0A 4O68A 1ZQCA 4K99A 4K98A 4LEVA 4X4TA 4UD4A 3OUYA 4EEBA 4RT3A 9ICGA 5CJ7A 4IQTA 5DDYA 3JYYA 2M2UA 2EWRA 3MCRA 4LEWA 2IHOA 1TVAA 4IQUA 3OUYB 4QZ8A 4RQ1A 3PHZA 4LEYA 2GA9D 5CP2A 1MIWA 2ZH9A 2ZHAA 1NO5A 2BCQA 3NYBA 3HWTA 5D61A 4K97A 4I2IA 5J0UA 2DR8A 4WC1A 4UBCA 7ICLA 2M2TA 4M0AA 3AQMA 4Z6DA 4AT9B 8ICRA 5J2BA 9ICUA 4M9HA 2FMQA 4KLLA 3WFQE 4X4RA 4X4VA 4F5NA 4E8FA 1ZQDA 4X4PA 7ICSA 1BPZA 3OVSA 1KNYA 2B56A 3OV7A 1ZQXA 1ZQYA 7ICTA 7ICEA 4LEZA 9ICKA 4JWMA 4UB3A 4PGXA 4I2AA 2BPCA 4F5OA 5J0OA 2I9GA 4RT2A 4F5RA 4PGYA 4QZBA 4RQ5A 4RWPA 4UAYA 2HHPA 7ICJA 1ZQLA 7ICQA 5J2KA 4TUSA 1ZQRA 5TZVA 2ZH5A 4AT8A 2P66A 1ZQNA 1ZQPA 2GWSA 3MGHA 4RPZA 3RJKA 1RPLA 5HHHA 2M2WA 4GXIA 3H39A 3H3AA 8ICHA 4M04A 7ICNA 5D4BA 4MF2A 1R89A 4DOAA 4QZAA 4JWNA 5BOMA 3H38A 3C5GA 1BPYA 4NXWA 1ZQFA 8ICFA 4JLZA 1MQ3A 4RPYA 5DECA 4K9BA 3V7KA 1JAJA 3AQLA 4UB5A 5CFSA 4R63A 1ZQAA 9ICFA 1KEJA 2PXIA 3RH5A 1JN3A 1ZQQA 1MQ2A 3ER9B 4F5QA 4IG8A 2BE3A 4WC5A 5IIIA 4NKUA 5HRKA 3UPSA 5CHEA 5B3PA 5F2VO 1ZQOA 1ZQBA 4I29A 4KLJA 5D46A 4I2HA 3PMNA 4FHVA 2BPGA 4FHWA 4QZDA 4R64A 4ATBB 4UB1A 9ICRA 1UEUA 4X0BA 4OAFA 5DB7A 4UAWA 1ZQJA 7ICKA 4NXZA 3TFSA 5D62A 4KLIA 4KLOA 4UB4A 2O1PA 4MFCA 3JPOA 2ISOA 4PHEA 4MFAA 4I2CA 5HRHA 4PHDA 7ICFA 3RJGA 3JPNA 4DOCA 4RQ4A 5HHIA 5J29A 2BCRA 1UETA 5DB9A 3B0XA 2ID1A 2ZHBA 1ZQWA 2VANA 3WFPA 5J0RA 3RJIA 3TFRA 4XJEA 3AUOA 4M9GA 4KB6A 4PH5A 4NM1A 4YMNA 4X4OA 9ICMA 1MIVA 9ICAA 4I2EA 1ZQVA 4AT7A 2ZH8A 2DRAA 8ICAA 1UEVA 4PGQA 3C18A 5IINA 5DB8A 5D63A 1ZQZA 5BOLA 3JPSA 4WC6A 2DRBA 4LT6A 1MIYA 5IIMA 4RQ6A 1ZQMA 1ZQUA 3ISCA 4X0AA 4I2DA 4E80A 1ZQHA 3AU2A 4EGWA 7ICIA 1HUZA 8ICNA 8ICWA 4MF8A 4DOBA 3RJJA 4WBYA 2BCVA 7ICRA 3RJHA 4NXVA 8ICMA 4YCXA 5JTGA 4QZIA 5DKWA 1XSNA 4TUQA 4RWNA 3HJ4A 4M5DA 1KDHA 4XRHA 2BCUA 4YD1A 3GDXA 3UXPA 8ICTA 4QZCA 4UB2A 3V7JA 3OWGA 2DR7A 5J0YA 5J2FA 4O5KA 9ICJA 3OGUA 2PFPA 1BPEA 5DBBA 4I2FA 7ICHA 4RQ0A 2DR5A 4K4IA 1ZJMA 4WH5A 1R8AA 8ICVA 5DBCA 3MBYA 4O5EA 4KLEA 4KLUA 7ICVA 4X4NA 4RWOA 3RH4A 4O69A 4UD5A 4OAGA 9ICOA 9ICVA 7ICOA 8ICUA 4YD2A 8ICIA 4QZGA 2ISPA 4WBZA 4I2BA 3AQKA 3LK9A 1OU5A 8ICSA 4AT8B 2O5AA 3ER8C 3WFSC 4KLDA 4NY8A 4NXTA 4KLMA 5DB6A 5IILA 4QZFA 4EEDA 5J2HA 4PHAA 4I28A 3UXNA 3PMLA 4LZGA 2ZH6A 3OVBA 3H37A 8ICXA 2ZH7A 3NKUA 5J2CA 4M2YA 3B0YA 4K4GA 1F5AA 5J2EA 4KLFA 8ICGA 4WQLA 1TFYA 2IUBA 4FHYA 8ICLA 5J2IA 2PFNA 3WFOA 5J0XA 4YMOA 2DR9A 1BPXA 4S3NA 3ERCC 5J0TA 4E7XA 1VJ7A 3JPTA 4XA5A 4QZ9A 3JPRA 3WFRE 2BBHA 4IQVA 3NVOA 1TV9A 1R8BA 4K4HA 4XUSA 4JLXA 1TFWA 5HRDA 2NRKA 8ICCA 5IIOA 3MGIA 1V4AA 8ICPA 2DVIA 5CR0A
chains in the Genus database with same CATH topology
