5HRBA

The crystal structure of asfvpolx:dna1 binary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
176
Chain Sequence
GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 47
structure length 176
sequence length 176
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrbA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrbA01
4PHAA 4RT3A 4FHVA 4IQTA 8ICWA 4FHXA 4AT7A 1MQ3A 4UB2A 8ICMA 2NRKA 4MF8A 5J2FA 5D4BA 5J2BA 4XA5A 4WBZA 4PGXA 4R63A 9ICVA 5HRHA 2O1PA 1R8BA 8ICBA 4LT6A 4M0AA 4RQ6A 5J0SA 3RJHA 3OVAA 1MIVA 4UBCA 1XSLA 3TFRA 5DEDA 1RZTA 3RJKA 4FO6A 1VJ7A 2PFQA 4IQUA 3RH4A 4M9HA 4NM1A 4WC1A 3ISBA 3WFPA 5HRIA 5CJ7A 5IIKA 4AT8A 1ZQRA 3NYBA 4I2IA 4WCWA 3MDCA 4E7XA 4XRHA 2DRAA 9ICXA 2VANA 4FHPA 2O5AA 4RT2A 4NY8A 2PFPA 9ICPA 4O9MA 4UAWA 4XQ7A 9ICQA 4O5KA 8ICCA 4X4RA 4Z6DA 4DOAA 3V7LA 4YCXA 5IIMA 1JAJA 2ZH3A 4UB4A 3JZ0A 5IIIA 5CB1A 4LVSA 5J0YA 1UEUA 5IINA 2RFFA 4PPXA 8ICAA 3AUOA 2BCQA 3WFSC 4X4TA 3UXPA 4X4SA 4NLZA 5DB6A 4I2AA 1ZQCA 1FA0A 1ZJMA 1KNYA 5J2HA 3RJJA 8ICNA 4UB3A 3JPNA 9ICNA 4X4OA 4QZGA 3MGHA 4KLMA 1BPXA 2M2TA 4GXIA 2ZH7A 2I9GA 4P4PA 4QZAA 4UAYA 4TUSA 3H38A 4QZIA 4X4UA 2M2WA 7ICEA 5IILA 4KLOA 3C5GA 2PXIA 3C66A 7ICNA 3RJEA 8ICZA 5HHHA 5BOMA 3JPPA 4RQ4A 4E8FA 3H3AA 4X4QA 1KEJA 5J0RA 5J2DA 3JPOA 4NLNA 8ICSA 1NOMA 4RPYA 1BPYA 4WC6A 1ZQGA 1ZQJA 9ICJA 5DBCA 4NKTA 8ICJA 4GXJA 4M47A 2GWSA 5DBBA 3MBYA 4QZFA 8ICKA 4X4VA 4TURA 2ZHAA 2ZH1A 1HUOA 3C2MA 3HWTA 9ICKA 2W9MA 3JPRA 1ZQDA 4M04A 4F5NA 1MQ2A 9ICEA 8ICPA 7ICJA 1WOTA 4AT7B 4KLQA 4QZ8A 4TUQA 5CR0A 4EBJA 4F5OA 2ISOA 3HJ4A 5CHGA 4QZ9A 7ICLA 4AT9A 2DR5A 4KLIA 4YMOA 5CP2A 4NLKA 4RQ8A 4KLDA 4RPZA 2Q66A 4RQ7A 3UQ0A 9ICOA 1ZQIA 4QZHA 1Q78A 3AU2A 5TZVA 7ICOA 3C18A 4ATBA 4K4HA 3B0XA 4P2HA 5CA7A 2ZH9A 4P4OA 5HRBA 1JN3A 4RWOA 5J2EA 3MDAA 1ZQKA 4WC4A 3V72A 4PGYA 1JQRA 1R8AA 3AQMA 3RH5A 5DKWA 4X5VA 3ISCA 2DR9A 5BPCA 3OUYA 4AT8B 4I29A 1TV9A 8ICUA 4F5RA 4WC2A 3PNCA 4FH5A 3OUYB 5DECA 4PHEA 1BPZA 5D49A 1ZQUA 4M2YA 3V7JA 4GXKA 4KLJA 1BPEA 8ICTA 4IQWA 4LZGA 1ZQWA 1ZQBA 5HRFA 4XUSA 5HRGA 3WFOA 4WC5A 4QZEA 3PMNA 5F2VO 2PBEA 4RWPA 5HRDA 1ZQHA 4P4MA 2ISPA 2BPCA 5DB7A 1ZQFA 4DOBA 3RJGA 1TVAA 4KLEA 4FH3A 4YMMA 2FMQA 8ICFA 2BCSA 7ICPA 4UAZA 4QZDA 4I2DA 4S3NA 4MF2A 5BOLA 8ICVA 1NO5A 3WFQE 2ZH4A 4M9GA 2PFNA 4UD4A 2M2UA 4R64A 4KLGA 9ICIA 4I2EA 4Z6FA 5HREA 9ICHA 8ICXA 1R89A 5J2AA 3AQKA 4UB5A 5J0TA 5HR9A 3H39A 3AU6A 4RQ3A 1ZQXA 1ZQNA 4NXZA 4MFAA 3JYYA 3AQNA 2DR7A 2BPGA 4R65A 3H37A 1PX5A 8ICYA 2ZH2A 4YD2A 3JPQA 4QZCA 5IIOA 3RH6A 5HHIA 4YN4A 4FHYA 9ICWA 7ICSA 2BPFA 4KLLA 1ZQAA 4O5EA 4RQ5A 4I27A 1ZQYA 5CWRA 1RPLA 5J2IA 4TUPA 1ZQMA 4IG8A 8ICLA 1ZQQA 4KLSA 1ZQEA 5J0OA 4I2BA 3JPTA 2ZH6A 4KLTA 4RWQA 4M9NA 4YD1A 5J2CA 5DBAA 4K4IA 7ICQA 4UBBA 3GDXA 4QZBA 3C5FA 3B0YA 3HX0A 1F5AA 8ICEA 7ICMA 4RQ1A 1BPDA 4DOCA 2P66A 4DO9A 4O5CA 4NM2A 1ZQOA 4MFCA 4AT9B 1KDHA 2ZH5A 4IQVA 5HRLA 5DDMA 5J0XA 4XQ8A 1HUZA 3ISDA 8ICHA 4ATBB 2DRBA 3AQLA 4KLFA 4X4NA 1XSNA 2HHPA 4FHWA 1ZQVA 5J0UA 2DVIA 5EOZA 8ICGA 5J0QA 2BCUA 4Z6CA 7ICKA 3LQCB 4PHDA 9ICFA 3HJ1A 4MFFA 5J29A 4KLUA 1V4AA 7ICVA 1ZQPA 1UEVA 5DDYA 9ICTA 3K75D 2FMSA 1ZQLA 3PMLA 5J2JA 7ICRA 8ICRA 3C2LA 1R8CA 9ICGA 4I2CA 1MIYA 2PFOA 5DB8A 2ZH8A 5J2KA 4KLHA 9ICUA 9ICRA 2BE3A 7ICUA 3OV7A 3JPSA 4M5DA 5J2GA 4NKUA 3OVBA 4WC3A 7ICIA 1JMSA 3C2KA 4RPXA 4X0BA 7ICHA 4I28A 5IIJA 4RQ2A 4LZDA 2BCVA 4K4GA 4UB1A 3L9DA 1BPBA 4JWNA 9ICBA 9ICLA 1TFWA 3TFSA 5DB9A 7ICTA 3RJIA 2IHMA 3LK9A 4X0AA 4M9LA 1YLQA 4F5QA 3UQ2A 4R66A 4EBKA 4I2FA 2BCRA 2DR8A 3UXOA 4I2JA 1XSPA 8ICIA 4UD5A 4RQ0A 7ICGA 2FMPA 1Q79A 1ZQSA 4WC0A 9ICMA 9ICCA 1MIWA 4WBYA 4E80A 3OVSA 4PGQA 8ICOA 3MGIA 9ICAA 2ID1A 4I2GA 4RWNA 4F5PA 9ICSA 1ZQTA 4EP7A 4WC7A 5HC9A 5J0PA 7ICFA 3RJFA 4Z6EA 3WFRE 3UPQA 2ZHBA 3V7KA 1ZJNA 8ICQA 5J0WA 3HW8A 4JWMA 3UXNA 2M2VA 5HRKA 4I2HA 1ZQZA 3OGUA 3HIYA 4PH5A 1UETA 1VFGA 1TFYA 5D46A 4M9JA 1OU5A 3UPSA 4PHPA 4YMNA 4X4PA
