5HRBA

The crystal structure of asfvpolx:dna1 binary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
176
Chain Sequence
GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
total genus 47
structure length 176
sequence length 176
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrbA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrbA01
9ICIA 1ZQKA 4RPYA 3RJKA 5BOMA 7ICOA 5HRGA 3UPSA 5DB9A 4PGYA 4AT9A 2Q66A 3AQKA 1MIYA 3JPQA 3UXPA 4WC3A 4XUSA 4ATBA 4PH5A 1F5AA 4UD4A 5DECA 1UEUA 2FMQA 4RQ5A 4WC2A 1MIVA 5HREA 5IINA 4QZFA 2ZH7A 3V7LA 2HHPA 4KLUA 4TUPA 9ICUA 1UEVA 2PBEA 1ZQMA 8ICAA 4AT7A 1ZQQA 2BCQA 8ICFA 7ICTA 5CB1A 3JPPA 5J0QA 4QZCA 1BPYA 1ZQNA 4LVSA 4DO9A 4RT2A 4AT9B 4R63A 4F5PA 1ZQLA 4RQ8A 4M9LA 2DRAA 9ICFA 4X4QA 4KLQA 4MFAA 1MQ3A 3ISBA 7ICMA 5J29A 5J0XA 4I2DA 3JPNA 4FHVA 7ICFA 4LT6A 4YMMA 3RJEA 2ZHBA 4MFCA 2BPFA 4Z6EA 2PXIA 1R8BA 4E8FA 3AU2A 1ZQTA 1JAJA 9ICLA 1MIWA 4X4RA 4UB2A 4PHDA 1V4AA 8ICRA 5J0OA 5J2FA 5HRFA 4I2GA 4NLNA 3WFRE 4WC1A 4FH3A 2PFOA 2M2TA 4UB3A 3JPOA 4PHAA 4YN4A 3B0XA 5CA7A 5DKWA 4PGQA 4P2HA 1XSLA 5J2DA 1HUZA 2ID1A 4JWMA 4EP7A 5HRDA 7ICKA 1ZQFA 3JPRA 3K75D 2DRBA 4P4OA 5HHHA 4FHPA 4YMOA 4K4HA 4X4OA 9ICEA 8ICWA 5J2HA 1TFWA 3MBYA 4UD5A 8ICJA 2BCUA 8ICLA 4UBCA 4TUQA 4QZ9A 4X5VA 4NLZA 9ICTA 4NKUA 3RJHA 5DDYA 1UETA 4F5NA 2GWSA 8ICVA 3RJFA 5J0WA 3AUOA 8ICMA 4I2FA 4PHPA 3PMLA 1ZQDA 4M9JA 3RJIA 3OUYA 2I9GA 8ICBA 1BPZA 7ICNA 4RPZA 1OU5A 3H38A 4I2JA 3RH4A 3H39A 9ICHA 5IIKA 4IQTA 5DB6A 9ICGA 5HR9A 7ICEA 1ZJNA 9ICXA 4IQVA 2BE3A 4RPXA 2DVIA 5J2CA 4GXIA 4K4IA 3WFPA 2PFPA 1BPDA 3TFSA 4AT8A 1ZJMA 3HWTA 4Z6CA 1ZQGA 1ZQOA 1RPLA 3C66A 4NM1A 8ICSA 4LZDA 1KNYA 1ZQSA 2ZH1A 4YD2A 5CWRA 4PPXA 3C5FA 4F5RA 4TUSA 5DBCA 4X0BA 4M9GA 1JN3A 4FHYA 4NLKA 4M2YA 1BPBA 3PMNA 4Z6FA 8ICZA 2ZHAA 3RH5A 4UAYA 4K4GA 1XSPA 4M04A 3AQNA 4WC5A 4NM2A 7ICJA 3JPSA 4I2CA 9ICWA 1JMSA 3L9DA 5HRHA 4I28A 3C5GA 7ICSA 1TV9A 1ZQBA 4RQ0A 5IILA 2ZH2A 2DR9A 3JZ0A 3MGIA 4KLFA 5HRKA 4IG8A 5J0YA 4FHXA 8ICXA 4KLLA 1MQ2A 4RQ6A 4JWNA 1YLQA 2DR7A 4M47A 2PFNA 7ICHA 9ICJA 2M2VA 5D49A 4EBKA 8ICPA 1WOTA 3LK9A 2FMSA 4EBJA 5HRIA 5J2JA 3ISCA 4XQ8A 9ICKA 5IIJA 4KLMA 4O9MA 8ICQA 8ICTA 5DBAA 5J0SA 3GDXA 4P4MA 2ISPA 4XA5A 3NYBA 1ZQJA 4XRHA 4WC7A 4NY8A 3B0YA 4TURA 4X4SA 9ICBA 4I29A 5CR0A 2BCSA 5CP2A 9ICOA 2BPGA 4R65A 1PX5A 4O5KA 3MGHA 5EOZA 2BPCA 1ZQYA 4X4UA 1ZQIA 1FA0A 4KLGA 9ICPA 5F2VO 