5J2JA 2M2VA 4FO6A 5J0PA 4X4UA 3MDCA 4IQWA 3RH6A 5HRIA 4KLSA 4EBKA 4XQ8A 4DO9A 1FA0A 5J0SA 7ICGA 4LVSA 1HUOA 3MDAA 5EOZA 4WC0A 4RPXA 4P4PA 3V7LA 4QZHA 3UXOA 5J0WA 5BPCA 3C2MA 8ICKA 4AT7B 1XSPA 4GXKA 5J2AA 1YLQA 4KLQA 2PFOA 5HC9A 3ISBA 5HRFA 5DBAA 9ICLA 4FH5A 4RWQA 2Q66A 4TUPA 8ICYA 9ICEA 5J2GA 1XSLA 9ICIA 4RQ7A 9ICPA 2FMSA 1VFGA 4WC2A 3OVAA 4NM2A 4RQ2A 8ICZA 1ZJNA 3C2LA 3RJFA 8ICJA 3JPPA 5CWRA 4F5PA 5HRBA 4O5CA 8ICEA 1ZQKA 2PBEA 4AT9A 4I27A 1BPBA 4M47A 4PHPA 8ICBA 4RQ8A 1ZQEA 4NLKA 4Z6CA 3HX0A 2ZH2A 2ZH1A 1BPDA 1PX5A 4Z6FA 9ICXA 2ZH4A 4FHXA 1WOTA 4YMMA 3UQ0A 1ZQSA 4M9NA 4GXJA 4R65A 3HJ1A 4P4MA 2W9MA 9ICCA 3V72A 3PNCA 9ICNA 1ZQTA 4MFFA 4I2GA 1RZTA 4O9MA 5CB1A 4QZEA 1ZQIA 9ICQA 5DEDA 4EBJA 4TURA 2RFFA 5CA7A 4LZDA 4X5VA 4KLGA 7ICUA 4R66A 3UPQA 4KLHA 3K75D 4PPXA 5HRLA 1JQRA 3C66A 9ICTA 5DDMA 7ICPA 2ZH3A 1Q79A 4P4OA 1R8CA 9ICHA 3JPQA 5IIJA 5D49A 4X4SA 4WC4A 2BPFA 2BCSA 4UAZA 3RJEA 4I2JA 4WCWA 3L9DA 4KLTA 5HREA 1NOMA 3UQ2A 7ICMA 4M9LA 3HIYA 9ICWA 2PFQA 4ATBA 4EP7A 4XQ7A 4UBBA 4NKTA 9ICBA 8ICQA 4P2HA 5J0QA 3AQNA 4NLNA 1Q78A 1JMSA 5HRGA 4YN4A 3C5FA 5HR9A 5J2DA 4WC7A 4WC3A 3C2KA 9ICSA 4RQ3A 8ICOA 4FHPA 3AU6A 1ZQGA 5IIKA 3HW8A 4M9JA 4NLZA 5CHGA 3ISDA 2FMPA 3LQCB 4FH3A 2IHMA 4Z6EA 4X4QA 3JZ0A 1ZQCA 4X4TA 4UD4A 3OUYA 4RT3A 9ICGA 5CJ7A 4IQTA 5DDYA 3JYYA 2M2UA 1TVAA 4IQUA 3OUYB 4QZ8A 4RQ1A 5CP2A 1MIWA 2ZH9A 2ZHAA 1NO5A 2BCQA 3NYBA 3HWTA 4I2IA 5J0UA 2DR8A 4WC1A 4UBCA 7ICLA 2M2TA 4M0AA 3AQMA 4Z6DA 4AT9B 8ICRA 5J2BA 9ICUA 4M9HA 2FMQA 4KLLA 3WFQE 4X4RA 4X4VA 4F5NA 4E8FA 1ZQDA 4X4PA 7ICSA 1BPZA 3OVSA 1KNYA 3OV7A 1ZQXA 1ZQYA 7ICTA 7ICEA 9ICKA 4JWMA 4UB3A 4PGXA 4I2AA 2BPCA 4F5OA 5J0OA 2I9GA 4RT2A 4F5RA 4PGYA 4QZBA 4RQ5A 4RWPA 4UAYA 2HHPA 7ICJA 1ZQLA 7ICQA 5J2KA 4TUSA 1ZQRA 5TZVA 2ZH5A 4AT8A 2P66A 1ZQNA 1ZQPA 2GWSA 3MGHA 4RPZA 3RJKA 1RPLA 5HHHA 2M2WA 4GXIA 3H39A 3H3AA 8ICHA 4M04A 7ICNA 5D4BA 4MF2A 1R89A 4DOAA 4QZAA 4JWNA 5BOMA 3H38A 3C5GA 1BPYA 1ZQFA 8ICFA 1MQ3A 4RPYA 5DECA 3V7KA 1JAJA 3AQLA 4UB5A 4R63A 1ZQAA 9ICFA 1KEJA 2PXIA 3RH5A 1JN3A 1ZQQA 1MQ2A 4IG8A 4F5QA 2BE3A 4WC5A 5IIIA 4NKUA 5HRKA 3UPSA 5F2VO 1ZQOA 1ZQBA 4I29A 4KLJA 5D46A 4I2HA 3PMNA 4FHVA 2BPGA 4FHWA 4QZDA 4R64A 4ATBB 4UB1A 9ICRA 1UEUA 4X0BA 5DB7A 4UAWA 1ZQJA 7ICKA 4NXZA 3TFSA 4KLIA 4KLOA 4UB4A 2O1PA 4MFCA 3JPOA 2ISOA 4PHEA 4MFAA 4I2CA 5HRHA 4PHDA 7ICFA 3RJGA 3JPNA 4DOCA 4RQ4A 5HHIA 5J29A 2BCRA 1UETA 5DB9A 3B0XA 2ID1A 2ZHBA 1ZQWA 2VANA 3WFPA 5J0RA 3RJIA 3TFRA 3AUOA 4M9GA 4PH5A 4NM1A 4YMNA 4X4OA 9ICMA 1MIVA 9ICAA 4I2EA 1ZQVA 4AT7A 2ZH8A 2DRAA 8ICAA 1UEVA 4PGQA 3C18A 5IINA 5DB8A 1ZQZA 5BOLA 3JPSA 4WC6A 2DRBA 4LT6A 1MIYA 5IIMA 4RQ6A 1ZQMA 1ZQUA 3ISCA 4X0AA 4I2DA 4E80A 1ZQHA 3AU2A 7ICIA 1HUZA 8ICNA 8ICWA 4MF8A 4DOBA 3RJJA 4WBYA 2BCVA 7ICRA 3RJHA 8ICMA 4YCXA 4QZIA 5DKWA 1XSNA 4TUQA 4RWNA 3HJ4A 4M5DA 1KDHA 4XRHA 2BCUA 4YD1A 3GDXA 3UXPA 8ICTA 4QZCA 4UB2A 3V7JA 2DR7A 5J0YA 5J2FA 4O5KA 9ICJA 3OGUA 2PFPA 1BPEA 5DBBA 4I2FA 7ICHA 4RQ0A 2DR5A 4K4IA 1ZJMA 1R8AA 8ICVA 5DBCA 3MBYA 4O5EA 4KLEA 4KLUA 7ICVA 4X4NA 4RWOA 3RH4A 4UD5A 9ICOA 9ICVA 7ICOA 8ICUA 4YD2A 8ICIA 4QZGA 2ISPA 4WBZA 4I2BA 3AQKA 3LK9A 1OU5A 8ICSA 