chains in the Genus database with same CATH superfamily
4PHAA 4RT3A 4FHVA 4IQTA 8ICWA 2IHOA 3ER8C 4FHXA 4AT7A 1MQ3A 4UB2A 8ICMA 2NRKA 4MF8A 5J2FA 4K9AA 5D4BA 5J2BA 4XA5A 4WBZA 4PGXA 4R63A 9ICVA 5HRHA 3JCFA 2O1PA 1R8BA 8ICBA 4LT6A 4M0AA 4RQ6A 5CFSA 5J0SA 3RJHA 3OVAA 1MIVA 4UBCA 1XSLA 3TFRA 5DEDA 1RZTA 4XJEA 3RJKA 4FO6A 1VJ7A 2PFQA 4IQUA 3RH4A 4M9HA 4NM1A 4WC1A 3ISBA 3WFPA 5HRIA 5D61A 5CJ7A 5IIKA 4WH5A 4AT8A 1ZQRA 3NYBA 4I2IA 4WCWA 3MDCA 4E7XA 4XRHA 2DRAA 9ICXA 2VANA 4FHPA 2O5AA 4RT2A 4NY8A 4LEYA 2PFPA 9ICPA 4O9MA 4UAWA 4NXUA 4XQ7A 9ICQA 4O5KA 4K9BA 8ICCA 4X4RA 4Z6DA 4DOAA 3V7LA 4YCXA 5IIMA 1JAJA 2ZH3A 4UB4A 3JZ0A 5IIIA 5CB1A 4LVSA 5CHEA 5J0YA 1UEUA 5IINA 2RFFA 4PPXA 8ICAA 3AUOA 4N7RA 4K96A 3NVOA 2BCQA 3WFSC 4OAIZ 4X4TA 3UXPA 4X4SA 4NLZA 5DB6A 4I2AA 1ZQCA 1FA0A 1ZJMA 1KNYA 5J2HA 3RJJA 8ICNA 4UB3A 3JPNA 9ICNA 4X4OA 4QZGA 3MGHA 4KLMA 1BPXA 2M2TA 4GXIA 2ZH7A 2I9GA 4P4PA 2BBHA 4QZAA 4UAYA 4TUSA 3H38A 4QZIA 5D62A 4X4UA 2M2WA 7ICEA 5IILA 4KLOA 3C5GA 2PXIA 3C66A 7ICNA 4NXVA 3RJEA 8ICZA 5HHHA 5BOMA 3JPPA 5B3PA 4RQ4A 4E8FA 4WQLA 3H3AA 4X4QA 1KEJA 5J0RA 5J2DA 3JPOA 4NLNA 8ICSA 1NOMA 4RPYA 1BPYA 4WC6A 1ZQGA 1ZQJA 9ICJA 5DBCA 4NKTA 8ICJA 4GXJA 4M47A 2GWSA 3NKUA 5DBBA 3PHZA 3MBYA 4QZFA 8ICKA 4X4VA 4TURA 2ZHAA 2ZH1A 1HUOA 3C2MA 4WQKA 3HWTA 9ICKA 2W9MA 3JPRA 1ZQDA 4M04A 3MCRA 4F5NA 1MQ2A 9ICEA 8ICPA 7ICJA 1WOTA 4AT7B 4KLQA 4O67A 4QZ8A 4TUQA 5CR0A 4EBJA 4F5OA 2ISOA 3HJ4A 5CHGA 4QZ9A 7ICLA 4AT9A 2DR5A 4KLIA 4YMOA 5CP2A 4NLKA 4RQ8A 4KLDA 4RPZA 2Q66A 4RQ7A 3UQ0A 9ICOA 1ZQIA 4QZHA 1Q78A 3AU2A 5CFUA 3EF2A 5TZVA 7ICOA 3C18A 4ATBA 4K4HA 4K98A 3B0XA 4P2HA 5CA7A 2ZH9A 4P4OA 5HRBA 1JN3A 4RWOA 5J2EA 3MDAA 1ZQKA 4WC4A 3V72A 4PGYA 1JQRA 1R8AA 3AQMA 3RH5A 5DKWA 4X5VA 3ISCA 2DR9A 5BPCA 3OUYA 4AT8B 4I29A 1TV9A 8ICUA 3ERCC 4F5RA 4WC2A 3PNCA 4FH5A 3K7DA 3OUYB 5DECA 4PHEA 1BPZA 5D49A 1ZQUA 4M2YA 3V7JA 4GXKA 4KLJA 4K99A 1BPEA 8ICTA 4IQWA 4LZGA 1ZQWA 1ZQBA 5HRFA 4XUSA 3CK6A 5HRGA 3WFOA 4WC5A 4QZEA 3PMNA 5F2VO 2PBEA 4RWPA 2HN1A 5HRDA 1ZQHA 4P4MA 2ISPA 2BPCA 5DB7A 1ZQFA 4DOBA 2HN2A 4K97A 3RJGA 1TVAA 4KLEA 3NWIA 3ER9B 4EEDA 4FH3A 4YMMA 2FMQA 8ICFA 2BCSA 4NXWA 7ICPA 4UAZA 2FCLA 4QZDA 4I2DA 4S3NA 4NXTA 4FO1A 4MF2A 5BOLA 8ICVA 1NO5A 4OAFA 3WFQE 4EGWA 4I0UA 2ZH4A 4M9GA 2PFNA 4UD4A 2M2UA 5D63A 4R64A 4KLGA 9ICIA 4I2EA 4Z6FA 5HREA 9ICHA 8ICXA 1R89A 5J2AA 3AQKA 4UB5A 5J0TA 5HR9A 3H39A 3AU6A 4RQ3A 2B4VA 1ZQXA 1ZQNA 4NXZA 4MFAA 3JYYA 3AQNA 2DR7A 2BPGA 4KB6A 4R65A 3H37A 1PX5A 8ICYA 2ZH2A 4YD2A 3JPQA 4QZCA 5IIOA 3RH6A 5HHIA 4YN4A 4FHYA 9ICWA 7ICSA 2BPFA 4KLLA 1ZQAA 4O5EA 4RQ5A 4I27A 1ZQYA 5CWRA 4WOYA 1RPLA 5J2IA 4TUPA 1ZQMA 4IG8A 8ICLA 1ZQQA 4KLSA 1ZQEA 5J0OA 4I2BA 3JPTA 2ZH6A 5CFTA 2B56A 4KLTA 4RWQA 4M9NA 4LEZA 4YD1A 5J2CA 5DBAA 4K4IA 7ICQA 4UBBA 2GAFD 4LEWA 3GDXA 4KM5A 4QZBA 3C5FA 3B0YA 3HX0A 1F5AA 8ICEA 4LEVA 7ICMA 4RQ1A 1BPDA 4DOCA 2P66A 4DO9A 4O5CA 4NM2A 1ZQOA 4MFCA 4AT9B 1KDHA 2ZH5A 4IQVA 5HRLA 5DDMA 5J0XA 4XQ8A 1HUZA 4EEBA 3ISDA 8ICHA 4ATBB 2DRBA 3AQLA 4KLFA 4X4NA 1XSNA 2HHPA 4FHWA 5JTGA 1ZQVA 5J0UA 2DVIA 5EOZA 8ICGA 5J0QA 4K8VA 2BCUA 4Z6CA 7ICKA 3LQCB 4PHDA 4HX0A 9ICFA 3HJ1A 4MFFA 5J29A 4KLUA 1V4AA 4EV6A 7ICVA 2IUBA 1ZQPA 1UEVA 5DDYA 1GPJA 3OWGA 9ICTA 