4AT8B 2O5AA 3WFSC 4KLDA 4NY8A 4KLMA 5DB6A 5IILA 4QZFA 5J2HA 4PHAA 4I28A 3UXNA 3PMLA 4LZGA 2ZH6A 3OVBA 3H37A 8ICXA 2ZH7A 5J2CA 4M2YA 3B0YA 4K4GA 1F5AA 5J2EA 4KLFA 8ICGA 1TFYA 4FHYA 8ICLA 5J2IA 2PFNA 3WFOA 5J0XA 4YMOA 2DR9A 1BPXA 4S3NA 5J0TA 4E7XA 1VJ7A 3JPTA 4XA5A 4QZ9A 3JPRA 3WFRE 4IQVA 1TV9A 1R8BA 4K4HA 4XUSA 1TFWA 5HRDA 2NRKA 8ICCA 5IIOA 3MGIA 1V4AA 8ICPA 2DVIA 5CR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2J A;  2M2V A;  4FO6 A;  5J0P A;  4X4U A;  3MDC A;  4IQW A;  3RH6 A;  5HRI A;  4KLS A;  4EBK A;  4XQ8 A;  4DO9 A;  1FA0 A;  5J0S A;  7ICG A;  4LVS A;  1HUO A;  3MDA A;  5EOZ A;  4WC0 A;  4RPX A;  4P4P A;  3V7L A;  4QZH A;  3UXO A;  5J0W A;  5BPC A;  3C2M A;  8ICK A;  4AT7 B;  1XSP A;  4GXK A;  5J2A A;  1YLQ A;  4KLQ A;  2PFO A;  5HC9 A;  3ISB A;  5HRF A;  5DBA A;  9ICL A;  4FH5 A;  4RWQ A;  2Q66 A;  4TUP A;  8ICY A;  9ICE A;  5J2G A;  1XSL A;  9ICI A;  4RQ7 A;  9ICP A;  2FMS A;  1VFG A;  4WC2 A;  3OVA A;  4NM2 A;  4RQ2 A;  8ICZ A;  1ZJN A;  3C2L A;  3RJF A;  8ICJ A;  3JPP A;  5CWR A;  4F5P A;  5HRB A;  4O5C A;  8ICE A;  1ZQK A;  2PBE A;  4AT9 A;  4I27 A;  1BPB A;  4M47 A;  4PHP A;  8ICB A;  4RQ8 A;  1ZQE A;  4NLK A;  4Z6C A;  3HX0 A;  2ZH2 A;  2ZH1 A;  1BPD A;  1PX5 A;  4Z6F A;  9ICX A;  2ZH4 A;  4FHX A;  1WOT A;  4YMM A;  3UQ0 A;  1ZQS A;  4M9N A;  4GXJ A;  4R65 A;  3HJ1 A;  4P4M A;  2W9M A;  9ICC A;  3V72 A;  3PNC A;  9ICN A;  1ZQT A;  4MFF A;  4I2G A;  1RZT A;  4O9M A;  5CB1 A;  4QZE A;  1ZQI A;  9ICQ A;  5DED A;  4EBJ A;  4TUR A;  2RFF A;  5CA7 A;  4LZD A;  4X5V A;  4KLG A;  7ICU A;  4R66 A;  3UPQ A;  4KLH A;  3K75 D;  4PPX A;  5HRL A;  1JQR A;  3C66 A;  9ICT A;  5DDM A;  7ICP A;  2ZH3 A;  1Q79 A;  4P4O A;  1R8C A;  9ICH A;  3JPQ A;  5IIJ A;  5D49 A;  4X4S A;  4WC4 A;  2BPF A;  2BCS A;  4UAZ A;  3RJE A;  4I2J A;  4WCW A;  3L9D A;  4KLT A;  5HRE A;  1NOM A;  3UQ2 A;  7ICM A;  4M9L A;  3HIY A;  9ICW A;  2PFQ A;  4ATB A;  4EP7 A;  4XQ7 A;  4UBB A;  4NKT A;  9ICB A;  8ICQ A;  4P2H A;  5J0Q A;  3AQN A;  4NLN A;  1Q78 A;  1JMS A;  5HRG A;  4YN4 A;  3C5F A;  5HR9 A;  5J2D A;  4WC7 A;  4WC3 A;  3C2K A;  9ICS A;  4RQ3 A;  8ICO A;  4FHP A;  3AU6 A;  1ZQG A;  5IIK A;  3HW8 A;  4M9J A;  4NLZ A;  5CHG A;  3ISD A;  2FMP A;  3LQC B;  4FH3 A;  2IHM A;  4Z6E A;  4X4Q A;  3JZ0 A;  1ZQC A;  4X4T A;  4UD4 A;  3OUY A;  4RT3 A;  9ICG A;  5CJ7 A;  4IQT A;  5DDY A;  3JYY A;  2M2U A;  1TVA A;  4IQU A;  3OUY B;  4QZ8 A;  4RQ1 A;  5CP2 A;  1MIW A;  2ZH9 A;  2ZHA A;  1NO5 A;  2BCQ A;  3NYB A;  3HWT A;  4I2I A;  5J0U A;  2DR8 A;  4WC1 A;  4UBC A;  7ICL A;  2M2T A;  4M0A A;  3AQM A;  4Z6D A;  4AT9 B;  8ICR A;  5J2B A;  9ICU A;  4M9H A;  2FMQ A;  4KLL A;  3WFQ E;  4X4R A;  4X4V A;  4F5N A;  4E8F A;  1ZQD A;  4X4P A;  7ICS A;  1BPZ A;  3OVS A;  1KNY A;  3OV7 A;  1ZQX A;  1ZQY A;  7ICT A;  7ICE A;  9ICK A;  4JWM A;  4UB3 A;  4PGX A;  4I2A A;  2BPC A;  4F5O A;  5J0O A;  2I9G A;  4RT2 A;  4F5R A;  4PGY A;  4QZB A;  4RQ5 A;  4RWP A;  4UAY A;  2HHP A;  7ICJ A;  1ZQL A;  7ICQ A;  5J2K A;  4TUS A;  1ZQR A;  5TZV A;  2ZH5 A;  4AT8 A;  2P66 A;  1ZQN A;  1ZQP A;  2GWS A;  3MGH A;  4RPZ A;  3RJK A;  1RPL A;  5HHH A;  2M2W A;  4GXI A;  3H39 A;  3H3A A;  8ICH A;  4M04 A;  7ICN A;  5D4B A;  4MF2 A;  1R89 A;  4DOA A;  4QZA A;  4JWN A;  5BOM A;  3H38 A;  3C5G A;  1BPY A;  1ZQF A;  8ICF A;  1MQ3 A;  4RPY A;  5DEC A;  3V7K A;  1JAJ A;  3AQL A;  4UB5 A;  4R63 A;  1ZQA A;  9ICF A;  1KEJ A;  2PXI A;  3RH5 A;  1JN3 A;  1ZQQ A;  1MQ2 A;  4IG8 A;  4F5Q A;  2BE3 A;  4WC5 A;  5III A;  4NKU A;  5HRK A;  3UPS A;  5F2V O;  1ZQO A;  1ZQB A;  4I29 A;  4KLJ A;  5D46 A;  4I2H A;  3PMN A;  4FHV A;  2BPG A;  4FHW A;  4QZD A;  4R64 A;  4ATB B;  4UB1 A;  9ICR A;  1UEU A;  4X0B A;  5DB7 A;  4UAW A;  1ZQJ A;  7ICK A;  4NXZ A;  3TFS A;  4KLI A;  4KLO A;  4UB4 A;  2O1P A;  4MFC A;  3JPO A;  2ISO A;  4PHE A;  4MFA A;  4I2C A;  5HRH A;  4PHD A;  7ICF A;  3RJG A;  3JPN A;  4DOC A;  4RQ4 A;  5HHI A;  5J29 A;  2BCR A;  1UET A;  5DB9 A;  3B0X A;  2ID1 A;  2ZHB A;  1ZQW A;  2VAN A;  3WFP A;  5J0R A;  3RJI A;  3TFR A;  3AUO A;  4M9G A;  4PH5 A;  4NM1 A;  4YMN A;  4X4O A;  9ICM A;  1MIV A;  9ICA A;  4I2E A;  1ZQV A;  4AT7 A;  2ZH8 A;  2DRA A;  8ICA A;  1UEV A;  4PGQ A;  3C18 A;  5IIN A;  5DB8 A;  1ZQZ A;  5BOL A;  3JPS A;  4WC6 A;  2DRB A;  4LT6 A;  1MIY A;  5IIM A;  4RQ6 A;  1ZQM A;  1ZQU A;  3ISC A;  4X0A A;  4I2D A;  4E80 A;  1ZQH A;  3AU2 A;  7ICI A;  1HUZ A;  8ICN A;  8ICW A;  4MF8 A;  4DOB A;  3RJJ A;  4WBY A;  2BCV A;  7ICR A;  3RJH A;  8ICM A;  4YCX A;  4QZI A;  5DKW A;  1XSN A;  4TUQ A;  4RWN A;  3HJ4 A;  4M5D A;  1KDH A;  4XRH A;  2BCU A;  4YD1 A;  3GDX A;  3UXP A;  8ICT A;  4QZC A;  4UB2 A;  3V7J A;  2DR7 A;  5J0Y A;  5J2F A;  4O5K A;  9ICJ A;  3OGU A;  2PFP A;  1BPE A;  5DBB A;  4I2F A;  7ICH A;  4RQ0 A;  2DR5 A;  4K4I A;  1ZJM A;  1R8A A;  8ICV A;  5DBC A;  3MBY A;  4O5E A;  4KLE A;  4KLU A;  7ICV A;  4X4N A;  4RWO A;  3RH4 A;  4UD5 A;  9ICO A;  9ICV A;  7ICO A;  8ICU A;  4YD2 A;  8ICI A;  4QZG A;  2ISP A;  4WBZ A;  4I2B A;  3AQK A;  3LK9 A;  1OU5 A;  8ICS A;  4AT8 B;  2O5A A;  3WFS C;  4KLD A;  4NY8 A;  4KLM A;  5DB6 A;  5IIL A;  4QZF A;  5J2H A;  4PHA A;  4I28 A;  3UXN A;  3PML A;  4LZG A;  2ZH6 A;  3OVB A;  3H37 A;  8ICX A;  2ZH7 A;  5J2C A;  4M2Y A;  3B0Y A;  4K4G A;  1F5A A;  5J2E A;  4KLF A;  8ICG A;  1TFY A;  4FHY A;  8ICL A;  5J2I A;  2PFN A;  3WFO A;  5J0X A;  4YMO A;  2DR9 A;  1BPX A;  4S3N A;  5J0T A;  4E7X A;  1VJ7 A;  3JPT A;  4XA5 A;  4QZ9 A;  3JPR A;  3WFR E;  4IQV A;  1TV9 A;  1R8B A;  4K4H A;  4XUS A;  1TFW A;  5HRD A;  2NRK A;  8ICC A;  5IIO A;  3MGI A;  1V4A A;  8ICP A;  2DVI A;  5CR0 A; 