3K75D 2FMSA 1ZQLA 3PMLA 5J2JA 7ICRA 8ICRA 3C2LA 1R8CA 9ICGA 4I2CA 2BBJA 2EWRA 1MIYA 2PFOA 5DB8A 2ZH8A 5J2KA 4KLHA 9ICUA 9ICRA 2BE3A 7ICUA 3OV7A 3JPSA 4O68A 4M5DA 5J2GA 4O69A 4NKUA 3OVBA 4JLXA 4WC3A 7ICIA 1JMSA 3C2KA 4RPXA 4X0BA 7ICHA 4I28A 5IIJA 4RQ2A 4LZDA 4NXXA 4OAHA 2BCVA 4K4GA 4UB1A 4MKPA 3L9DA 1BPBA 4JWNA 9ICBA 9ICLA 4JLZA 1TFWA 3TFSA 5DB9A 7ICTA 4O6AA 3RJIA 2IHMA 3LK9A 4X0AA 4M9LA 1YLQA 4F5QA 3UQ2A 4R66A 4EBKA 4I2FA 2BCRA 2DR8A 3UXOA 4I2JA 1XSPA 8ICIA 4UD5A 4RQ0A 7ICGA 2FMPA 1Q79A 1ZQSA 4WC0A 9ICMA 9ICCA 1MIWA 4WBYA 4E80A 3OVSA 4PGQA 8ICOA 3MGIA 9ICAA 2ID1A 4I2GA 2GA9D 4RWNA 4F5PA 9ICSA 1ZQTA 4EP7A 4WC7A 5HC9A 5J0PA 7ICFA 3RJFA 4Z6EA 3WFRE 3UPQA 2ZHBA 3V7KA 1ZJNA 8ICQA 4OAGA 5B3QA 5J0WA 3HW8A 4JWMA 3UXNA 2M2VA 2B51A 5HRKA 4I2HA 1ZQZA 3OGUA 3HIYA 4PH5A 1UETA 1VFGA 1TFYA 5D46A 4M9JA 1OU5A 3UPSA 4PHPA 4YMNA 4X4PA
chains in the Genus database with same CATH topology
4PHAA 4RT3A 4FHVA 4IQTA 8ICWA 4FHXA 4AT7A 1MQ3A 4UB2A 8ICMA 2NRKA 4MF8A 5J2FA 5D4BA 5J2BA 4XA5A 4WBZA 4PGXA 4R63A 9ICVA 5HRHA 2O1PA 1R8BA 8ICBA 4LT6A 4M0AA 4RQ6A 5J0SA 3RJHA 3OVAA 1MIVA 4UBCA 1XSLA 3TFRA 5DEDA 1RZTA 3RJKA 4FO6A 1VJ7A 2PFQA 4IQUA 3RH4A 4M9HA 4NM1A 4WC1A 3ISBA 3WFPA 5HRIA 5CJ7A 5IIKA 4AT8A 1ZQRA 3NYBA 4I2IA 4WCWA 3MDCA 4E7XA 4XRHA 2DRAA 9ICXA 2VANA 4FHPA 2O5AA 4RT2A 4NY8A 2PFPA 9ICPA 4O9MA 4UAWA 4XQ7A 9ICQA 4O5KA 8ICCA 4X4RA 4Z6DA 4DOAA 3V7LA 4YCXA 5IIMA 1JAJA 2ZH3A 4UB4A 3JZ0A 5IIIA 5CB1A 4LVSA 5J0YA 1UEUA 5IINA 2RFFA 4PPXA 8ICAA 3AUOA 2BCQA 3WFSC 4X4TA 3UXPA 4X4SA 4NLZA 5DB6A 4I2AA 1ZQCA 1FA0A 1ZJMA 1KNYA 5J2HA 3RJJA 8ICNA 4UB3A 3JPNA 9ICNA 4X4OA 4QZGA 3MGHA 4KLMA 1BPXA 2M2TA 4GXIA 2ZH7A 2I9GA 4P4PA 4QZAA 4UAYA 4TUSA 3H38A 4QZIA 4X4UA 2M2WA 7ICEA 5IILA 4KLOA 3C5GA 2PXIA 3C66A 7ICNA 3RJEA 8ICZA 5HHHA 5BOMA 3JPPA 4RQ4A 4E8FA 3H3AA 4X4QA 1KEJA 5J0RA 5J2DA 3JPOA 4NLNA 8ICSA 1NOMA 4RPYA 1BPYA 4WC6A 1ZQGA 1ZQJA 9ICJA 5DBCA 4NKTA 8ICJA 4GXJA 4M47A 2GWSA 5DBBA 3MBYA 4QZFA 8ICKA 4X4VA 4TURA 2ZHAA 2ZH1A 1HUOA 3C2MA 3HWTA 9ICKA 2W9MA 3JPRA 1ZQDA 4M04A 4F5NA 1MQ2A 9ICEA 8ICPA 7ICJA 1WOTA 4AT7B 4KLQA 4QZ8A 4TUQA 5CR0A 4EBJA 4F5OA 2ISOA 3HJ4A 5CHGA 4QZ9A 7ICLA 4AT9A 2DR5A 4KLIA 4YMOA 5CP2A 4NLKA 4RQ8A 4KLDA 4RPZA 2Q66A 4RQ7A 3UQ0A 9ICOA 1ZQIA 4QZHA 1Q78A 3AU2A 5TZVA 7ICOA 3C18A 4ATBA 4K4HA 3B0XA 4P2HA 5CA7A 2ZH9A 4P4OA 5HRBA 1JN3A 4RWOA 5J2EA 3MDAA 1ZQKA 4WC4A 3V72A 4PGYA 1JQRA 1R8AA 3AQMA 3RH5A 5DKWA 4X5VA 3ISCA 2DR9A 5BPCA 3OUYA 4AT8B 4I29A 1TV9A 8ICUA 4F5RA 4WC2A 3PNCA 4FH5A 3OUYB 5DECA 4PHEA 1BPZA 5D49A 1ZQUA 4M2YA 3V7JA 4GXKA 4KLJA 1BPEA 8ICTA 4IQWA 4LZGA 1ZQWA 1ZQBA 5HRFA 4XUSA 5HRGA 3WFOA 4WC5A 4QZEA 3PMNA 5F2VO 2PBEA 4RWPA 5HRDA 1ZQHA 4P4MA 2ISPA 2BPCA 5DB7A 1ZQFA 4DOBA 3RJGA 1TVAA 4KLEA 4FH3A 4YMMA 2FMQA 8ICFA 2BCSA 7ICPA 4UAZA 4QZDA 4I2DA 4S3NA 4MF2A 5BOLA 8ICVA 1NO5A 3WFQE 2ZH4A 4M9GA 2PFNA 4UD4A 2M2UA 4R64A 4KLGA 9ICIA 4I2EA 4Z6FA 5HREA 9ICHA 8ICXA 1R89A 5J2AA 3AQKA 4UB5A 5J0TA 5HR9A 3H39A 3AU6A 4RQ3A 1ZQXA 1ZQNA 4NXZA 4MFAA 3JYYA 3AQNA 2DR7A 2BPGA 4R65A 3H37A 1PX5A 8ICYA 2ZH2A 4YD2A 3JPQA 4QZCA 5IIOA 3RH6A 5HHIA 4YN4A 4FHYA 9ICWA 7ICSA 2BPFA 4KLLA 1ZQAA 4O5EA 4RQ5A 4I27A 1ZQYA 5CWRA 1RPLA 5J2IA 4TUPA 1ZQMA 4IG8A 8ICLA 1ZQQA 4KLSA 1ZQEA 5J0OA 4I2BA 3JPTA 2ZH6A 4KLTA 4RWQA 4M9NA 4YD1A 5J2CA 5DBAA 4K4IA 7ICQA 4UBBA 3GDXA 4QZBA 3C5FA 3B0YA 3HX0A 1F5AA 8ICEA 7ICMA 4RQ1A 1BPDA 4DOCA 2P66A 4DO9A 4O5CA 4NM2A 1ZQOA 4MFCA 4AT9B 1KDHA 2ZH5A 4IQVA 5HRLA 5DDMA 5J0XA 4XQ8A 1HUZA 3ISDA 8ICHA 4ATBB 2DRBA 3AQLA 4KLFA 4X4NA 1XSNA 2HHPA 4FHWA 1ZQVA 5J0UA 