#chains in the Genus database with same CATH topology
 5J2J A;  2M2V A;  4FO6 A;  5J0P A;  4X4U A;  3MDC A;  4IQW A;  4N7R A;  3RH6 A;  4NXU A;  5HRI A;  4KLS A;  4EBK A;  4XQ8 A;  4DO9 A;  1FA0 A;  5CFU A;  5J0S A;  7ICG A;  4LVS A;  1HUO A;  3MDA A;  5EOZ A;  4WC0 A;  4RPX A;  4FO1 A;  4K9A A;  2GAF D;  4P4P A;  3V7L A;  4MKP A;  4QZH A;  3UXO A;  5J0W A;  5BPC A;  3C2M A;  8ICK A;  5CFT A;  4AT7 B;  1XSP A;  4GXK A;  5J2A A;  1YLQ A;  4KLQ A;  2PFO A;  5HC9 A;  3ISB A;  5HRF A;  5DBA A;  4O67 A;  9ICL A;  4FH5 A;  4RWQ A;  2Q66 A;  4TUP A;  8ICY A;  4K8V A;  9ICE A;  5J2G A;  1XSL A;  3K7D A;  9ICI A;  4RQ7 A;  3CK6 A;  9ICP A;  2FMS A;  1VFG A;  4WC2 A;  3OVA A;  4NM2 A;  4O6A A;  4RQ2 A;  8ICZ A;  1ZJN A;  3C2L A;  3RJF A;  8ICJ A;  3JPP A;  5CWR A;  4F5P A;  5HRB A;  4WQK A;  4O5C A;  8ICE A;  1ZQK A;  2PBE A;  4AT9 A;  4I27 A;  1BPB A;  4M47 A;  2BBJ A;  4PHP A;  2B4V A;  8ICB A;  4RQ8 A;  1ZQE A;  3NWI A;  4NLK A;  4Z6C A;  3HX0 A;  2ZH2 A;  4K96 A;  2ZH1 A;  1BPD A;  1PX5 A;  4Z6F A;  9ICX A;  2ZH4 A;  4KM5 A;  4FHX A;  1WOT A;  4YMM A;  4HX0 A;  3UQ0 A;  1ZQS A;  4M9N A;  4GXJ A;  4R65 A;  3HJ1 A;  4P4M A;  2W9M A;  4EV6 A;  9ICC A;  3V72 A;  3PNC A;  9ICN A;  1ZQT A;  4MFF A;  4I2G A;  2HN2 A;  1RZT A;  4O9M A;  5CB1 A;  4QZE A;  1ZQI A;  4OAI Z;  9ICQ A;  5DED A;  4EBJ A;  4TUR A;  2RFF A;  5CA7 A;  4LZD A;  4X5V A;  4KLG A;  7ICU A;  4R66 A;  3UPQ A;  4KLH A;  1GPJ A;  3K75 D;  4PPX A;  5HRL A;  2HN1 A;  1JQR A;  3C66 A;  9ICT A;  5DDM A;  7ICP A;  2ZH3 A;  1Q79 A;  4P4O A;  1R8C A;  9ICH A;  2FCL A;  3JPQ A;  5IIJ A;  4I0U A;  5D49 A;  4X4S A;  4WC4 A;  2BPF A;  2BCS A;  4UAZ A;  3RJE A;  4I2J A;  4WCW A;  3L9D A;  2B51 A;  4KLT A;  5HRE A;  1NOM A;  3UQ2 A;  7ICM A;  4M9L A;  3HIY A;  9ICW A;  2PFQ A;  4ATB A;  4EP7 A;  4XQ7 A;  4UBB A;  4NKT A;  9ICB A;  3JCF A;  8ICQ A;  5B3Q A;  4P2H A;  4OAH A;  5J0Q A;  3AQN A;  4NLN A;  1Q78 A;  1JMS A;  5HRG A;  4YN4 A;  3C5F A;  5HR9 A;  5J2D A;  4WC7 A;  4WC3 A;  4WOY A;  3C2K A;  4NXX A;  9ICS A;  4RQ3 A;  8ICO A;  4FHP A;  3EF2 A;  3AU6 A;  1ZQG A;  5IIK A;  3HW8 A;  4M9J A;  4NLZ A;  5CHG A;  3ISD A;  2FMP A;  3LQC B;  4FH3 A;  2IHM A;  4Z6E A;  4X4Q A;  3JZ0 A;  4O68 A;  1ZQC A;  4K99 A;  4K98 A;  4LEV A;  4X4T A;  4UD4 A;  3OUY A;  4EEB A;  4RT3 A;  9ICG A;  5CJ7 A;  4IQT A;  5DDY A;  3JYY A;  2M2U A;  2EWR A;  3MCR A;  4LEW A;  2IHO A;  1TVA A;  4IQU A;  3OUY B;  4QZ8 A;  4RQ1 A;  3PHZ A;  4LEY A;  2GA9 D;  5CP2 A;  1MIW A;  2ZH9 A;  2ZHA A;  1NO5 A;  2BCQ A;  3NYB A;  3HWT A;  5D61 A;  4K97 A;  4I2I A;  5J0U A;  2DR8 A;  4WC1 A;  4UBC A;  7ICL A;  2M2T A;  4M0A A;  3AQM A;  4Z6D A;  4AT9 B;  8ICR A;  5J2B A;  9ICU A;  4M9H A;  2FMQ A;  4KLL A;  3WFQ E;  4X4R A;  4X4V A;  4F5N A;  4E8F A;  1ZQD A;  4X4P A;  7ICS A;  1BPZ A;  3OVS A;  1KNY A;  2B56 A;  3OV7 A;  1ZQX A;  1ZQY A;  7ICT A;  7ICE A;  4LEZ A;  9ICK A;  4JWM A;  4UB3 A;  4PGX A;  4I2A A;  2BPC A;  4F5O A;  5J0O A;  2I9G A;  4RT2 A;  4F5R A;  4PGY A;  4QZB A;  4RQ5 A;  4RWP A;  4UAY A;  2HHP A;  7ICJ A;  1ZQL A;  7ICQ A;  5J2K A;  4TUS A;  1ZQR A;  5TZV A;  2ZH5 A;  4AT8 A;  2P66 A;  1ZQN A;  1ZQP A;  2GWS A;  3MGH A;  4RPZ A;  3RJK A;  1RPL A;  5HHH A;  2M2W A;  4GXI A;  3H39 A;  3H3A A;  8ICH A;  4M04 A;  7ICN A;  5D4B A;  4MF2 A;  1R89 A;  4DOA A;  4QZA A;  4JWN A;  5BOM A;  3H38 A;  3C5G A;  1BPY A;  4NXW A;  1ZQF A;  8ICF A;  4JLZ A;  1MQ3 A;  4RPY A;  5DEC A;  4K9B A;  3V7K A;  1JAJ A;  3AQL A;  4UB5 A;  5CFS A;  4R63 A;  1ZQA A;  9ICF A;  1KEJ A;  2PXI A;  3RH5 A;  1JN3 A;  1ZQQ A;  1MQ2 A;  3ER9 B;  4F5Q A;  4IG8 A;  2BE3 A;  4WC5 A;  5III A;  4NKU A;  5HRK A;  3UPS A;  5CHE A;  5B3P A;  5F2V O;  1ZQO A;  1ZQB A;  4I29 A;  4KLJ A;  5D46 A;  4I2H A;  3PMN A;  4FHV A;  2BPG A;  4FHW A;  4QZD A;  4R64 A;  4ATB B;  4UB1 A;  9ICR A;  1UEU A;  4X0B A;  4OAF A;  5DB7 A;  4UAW A;  1ZQJ A;  7ICK A;  4NXZ A;  3TFS A;  5D62 A;  4KLI A;  4KLO A;  4UB4 A;  2O1P A;  4MFC A;  3JPO A;  2ISO A;  4PHE A;  4MFA A;  4I2C A;  5HRH A;  4PHD A;  7ICF A;  3RJG A;  3JPN A;  4DOC A;  4RQ4 A;  5HHI A;  5J29 A;  2BCR A;  1UET A;  5DB9 A;  3B0X A;  2ID1 A;  2ZHB A;  1ZQW A;  2VAN A;  3WFP A;  5J0R A;  3RJI A;  3TFR A;  4XJE A;  3AUO A;  4M9G A;  4KB6 A;  4PH5 A;  4NM1 A;  4YMN A;  4X4O A;  9ICM A;  1MIV A;  9ICA A;  4I2E A;  1ZQV A;  4AT7 A;  2ZH8 A;  2DRA A;  8ICA A;  1UEV A;  4PGQ A;  3C18 A;  5IIN A;  5DB8 A;  5D63 A;  1ZQZ A;  5BOL A;  3JPS A;  4WC6 A;  2DRB A;  4LT6 A;  1MIY A;  5IIM A;  4RQ6 A;  1ZQM A;  1ZQU A;  3ISC A;  4X0A A;  4I2D A;  4E80 A;  1ZQH A;  3AU2 A;  4EGW A;  7ICI A;  1HUZ A;  8ICN A;  8ICW A;  4MF8 A;  4DOB A;  3RJJ A;  4WBY A;  2BCV A;  7ICR A;  3RJH A;  4NXV A;  8ICM A;  4YCX A;  5JTG A;  4QZI A;  5DKW A;  1XSN A;  4TUQ A;  4RWN A;  3HJ4 A;  4M5D A;  1KDH A;  4XRH A;  2BCU A;  4YD1 A;  3GDX A;  3UXP A;  8ICT A;  4QZC A;  4UB2 A;  3V7J A;  3OWG A;  2DR7 A;  5J0Y A;  5J2F A;  4O5K A;  9ICJ A;  3OGU A;  2PFP A;  1BPE A;  5DBB A;  4I2F A;  7ICH A;  4RQ0 A;  2DR5 A;  4K4I A;  1ZJM A;  4WH5 A;  1R8A A;  8ICV A;  5DBC A;  3MBY A;  4O5E A;  4KLE A;  4KLU A;  7ICV A;  4X4N A;  4RWO A;  3RH4 A;  4O69 A;  4UD5 A;  4OAG A;  9ICO A;  9ICV A;  7ICO A;  8ICU A;  4YD2 A;  8ICI A;  4QZG A;  2ISP A;  4WBZ A;  4I2B A;  3AQK A;  3LK9 A;  1OU5 A;  8ICS A;  4AT8 B;  2O5A A;  3ER8 C;  3WFS C;  4KLD A;  4NY8 A;  4NXT A;  4KLM A;  5DB6 A;  5IIL A;  4QZF A;  4EED A;  5J2H A;  4PHA A;  4I28 A;  3UXN A;  3PML A;  4LZG A;  2ZH6 A;  3OVB A;  3H37 A;  8ICX A;  2ZH7 A;  3NKU A;  5J2C A;  4M2Y A;  3B0Y A;  4K4G A;  1F5A A;  5J2E A;  4KLF A;  8ICG A;  4WQL A;  1TFY A;  2IUB A;  4FHY A;  8ICL A;  5J2I A;  2PFN A;  3WFO A;  5J0X A;  4YMO A;  2DR9 A;  1BPX A;  4S3N A;  3ERC C;  5J0T A;  4E7X A;  1VJ7 A;  3JPT A;  4XA5 A;  4QZ9 A;  3JPR A;  3WFR E;  2BBH A;  4IQV A;  3NVO A;  1TV9 A;  1R8B A;  4K4H A;  4XUS A;  4JLX A;  1TFW A;  5HRD A;  2NRK A;  8ICC A;  5IIO A;  3MGI A;  1V4A A;  8ICP A;  2DVI A;  5CR0 A; 