2DVIA 5EOZA 8ICGA 5J0QA 2BCUA 4Z6CA 7ICKA 3LQCB 4PHDA 9ICFA 3HJ1A 4MFFA 5J29A 4KLUA 1V4AA 7ICVA 1ZQPA 1UEVA 5DDYA 9ICTA 3K75D 2FMSA 1ZQLA 3PMLA 5J2JA 7ICRA 8ICRA 3C2LA 1R8CA 9ICGA 4I2CA 1MIYA 2PFOA 5DB8A 2ZH8A 5J2KA 4KLHA 9ICUA 9ICRA 2BE3A 7ICUA 3OV7A 3JPSA 4M5DA 5J2GA 4NKUA 3OVBA 4WC3A 7ICIA 1JMSA 3C2KA 4RPXA 4X0BA 7ICHA 4I28A 5IIJA 4RQ2A 4LZDA 2BCVA 4K4GA 4UB1A 3L9DA 1BPBA 4JWNA 9ICBA 9ICLA 1TFWA 3TFSA 5DB9A 7ICTA 3RJIA 2IHMA 3LK9A 4X0AA 4M9LA 1YLQA 4F5QA 3UQ2A 4R66A 4EBKA 4I2FA 2BCRA 2DR8A 3UXOA 4I2JA 1XSPA 8ICIA 4UD5A 4RQ0A 7ICGA 2FMPA 1Q79A 1ZQSA 4WC0A 9ICMA 9ICCA 1MIWA 4WBYA 4E80A 3OVSA 4PGQA 8ICOA 3MGIA 9ICAA 2ID1A 4I2GA 4RWNA 4F5PA 9ICSA 1ZQTA 4EP7A 4WC7A 5HC9A 5J0PA 7ICFA 3RJFA 4Z6EA 3WFRE 3UPQA 2ZHBA 3V7KA 1ZJNA 8ICQA 5J0WA 3HW8A 4JWMA 3UXNA 2M2VA 5HRKA 4I2HA 1ZQZA 3OGUA 3HIYA 4PH5A 1UETA 1VFGA 1TFYA 5D46A 4M9JA 1OU5A 3UPSA 4PHPA 4YMNA 4X4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHA A;  4RT3 A;  4FHV A;  4IQT A;  8ICW A;  4FHX A;  4AT7 A;  1MQ3 A;  4UB2 A;  8ICM A;  2NRK A;  4MF8 A;  5J2F A;  5D4B A;  5J2B A;  4XA5 A;  4WBZ A;  4PGX A;  4R63 A;  9ICV A;  5HRH A;  2O1P A;  1R8B A;  8ICB A;  4LT6 A;  4M0A A;  4RQ6 A;  5J0S A;  3RJH A;  3OVA A;  1MIV A;  4UBC A;  1XSL A;  3TFR A;  5DED A;  1RZT A;  3RJK A;  4FO6 A;  1VJ7 A;  2PFQ A;  4IQU A;  3RH4 A;  4M9H A;  4NM1 A;  4WC1 A;  3ISB A;  3WFP A;  5HRI A;  5CJ7 A;  5IIK A;  4AT8 A;  1ZQR A;  3NYB A;  4I2I A;  4WCW A;  3MDC A;  4E7X A;  4XRH A;  2DRA A;  9ICX A;  2VAN A;  4FHP A;  2O5A A;  4RT2 A;  4NY8 A;  2PFP A;  9ICP A;  4O9M A;  4UAW A;  4XQ7 A;  9ICQ A;  4O5K A;  8ICC A;  4X4R A;  4Z6D A;  4DOA A;  3V7L A;  4YCX A;  5IIM A;  1JAJ A;  2ZH3 A;  4UB4 A;  3JZ0 A;  5III A;  5CB1 A;  4LVS A;  5J0Y A;  1UEU A;  5IIN A;  2RFF A;  4PPX A;  8ICA A;  3AUO A;  2BCQ A;  3WFS C;  4X4T A;  3UXP A;  4X4S A;  4NLZ A;  5DB6 A;  4I2A A;  1ZQC A;  1FA0 A;  1ZJM A;  1KNY A;  5J2H A;  3RJJ A;  8ICN A;  4UB3 A;  3JPN A;  9ICN A;  4X4O A;  4QZG A;  3MGH A;  4KLM A;  1BPX A;  2M2T A;  4GXI A;  2ZH7 A;  2I9G A;  4P4P A;  4QZA A;  4UAY A;  4TUS A;  3H38 A;  4QZI A;  4X4U A;  2M2W A;  7ICE A;  5IIL A;  4KLO A;  3C5G A;  2PXI A;  3C66 A;  7ICN A;  3RJE A;  8ICZ A;  5HHH A;  5BOM A;  3JPP A;  4RQ4 A;  4E8F A;  3H3A A;  4X4Q A;  1KEJ A;  5J0R A;  5J2D A;  3JPO A;  4NLN A;  8ICS A;  1NOM A;  4RPY A;  1BPY A;  4WC6 A;  1ZQG A;  1ZQJ A;  9ICJ A;  5DBC A;  4NKT A;  8ICJ A;  4GXJ A;  4M47 A;  2GWS A;  5DBB A;  3MBY A;  4QZF A;  8ICK A;  4X4V A;  4TUR A;  2ZHA A;  2ZH1 A;  1HUO A;  3C2M A;  3HWT A;  9ICK A;  2W9M A;  3JPR A;  1ZQD A;  4M04 A;  4F5N A;  1MQ2 A;  9ICE A;  8ICP A;  7ICJ A;  1WOT A;  4AT7 B;  4KLQ A;  4QZ8 A;  4TUQ A;  5CR0 A;  4EBJ A;  4F5O A;  2ISO A;  3HJ4 A;  5CHG A;  4QZ9 A;  7ICL A;  4AT9 A;  2DR5 A;  4KLI A;  4YMO A;  5CP2 A;  4NLK A;  4RQ8 A;  4KLD A;  4RPZ A;  2Q66 A;  4RQ7 A;  3UQ0 A;  9ICO A;  1ZQI A;  4QZH A;  1Q78 A;  3AU2 A;  5TZV A;  7ICO A;  3C18 A;  4ATB A;  4K4H A;  3B0X A;  4P2H A;  5CA7 A;  2ZH9 A;  4P4O A;  5HRB A;  1JN3 A;  4RWO A;  5J2E A;  3MDA A;  1ZQK A;  4WC4 A;  3V72 A;  4PGY A;  1JQR A;  1R8A A;  3AQM A;  3RH5 A;  5DKW A;  4X5V A;  3ISC A;  2DR9 A;  5BPC A;  3OUY A;  4AT8 B;  4I29 A;  1TV9 A;  8ICU A;  4F5R A;  4WC2 A;  3PNC A;  4FH5 A;  3OUY B;  5DEC A;  4PHE A;  1BPZ A;  5D49 A;  1ZQU A;  4M2Y A;  3V7J A;  4GXK A;  4KLJ A;  1BPE A;  8ICT A;  4IQW A;  4LZG A;  1ZQW A;  1ZQB A;  5HRF A;  4XUS A;  5HRG A;  3WFO A;  4WC5 A;  4QZE A;  3PMN A;  5F2V O;  2PBE A;  4RWP A;  5HRD A;  1ZQH A;  4P4M A;  2ISP A;  2BPC A;  5DB7 A;  1ZQF A;  4DOB A;  3RJG A;  1TVA A;  4KLE A;  4FH3 A;  4YMM A;  2FMQ A;  8ICF A;  2BCS A;  7ICP A;  4UAZ A;  4QZD A;  4I2D A;  4S3N A;  4MF2 A;  5BOL A;  8ICV A;  1NO5 A;  3WFQ E;  2ZH4 A;  4M9G A;  2PFN A;  4UD4 A;  2M2U A;  4R64 A;  4KLG A;  9ICI A;  4I2E A;  4Z6F A;  5HRE A;  9ICH A;  8ICX A;  1R89 A;  5J2A A;  3AQK A;  4UB5 A;  5J0T A;  5HR9 A;  3H39 A;  3AU6 A;  4RQ3 A;  1ZQX A;  1ZQN A;  4NXZ A;  4MFA A;  3JYY A;  3AQN A;  2DR7 A;  2BPG A;  4R65 A;  3H37 A;  1PX5 A;  8ICY A;  2ZH2 A;  4YD2 A;  3JPQ A;  4QZC A;  5IIO A;  3RH6 A;  5HHI A;  4YN4 A;  4FHY A;  9ICW A;  7ICS A;  2BPF A;  4KLL A;  1ZQA A;  4O5E A;  4RQ5 A;  4I27 A;  1ZQY A;  5CWR A;  1RPL A;  5J2I A;  4TUP A;  1ZQM A;  4IG8 A;  8ICL A;  1ZQQ A;  4KLS A;  1ZQE A;  5J0O A;  4I2B A;  3JPT A;  2ZH6 A;  4KLT A;  4RWQ A;  4M9N A;  4YD1 A;  5J2C A;  5DBA A;  4K4I A;  7ICQ A;  4UBB A;  3GDX A;  4QZB A;  3C5F A;  3B0Y A;  3HX0 A;  1F5A A;  8ICE A;  7ICM A;  4RQ1 A;  1BPD A;  4DOC A;  2P66 A;  4DO9 A;  4O5C A;  4NM2 A;  1ZQO A;  4MFC A;  4AT9 B;  1KDH A;  2ZH5 A;  4IQV A;  5HRL A;  5DDM A;  5J0X A;  4XQ8 A;  1HUZ A;  3ISD A;  8ICH A;  4ATB B;  2DRB A;  3AQL A;  4KLF A;  4X4N A;  1XSN A;  2HHP A;  4FHW A;  1ZQV A;  5J0U A;  2DVI A;  5EOZ A;  8ICG A;  5J0Q A;  2BCU A;  4Z6C A;  7ICK A;  3LQC B;  4PHD A;  9ICF A;  3HJ1 A;  4MFF A;  5J29 A;  4KLU A;  1V4A A;  7ICV A;  1ZQP A;  1UEV A;  5DDY A;  9ICT A;  3K75 D;  2FMS A;  1ZQL A;  3PML A;  5J2J A;  7ICR A;  8ICR A;  3C2L A;  1R8C A;  9ICG A;  4I2C A;  1MIY A;  2PFO A;  5DB8 A;  2ZH8 A;  5J2K A;  4KLH A;  9ICU A;  9ICR A;  2BE3 A;  7ICU A;  3OV7 A;  3JPS A;  4M5D A;  5J2G A;  4NKU A;  3OVB A;  4WC3 A;  7ICI A;  1JMS A;  3C2K A;  4RPX A;  4X0B A;  7ICH A;  4I28 A;  5IIJ A;  4RQ2 A;  4LZD A;  2BCV A;  4K4G A;  4UB1 A;  3L9D A;  1BPB A;  4JWN A;  9ICB A;  9ICL A;  1TFW A;  3TFS A;  5DB9 A;  7ICT A;  3RJI A;  2IHM A;  3LK9 A;  4X0A A;  4M9L A;  1YLQ A;  4F5Q A;  3UQ2 A;  4R66 A;  4EBK A;  4I2F A;  2BCR A;  2DR8 A;  3UXO A;  4I2J A;  1XSP A;  8ICI A;  4UD5 A;  4RQ0 A;  7ICG A;  2FMP A;  1Q79 A;  1ZQS A;  4WC0 A;  9ICM A;  9ICC A;  1MIW A;  4WBY A;  4E80 A;  3OVS A;  4PGQ A;  8ICO A;  3MGI A;  9ICA A;  2ID1 A;  4I2G A;  4RWN A;  4F5P A;  9ICS A;  1ZQT A;  4EP7 A;  4WC7 A;  5HC9 A;  5J0P A;  7ICF A;  3RJF A;  4Z6E A;  3WFR E;  3UPQ A;  2ZHB A;  3V7K A;  1ZJN A;  8ICQ A;  5J0W A;  3HW8 A;  4JWM A;  3UXN A;  2M2V A;  5HRK A;  4I2H A;  1ZQZ A;  3OGU A;  3HIY A;  4PH5 A;  1UET A;  1VFG A;  1TFY A;  5D46 A;  4M9J A;  1OU5 A;  3UPS A;  4PHP A;  4YMN A;  4X4P A; 
#chains in the Genus database with same CATH topology
 4PHA A;  4RT3 A;  4FHV A;  4IQT A;  8ICW A;  2IHO A;  3ER8 C;  4FHX A;  4AT7 A;  1MQ3 A;  4UB2 A;  8ICM A;  2NRK A;  4MF8 A;  5J2F A;  4K9A A;  5D4B A;  5J2B A;  4XA5 A;  4WBZ A;  4PGX A;  4R63 A;  9ICV A;  5HRH A;  3JCF A;  2O1P A;  1R8B A;  8ICB A;  4LT6 A;  4M0A A;  4RQ6 A;  5CFS A;  5J0S A;  3RJH A;  3OVA A;  1MIV A;  4UBC A;  1XSL A;  3TFR A;  5DED A;  1RZT A;  4XJE A;  3RJK A;  4FO6 A;  1VJ7 A;  2PFQ A;  4IQU A;  3RH4 A;  4M9H A;  4NM1 A;  4WC1 A;  3ISB A;  3WFP A;  5HRI A;  5D61 A;  5CJ7 A;  5IIK A;  4WH5 A;  4AT8 A;  1ZQR A;  3NYB A;  4I2I A;  4WCW A;  3MDC A;  4E7X A;  4XRH A;  2DRA A;  9ICX A;  2VAN A;  4FHP A;  2O5A A;  4RT2 A;  4NY8 A;  4LEY A;  2PFP A;  9ICP A;  4O9M A;  4UAW A;  4NXU A;  4XQ7 A;  9ICQ A;  4O5K A;  4K9B A;  8ICC A;  