#chains in the Genus database with same CATH homology
 5J2J A;  2M2V A;  4FO6 A;  5J0P A;  4X4U A;  3MDC A;  4IQW A;  3RH6 A;  5HRI A;  4KLS A;  4EBK A;  4XQ8 A;  4DO9 A;  1FA0 A;  5J0S A;  7ICG A;  4LVS A;  1HUO A;  3MDA A;  5EOZ A;  4WC0 A;  4RPX A;  4P4P A;  3V7L A;  4QZH A;  3UXO A;  5J0W A;  5BPC A;  3C2M A;  8ICK A;  4AT7 B;  1XSP A;  4GXK A;  5J2A A;  1YLQ A;  4KLQ A;  2PFO A;  5HC9 A;  3ISB A;  5HRF A;  5DBA A;  9ICL A;  4FH5 A;  4RWQ A;  2Q66 A;  4TUP A;  8ICY A;  9ICE A;  5J2G A;  1XSL A;  9ICI A;  4RQ7 A;  9ICP A;  2FMS A;  1VFG A;  4WC2 A;  3OVA A;  4NM2 A;  4RQ2 A;  8ICZ A;  1ZJN A;  3C2L A;  3RJF A;  8ICJ A;  3JPP A;  5CWR A;  4F5P A;  5HRB A;  4O5C A;  8ICE A;  1ZQK A;  2PBE A;  4AT9 A;  4I27 A;  1BPB A;  4M47 A;  4PHP A;  8ICB A;  4RQ8 A;  1ZQE A;  4NLK A;  4Z6C A;  3HX0 A;  2ZH2 A;  2ZH1 A;  1BPD A;  1PX5 A;  4Z6F A;  9ICX A;  2ZH4 A;  4FHX A;  1WOT A;  4YMM A;  3UQ0 A;  1ZQS A;  4M9N A;  4GXJ A;  4R65 A;  3HJ1 A;  4P4M A;  2W9M A;  9ICC A;  3V72 A;  3PNC A;  9ICN A;  1ZQT A;  4MFF A;  4I2G A;  1RZT A;  4O9M A;  5CB1 A;  4QZE A;  1ZQI A;  9ICQ A;  5DED A;  4EBJ A;  4TUR A;  2RFF A;  5CA7 A;  4LZD A;  4X5V A;  4KLG A;  7ICU A;  4R66 A;  3UPQ A;  4KLH A;  3K75 D;  4PPX A;  5HRL A;  1JQR A;  3C66 A;  9ICT A;  5DDM A;  7ICP A;  2ZH3 A;  1Q79 A;  4P4O A;  1R8C A;  9ICH A;  3JPQ A;  5IIJ A;  5D49 A;  4X4S A;  4WC4 A;  2BPF A;  2BCS A;  4UAZ A;  3RJE A;  4I2J A;  4WCW A;  3L9D A;  4KLT A;  5HRE A;  1NOM A;  3UQ2 A;  7ICM A;  4M9L A;  3HIY A;  9ICW A;  2PFQ A;  4ATB A;  4EP7 A;  4XQ7 A;  4UBB A;  4NKT A;  9ICB A;  8ICQ A;  4P2H A;  5J0Q A;  3AQN A;  4NLN A;  1Q78 A;  1JMS A;  5HRG A;  4YN4 A;  3C5F A;  5HR9 A;  5J2D A;  4WC7 A;  4WC3 A;  3C2K A;  9ICS A;  4RQ3 A;  8ICO A;  4FHP A;  3AU6 A;  1ZQG A;  5IIK A;  3HW8 A;  4M9J A;  4NLZ A;  5CHG A;  3ISD A;  2FMP A;  3LQC B;  4FH3 A;  2IHM A;  4Z6E A;  4X4Q A;  3JZ0 A;  1ZQC A;  4X4T A;  4UD4 A;  3OUY A;  4RT3 A;  9ICG A;  5CJ7 A;  4IQT A;  5DDY A;  3JYY A;  2M2U A;  1TVA A;  4IQU A;  3OUY B;  4QZ8 A;  4RQ1 A;  5CP2 A;  1MIW A;  2ZH9 A;  2ZHA A;  1NO5 A;  2BCQ A;  3NYB A;  3HWT A;  4I2I A;  5J0U A;  2DR8 A;  4WC1 A;  4UBC A;  7ICL A;  2M2T A;  4M0A A;  3AQM A;  4Z6D A;  4AT9 B;  8ICR A;  5J2B A;  9ICU A;  4M9H A;  2FMQ A;  4KLL A;  3WFQ E;  4X4R A;  4X4V A;  4F5N A;  4E8F A;  1ZQD A;  4X4P A;  7ICS A;  1BPZ A;  3OVS A;  1KNY A;  3OV7 A;  1ZQX A;  1ZQY A;  7ICT A;  7ICE A;  9ICK A;  4JWM A;  4UB3 A;  4PGX A;  4I2A