4X4R A;  4Z6D A;  4DOA A;  3V7L A;  4YCX A;  5IIM A;  1JAJ A;  2ZH3 A;  4UB4 A;  3JZ0 A;  5III A;  5CB1 A;  4LVS A;  5CHE A;  5J0Y A;  1UEU A;  5IIN A;  2RFF A;  4PPX A;  8ICA A;  3AUO A;  4N7R A;  4K96 A;  3NVO A;  2BCQ A;  3WFS C;  4OAI Z;  4X4T A;  3UXP A;  4X4S A;  4NLZ A;  5DB6 A;  4I2A A;  1ZQC A;  1FA0 A;  1ZJM A;  1KNY A;  5J2H A;  3RJJ A;  8ICN A;  4UB3 A;  3JPN A;  9ICN A;  4X4O A;  4QZG A;  3MGH A;  4KLM A;  1BPX A;  2M2T A;  4GXI A;  2ZH7 A;  2I9G A;  4P4P A;  2BBH A;  4QZA A;  4UAY A;  4TUS A;  3H38 A;  4QZI A;  5D62 A;  4X4U A;  2M2W A;  7ICE A;  5IIL A;  4KLO A;  3C5G A;  2PXI A;  3C66 A;  7ICN A;  4NXV A;  3RJE A;  8ICZ A;  5HHH A;  5BOM A;  3JPP A;  5B3P A;  4RQ4 A;  4E8F A;  4WQL A;  3H3A A;  4X4Q A;  1KEJ A;  5J0R A;  5J2D A;  3JPO A;  4NLN A;  8ICS A;  1NOM A;  4RPY A;  1BPY A;  4WC6 A;  1ZQG A;  1ZQJ A;  9ICJ A;  5DBC A;  4NKT A;  8ICJ A;  4GXJ A;  4M47 A;  2GWS A;  3NKU A;  5DBB A;  3PHZ A;  3MBY A;  4QZF A;  8ICK A;  4X4V A;  4TUR A;  2ZHA A;  2ZH1 A;  1HUO A;  3C2M A;  4WQK A;  3HWT A;  9ICK A;  2W9M A;  3JPR A;  1ZQD A;  4M04 A;  3MCR A;  4F5N A;  1MQ2 A;  9ICE A;  8ICP A;  7ICJ A;  1WOT A;  4AT7 B;  4KLQ A;  4O67 A;  4QZ8 A;  4TUQ A;  5CR0 A;  4EBJ A;  4F5O A;  2ISO A;  3HJ4 A;  5CHG A;  4QZ9 A;  7ICL A;  4AT9 A;  2DR5 A;  4KLI A;  4YMO A;  5CP2 A;  4NLK A;  4RQ8 A;  4KLD A;  4RPZ A;  2Q66 A;  4RQ7 A;  3UQ0 A;  9ICO A;  1ZQI A;  4QZH A;  1Q78 A;  3AU2 A;  5CFU A;  3EF2 A;  5TZV A;  7ICO A;  3C18 A;  4ATB A;  4K4H A;  4K98 A;  3B0X A;  4P2H A;  5CA7 A;  2ZH9 A;  4P4O A;  5HRB A;  1JN3 A;  4RWO A;  5J2E A;  3MDA A;  1ZQK A;  4WC4 A;  3V72 A;  4PGY A;  1JQR A;  1R8A A;  3AQM A;  3RH5 A;  5DKW A;  4X5V A;  3ISC A;  2DR9 A;  5BPC A;  3OUY A;  4AT8 B;  4I29 A;  1TV9 A;  8ICU A;  3ERC C;  4F5R A;  4WC2 A;  3PNC A;  4FH5 A;  3K7D A;  3OUY B;  5DEC A;  4PHE A;  1BPZ A;  5D49 A;  1ZQU A;  4M2Y A;  3V7J A;  4GXK A;  4KLJ A;  4K99 A;  1BPE A;  8ICT A;  4IQW A;  4LZG A;  1ZQW A;  1ZQB A;  5HRF A;  4XUS A;  3CK6 A;  5HRG A;  3WFO A;  4WC5 A;  4QZE A;  3PMN A;  5F2V O;  2PBE A;  4RWP A;  2HN1 A;  5HRD A;  1ZQH A;  4P4M A;  2ISP A;  2BPC A;  5DB7 A;  1ZQF A;  4DOB A;  2HN2 A;  4K97 A;  3RJG A;  1TVA A;  4KLE A;  3NWI A;  3ER9 B;  4EED A;  4FH3 A;  4YMM A;  2FMQ A;  8ICF A;  2BCS A;  4NXW A;  7ICP A;  4UAZ A;  2FCL A;  4QZD A;  4I2D A;  4S3N A;  4NXT A;  4FO1 A;  4MF2 A;  5BOL A;  8ICV A;  1NO5 A;  4OAF A;  3WFQ E;  4EGW A;  4I0U A;  2ZH4 A;  4M9G A;  2PFN A;  4UD4 A;  2M2U A;  5D63 A;  4R64 A;  4KLG A;  9ICI A;  4I2E A;  4Z6F A;  5HRE A;  9ICH A;  8ICX A;  1R89 A;  5J2A A;  3AQK A;  4UB5 A;  5J0T A;  5HR9 A;  3H39 A;  3AU6 A;  4RQ3 A;  2B4V A;  1ZQX A;  1ZQN A;  4NXZ A;  4MFA A;  3JYY A;  3AQN A;  2DR7 A;  2BPG A;  4KB6 A;  4R65 A;  3H37 A;  1PX5 A;  8ICY A;  2ZH2 A;  4YD2 A;  3JPQ A;  4QZC A;  5IIO A;  3RH6 A;  5HHI A;  4YN4 A;  4FHY A;  9ICW A;  7ICS A;  2BPF A;  4KLL A;  1ZQA A;  4O5E A;  4RQ5 A;  4I27 A;  1ZQY A;  5CWR A;  4WOY A;  1RPL A;  5J2I A;  4TUP A;  1ZQM A;  4IG8 A;  8ICL A;  1ZQQ A;  4KLS A;  1ZQE A;  5J0O A;  4I2B A;  3JPT A;  2ZH6 A;  5CFT A;  2B56 A;  4KLT A;  4RWQ A;  4M9N A;  4LEZ A;  4YD1 A;  5J2C A;  5DBA A;  4K4I A;  7ICQ A;  4UBB A;  2GAF D;  4LEW A;  3GDX A;  4KM5 A;  4QZB A;  3C5F A;  3B0Y A;  3HX0 A;  1F5A A;  8ICE A;  4LEV A;  7ICM A;  4RQ1 A;  1BPD A;  4DOC A;  2P66 A;  4DO9 A;  4O5C A;  4NM2 A;  1ZQO A;  4MFC A;  4AT9 B;  1KDH A;  2ZH5 A;  4IQV A;  5HRL A;  5DDM A;  5J0X A;  4XQ8 