A;  2BPC A;  4F5O A;  5J0O A;  2I9G A;  4RT2 A;  4F5R A;  4PGY A;  4QZB A;  4RQ5 A;  4RWP A;  4UAY A;  2HHP A;  7ICJ A;  1ZQL A;  7ICQ A;  5J2K A;  4TUS A;  1ZQR A;  5TZV A;  2ZH5 A;  4AT8 A;  2P66 A;  1ZQN A;  1ZQP A;  2GWS A;  3MGH A;  4RPZ A;  3RJK A;  1RPL A;  5HHH A;  2M2W A;  4GXI A;  3H39 A;  3H3A A;  8ICH A;  4M04 A;  7ICN A;  5D4B A;  4MF2 A;  1R89 A;  4DOA A;  4QZA A;  4JWN A;  5BOM A;  3H38 A;  3C5G A;  1BPY A;  1ZQF A;  8ICF A;  1MQ3 A;  4RPY A;  5DEC A;  3V7K A;  1JAJ A;  3AQL A;  4UB5 A;  4R63 A;  1ZQA A;  9ICF A;  1KEJ A;  2PXI A;  3RH5 A;  1JN3 A;  1ZQQ A;  1MQ2 A;  4IG8 A;  4F5Q A;  2BE3 A;  4WC5 A;  5III A;  4NKU A;  5HRK A;  3UPS A;  5F2V O;  1ZQO A;  1ZQB A;  4I29 A;  4KLJ A;  5D46 A;  4I2H A;  3PMN A;  4FHV A;  2BPG A;  4FHW A;  4QZD A;  4R64 A;  4ATB B;  4UB1 A;  9ICR A;  1UEU A;  4X0B A;  5DB7 A;  4UAW A;  1ZQJ A;  7ICK A;  4NXZ A;  3TFS A;  4KLI A;  4KLO A;  4UB4 A;  2O1P A;  4MFC A;  3JPO A;  2ISO A;  4PHE A;  4MFA A;  4I2C A;  5HRH A;  4PHD A;  7ICF A;  3RJG A;  3JPN A;  4DOC A;  4RQ4 A;  5HHI A;  5J29 A;  2BCR A;  1UET A;  5DB9 A;  3B0X A;  2ID1 A;  2ZHB A;  1ZQW A;  2VAN A;  3WFP A;  5J0R A;  3RJI A;  3TFR A;  3AUO A;  4M9G A;  4PH5 A;  4NM1 A;  4YMN A;  4X4O A;  9ICM A;  1MIV A;  9ICA A;  4I2E A;  1ZQV A;  4AT7 A;  2ZH8 A;  2DRA A;  8ICA A;  1UEV A;  4PGQ A;  3C18 A;  5IIN A;  5DB8 A;  1ZQZ A;  5BOL A;  3JPS A;  4WC6 A;  2DRB A;  4LT6 A;  1MIY A;  5IIM A;  4RQ6 A;  1ZQM A;  1ZQU A;  3ISC A;  4X0A A;  4I2D A;  4E80 A;  1ZQH A;  3AU2 A;  7ICI A;  1HUZ A;  8ICN A;  8ICW A;  4MF8 A;  4DOB A;  3RJJ A;  4WBY A;  2BCV A;  7ICR A;  3RJH A;  8ICM A;  4YCX A;  4QZI A;  5DKW A;  1XSN A;  4TUQ A;  4RWN A;  3HJ4 A;  4M5D A;  1KDH A;  4XRH A;  2BCU A;  4YD1 A;  3GDX A;  3UXP A;  8ICT A;  4QZC A;  4UB2 A;  3V7J A;  2DR7 A;  5J0Y A;  5J2F A;  4O5K A;  9ICJ A;  3OGU A;  2PFP A;  1BPE A;  5DBB A;  4I2F A;  7ICH A;  4RQ0 A;  2DR5 A;  4K4I A;  1ZJM A;  1R8A A;  8ICV A;  5DBC A;  3MBY A;  4O5E A;  4KLE A;  4KLU A;  7ICV A;  4X4N A;  4RWO A;  3RH4 A;  4UD5 A;  9ICO A;  9ICV A;  7ICO A;  8ICU A;  4YD2 A;  8ICI A;  4QZG A;  2ISP A;  4WBZ A;  4I2B A;  3AQK A;  3LK9 A;  1OU5 A;  8ICS A;  4AT8 B;  2O5A A;  3WFS C;  4KLD A;  4NY8 A;  4KLM A;  5DB6 A;  5IIL A;  4QZF A;  5J2H A;  4PHA A;  4I28 A;  3UXN A;  3PML A;  4LZG A;  2ZH6 A;  3OVB A;  3H37 A;  8ICX A;  2ZH7 A;  5J2C A;  4M2Y A;  3B0Y A;  4K4G A;  1F5A A;  5J2E A;  4KLF A;  8ICG A;  1TFY A;  4FHY A;  8ICL A;  5J2I A;  2PFN A;  3WFO A;  5J0X A;  4YMO A;  2DR9 A;  1BPX A;  4S3N A;  5J0T A;  4E7X A;  1VJ7 A;  3JPT A;  4XA5 A;  4QZ9 A;  3JPR A;  3WFR E;  4IQV A;  1TV9 A;  1R8B A;  4K4H A;  4XUS A;  1TFW A;  5HRD A;  2NRK A;  8ICC A;  5IIO A;  3MGI A;  1V4A A;  8ICP A;  2DVI A;  5CR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...