A;  1HUZ A;  4EEB A;  3ISD A;  8ICH A;  4ATB B;  2DRB A;  3AQL A;  4KLF A;  4X4N A;  1XSN A;  2HHP A;  4FHW A;  5JTG A;  1ZQV A;  5J0U A;  2DVI A;  5EOZ A;  8ICG A;  5J0Q A;  4K8V A;  2BCU A;  4Z6C A;  7ICK A;  3LQC B;  4PHD A;  4HX0 A;  9ICF A;  3HJ1 A;  4MFF A;  5J29 A;  4KLU A;  1V4A A;  4EV6 A;  7ICV A;  2IUB A;  1ZQP A;  1UEV A;  5DDY A;  1GPJ A;  3OWG A;  9ICT A;  3K75 D;  2FMS A;  1ZQL A;  3PML A;  5J2J A;  7ICR A;  8ICR A;  3C2L A;  1R8C A;  9ICG A;  4I2C A;  2BBJ A;  2EWR A;  1MIY A;  2PFO A;  5DB8 A;  2ZH8 A;  5J2K A;  4KLH A;  9ICU A;  9ICR A;  2BE3 A;  7ICU A;  3OV7 A;  3JPS A;  4O68 A;  4M5D A;  5J2G A;  4O69 A;  4NKU A;  3OVB A;  4JLX A;  4WC3 A;  7ICI A;  1JMS A;  3C2K A;  4RPX A;  4X0B A;  7ICH A;  4I28 A;  5IIJ A;  4RQ2 A;  4LZD A;  4NXX A;  4OAH A;  2BCV A;  4K4G A;  4UB1 A;  4MKP A;  3L9D A;  1BPB A;  4JWN A;  9ICB A;  9ICL A;  4JLZ A;  1TFW A;  3TFS A;  5DB9 A;  7ICT A;  4O6A A;  3RJI A;  2IHM A;  3LK9 A;  4X0A A;  4M9L A;  1YLQ A;  4F5Q A;  3UQ2 A;  4R66 A;  4EBK A;  4I2F A;  2BCR A;  2DR8 A;  3UXO A;  4I2J A;  1XSP A;  8ICI A;  4UD5 A;  4RQ0 A;  7ICG A;  2FMP A;  1Q79 A;  1ZQS A;  4WC0 A;  9ICM A;  9ICC A;  1MIW A;  4WBY A;  4E80 A;  3OVS A;  4PGQ A;  8ICO A;  3MGI A;  9ICA A;  2ID1 A;  4I2G A;  2GA9 D;  4RWN A;  4F5P A;  9ICS A;  1ZQT A;  4EP7 A;  4WC7 A;  5HC9 A;  5J0P A;  7ICF A;  3RJF A;  4Z6E A;  3WFR E;  3UPQ A;  2ZHB A;  3V7K A;  1ZJN A;  8ICQ A;  4OAG A;  5B3Q A;  5J0W A;  3HW8 A;  4JWM A;  3UXN A;  2M2V A;  2B51 A;  5HRK A;  4I2H A;  1ZQZ A;  3OGU A;  3HIY A;  4PH5 A;  1UET A;  1VFG A;  1TFY A;  5D46 A;  4M9J A;  1OU5 A;  3UPS A;  4PHP A;  4YMN A;  4X4P A; 
#chains in the Genus database with same CATH homology
 4PHA A;  4RT3 A;  4FHV A;  4IQT A;  8ICW A;  4FHX A;  4AT7 A;  1MQ3 A;  4UB2 A;  8ICM A;  2NRK A;  4MF8 A;  5J2F A;  5D4B A;  5J2B A;  4XA5 A;  4WBZ A;  4PGX A;  4R63 A;  9ICV A;  5HRH A;  2O1P A;  1R8B A;  8ICB A;  4LT6 A;  4M0A A;  4RQ6 A;  5J0S A;  3RJH A;  3OVA A;  1MIV A;  4UBC A;  1XSL A;  3TFR A;  5DED A;  1RZT A;  3RJK A;  4FO6 A;  1VJ7 A;  2PFQ A;  4IQU A;  3RH4 A;  4M9H A;  4NM1 A;  4WC1 A;  3ISB A;  3WFP A;  5HRI A;  5CJ7 A;  5IIK A;  4AT8 A;  1ZQR A;  3NYB A;  4I2I A;  4WCW A;  3MDC A;  4E7X A;  4XRH A;  2DRA A;  9ICX A;  2VAN A;  4FHP A;  2O5A A;  4RT2 A;  4NY8 A;  2PFP A;  9ICP A;  4O9M A;  4UAW A;  4XQ7 A;  9ICQ A;  4O5K A;  8ICC A;  4X4R A;  4Z6D A;  4DOA A;  3V7L A;  4YCX A;  5IIM A;  1JAJ A;  2ZH3 A;  4UB4 A;  3JZ0 A;  5III A;  5CB1 A;  4LVS A;  5J0Y A;  1UEU A;  5IIN A;  2RFF A;  4PPX A;  8ICA A;  3AUO A;  2BCQ A;  3WFS C;  4X4T A;  3UXP A;  4X4S A;  4NLZ A;  5DB6 A;  4I2A A;  1ZQC A;  1FA0 A;  1ZJM A;  1KNY A;  5J2H A;  3RJJ A;  8ICN A;  4UB3 A;  3JPN A;  9ICN A;  4X4O A;  4QZG A;  3MGH A;  4KLM A;  1BPX A;  2M2T A;  4GXI A;  2ZH7 A;  2I9G A;  4P4P A;  4QZA A;  4UAY A;  4TUS A;  3H38 A;  4QZI A;  4X4U A;  2M2W A;  7ICE A;  5IIL A;  4KLO A;  3C5G A;  2PXI A;  3C66 A;  7ICN A;  3RJE A;  8ICZ A;  5HHH A;  5BOM A;  3JPP A;  4RQ4 A;  4E8F A;  3H3A A;  4X4Q A;  1KEJ A;  5J0R A;  5J2D A;  3JPO A;  4NLN A;  8ICS A;  1NOM A;  4RPY A;  1BPY A;  4WC6 A;  1ZQG A;  1ZQJ A;  9ICJ A;  5DBC A;  4NKT A;  8ICJ A;  4GXJ A;  4M47 A;  2GWS A;  5DBB A;  3MBY A;  4QZF A;  8ICK A;  4X4V A;  4TUR A;  2ZHA A;  2ZH1 A;  1HUO A;  3C2M A;  3HWT A;  9ICK A;  2W9M A;  3JPR A;  1ZQD A;  4M04 A;  4F5N A;  1MQ2 A;  9ICE A;  8ICP A;  7ICJ A;  1WOT A;  4AT7 B;  4KLQ A;  4QZ8 A;  4TUQ A;  5CR0 A;  4EBJ A;  4F5O A;  2ISO A;  3HJ4 A;  5CHG A;  4QZ9 A;  7ICL A;  4AT9 A;  2DR5 A;  4KLI A;  4YMO A;  5CP2 A;  4NLK A;  4RQ8 A;  4KLD A;  4RPZ A;  2Q66 A;  4RQ7 A;  3UQ0 A;  9ICO A;  1ZQI A;  4QZH A;  1Q78 A;  3AU2 A;  5TZV A;  7ICO A;  3C18 A;  4ATB A;  4K4H A;  3B0X A;  4P2H A;  5CA7 A;  2ZH9 A;  4P4O A;  5HRB A;  1JN3 A;  4RWO A;  5J2E A;  3MDA A;  1ZQK A;  4WC4 A;  3V72 A;  4PGY A;  1JQR A;  1R8A A;  3AQM A;  3RH5 A;  5DKW A;  4X5V A;  3ISC A;  2DR9 A;  5BPC A;  3OUY A;  4AT8 B;  4I29 A;  1TV9 A;  8ICU A;  4F5R A;  4WC2 A;  3PNC A;  4FH5 A;  3OUY B;  5DEC A;  4PHE A;  1BPZ A;  5D49 A;  1ZQU A;  4M2Y A;  3V7J A;  4GXK A;  4KLJ A;  1BPE A;  8ICT A;  4IQW A;  4LZG A;  1ZQW A;  1ZQB A;  5HRF A;  4XUS A;  5HRG A;  3WFO A;  4WC5 A;  4QZE A;  3PMN A;  5F2V O;  2PBE A;  4RWP A;  5HRD A;  1ZQH A;  4P4M A;  2ISP A;  2BPC A;  5DB7 A;  1ZQF A;  4DOB A;  3RJG A;  1TVA A;  4KLE A;  4FH3 A;  4YMM A;  2FMQ A;  8ICF A;  2BCS A;  7ICP A;  4UAZ A;  4QZD A;  4I2D A;  4S3N A;  4MF2 A;  5BOL A;  8ICV A;  1NO5 A;  3WFQ E;  2ZH4 A;  4M9G A;  2PFN A;  4UD4 A;  2M2U A;  4R64 A;  4KLG A;  9ICI A;  4I2E A;  4Z6F A;  5HRE A;  9ICH A;  8ICX A;  1R89 A;  5J2A A;  3AQK A;  4UB5 A;  5J0T A;  5HR9 A;  3H39 A;  3AU6 A;  4RQ3 A;  1ZQX A;  1ZQN A;  4NXZ A;  4MFA A;  3JYY A;  3AQN A;  2DR7 A;  2BPG A;  4R65 A;  3H37 A;  1PX5 A;  8ICY A;  2ZH2 A;  4YD2 A;  3JPQ A;  4QZC A;  5IIO A;  3RH6 A;  5HHI A;  4YN4 A;  4FHY A;  9ICW A;  7ICS A;  2BPF A;  4KLL A;  1ZQA A;  4O5E A;  4RQ5 A;  4I27 A;  1ZQY A;  5CWR A;  1RPL A;  5J2I A;  4TUP A;  1ZQM A;  4IG8 A;  8ICL A;  1ZQQ A;  4KLS A;  1ZQE A;  5J0O A;  4I2B A;  3JPT A;  2ZH6 A;  4KLT A;  4RWQ A;  4M9N A;  4YD1 A;  5J2C A;  5DBA A;  4K4I A;  7ICQ A;  4UBB A;  3GDX A;  4QZB A;  3C5F A;  3B0Y A;  3HX0 A;  1F5A A;  8ICE A;  7ICM A;  4RQ1 A;  1BPD A;  4DOC A;  2P66 A;  4DO9 A;  4O5C A;  4NM2 A;  1ZQO A;  4MFC A;  4AT9 B;  1KDH A;  2ZH5 A;  4IQV A;  5HRL A;  5DDM A;  5J0X A;  4XQ8 A;  1HUZ A;  3ISD A;  8ICH A;  4ATB B;  2DRB A;  3AQL A;  4KLF A;  4X4N A;  1XSN A;  2HHP A;  4FHW A;  1ZQV A;  5J0U A;  2DVI A;  5EOZ A;  8ICG A;  5J0Q A;  2BCU A;  4Z6C A;  7ICK A;  3LQC B;  4PHD A;  9ICF A;  3HJ1 A;  4MFF A;  5J29 A;  4KLU A;  1V4A A;  7ICV A;  1ZQP A;  1UEV A;  5DDY A;  9ICT A;  3K75 D;  2FMS A;  1ZQL A;  3PML A;  5J2J A;  7ICR A;  8ICR A;  3C2L A;  1R8C A;  9ICG A;  4I2C A;  1MIY A;  2PFO A;  5DB8 A;  2ZH8 A;  5J2K A;  4KLH A;  9ICU A;  9ICR A;  2BE3 A;  7ICU A;  3OV7 A;  3JPS A;  4M5D A;  5J2G A;  4NKU A;  3OVB A;  4WC3 A;  7ICI A;  1JMS A;  3C2K A;  4RPX A;  4X0B A;  7ICH A;  4I28 A;  5IIJ A;  4RQ2 A;  4LZD A;  2BCV A;  4K4G A;  4UB1 A;  3L9D A;  1BPB A;  4JWN A;  9ICB A;  9ICL A;  1TFW A;  3TFS A;  5DB9 A;  7ICT A;  3RJI A;  2IHM A;  3LK9 A;  4X0A A;  4M9L A;  1YLQ A;  4F5Q A;  3UQ2 A;  4R66 A;  4EBK A;  4I2F A;  2BCR A;  2DR8 A;  3UXO A;  4I2J A;  1XSP A;  8ICI A;  4UD5 A;  4RQ0 A;  7ICG A;  2FMP A;  1Q79 A;  1ZQS A;  4WC0 A;  9ICM A;  9ICC A;  1MIW A;  4WBY A;  4E80 A;  3OVS A;  4PGQ A;  8ICO A;  3MGI A;  9ICA A;  2ID1 A;  4I2G A;  4RWN A;  4F5P A;  9ICS A;  1ZQT A;  4EP7 A;  4WC7 A;  5HC9 A;  5J0P A;  7ICF A;  3RJF A;  4Z6E A;  3WFR E;  3UPQ A;  2ZHB A;  3V7K A;  1ZJN A;  8ICQ A;  5J0W A;  3HW8 A;  4JWM A;  3UXN A;  2M2V A;  5HRK A;  4I2H A;  1ZQZ A;  3OGU A;  3HIY A;  4PH5 A;  1UET A;  1VFG A;  1TFY A;  5D46 A;  4M9J A;  1OU5 A;  3UPS A;  4PHP A;  4YMN A;  4X4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...