4E7XA 1TFYA 3HW8A 4RQ3A 1ZQRA 9ICCA 4AT8B 4RWQA 3UXOA 1ZQWA 4WCWA 4RQ2A 4P4PA 3OVSA 4UAZA 4QZEA 3C2KA 4RWNA 1Q79A 3RJGA 8ICKA 9ICQA 2DR5A 5DDMA 3RJJA 3AU6A 5J2KA 3MDCA 3H3AA 1ZQUA 5IIMA 3RH6A 5HHIA 4IQUA 3AQLA 4I27A 3HIYA 5HC9A 2ZH6A 4RQ1A 1KDHA 4FH5A 4R64A 2ZH5A 4ATBB 3TFRA 1ZQCA 8ICNA 5HRLA 4RWPA 4UAWA 5J2AA 4KLJA 4QZBA 2FMPA 7ICIA 4KLOA 2O1PA 5J0RA 4FHWA 5IIOA 3WFOA 3HJ1A 4MFFA 5HRBA 4KLHA 4AT7B 4WC6A 4YMNA 4I2IA 3C2LA 4RQ7A 4QZHA 5J0TA 1ZQEA 4O5EA 1R89A 4QZ8A 3HJ4A 3PNCA 1BPEA 1VJ7A 9ICNA 1JQRA 4RWOA 3C2MA 5D46A 4WC4A 4WC0A 4F5QA 9ICAA 4DOAA 8ICCA 8ICIA 4WBZA 2NRKA 3UQ0A 1ZQAA 2O5AA 3V7JA 4RQ4A 4DOCA 5CHGA 8ICEA 3UXNA 3LQCB 3WFQE 2ZH9A 4WBYA 2DR8A 4X4NA 4GXKA 4M9NA 4I2BA 4Z6DA 8ICGA 9ICSA 1VFGA 7ICUA 5DB7A 1NOMA 5J2BA 5J0PA 1ZQHA 4LZGA 4NKTA 1RZTA 5TZVA 2ISOA 1KEJA 2BCVA 3JYYA 3HX0A 4UB5A 5DB8A 4RT3A 4QZGA 3OVBA 2BCRA 4KLSA 2PFQA 4YCXA 3OVAA 4UB4A 1NO5A 4PHEA 4QZIA 3AQMA 5DBBA 1TVAA 1R8AA 5BPCA 4F5OA 4MF2A 5J2GA 4M5DA 2ZH4A 9ICRA 4PGXA 7ICVA 4XQ7A 1ZQZA 3V72A 4X4TA 3UPQA 7ICPA 8ICHA 4GXJA 4DOBA 4KLDA 1R8CA 3OUYB 4KLIA 4KLTA 4QZDA 2IHMA 2VANA 4M9HA 3ISDA 4O5CA 2P66A 1HUOA 1ZQPA 1ZQVA 4I2EA 3H37A 2ZH3A 3OGUA 4I2AA 8ICYA 4NXZA 4I2HA 4UB1A 5DEDA 3WFSC 7ICRA 5BOLA 9ICMA 1BPXA 2W9MA 4E80A 5IIIA 4YD1A 5J0UA 4UBBA 5D4BA 7ICQA 4R66A 1Q78A 3C18A 2M2UA 4S3NA 4X0AA 2M2WA 4MF8A 5J2IA 3JPTA 1ZQXA 3V7KA 8ICOA 9ICVA 7ICGA 4FO6A 1XSNA 5J2EA 4IQWA 4QZAA 3UQ2A 8ICUA 2RFFA 4X4PA 3OV7A 4X4VA 3MDAA 5CJ7A 7ICLA 4M0AA 2ZH8A 4KLEA
chains in the Genus database with same CATH superfamily
9ICIA 1ZQKA 5CFTA 4RPYA 3RJKA 5BOMA 7ICOA 5HRGA 3UPSA 5DB9A 4NXXA 4PGYA 4AT9A 2Q66A 3AQKA 1MIYA 5B3QA 3JPQA 3UXPA 4WC3A 4XUSA 4ATBA 4PH5A 1F5AA 4UD4A 5DECA 1UEUA 2FMQA 4RQ5A 4WC2A 1MIVA 5HREA 5IINA 4EEDA 4QZFA 4O6AA 2ZH7A 3V7LA 2HHPA 4KLUA 4TUPA 9ICUA 1UEVA 2PBEA 5CHEA 3NWIA 1ZQMA 8ICAA 4AT7A 1ZQQA 2EWRA 2BCQA 8ICFA 7ICTA 5CB1A 3JPPA 5J0QA 4QZCA 1BPYA 1ZQNA 4LVSA 4DO9A 4RT2A 4AT9B 4R63A 4F5PA 1ZQLA 4RQ8A 4M9LA 2DRAA 9ICFA 4X4QA 4KLQA 4MFAA 1MQ3A 3ISBA 7ICMA 5J29A 5J0XA 4KM5A 4I2DA 3JPNA 4FHVA 7ICFA 4LT6A 4YMMA 4O67A 3RJEA 2ZHBA 4MFCA 2BPFA 4Z6EA 2PXIA 1R8BA 3NVOA 4NXTA 4E8FA 3AU2A 1ZQTA 1JAJA 9ICLA 1MIWA 4X4RA 4UB2A 4PHDA 1V4AA 8ICRA 5J0OA 5J2FA 5HRFA 4I2GA 4NLNA 3WFRE 4WC1A 4FH3A 3ER9B 2PFOA 2M2TA 4UB3A 3JPOA 4PHAA 4JLZA 4YN4A 3B0XA 5CA7A 5DKWA 4PGQA 4P2HA 1XSLA 2IUBA 5J2DA 1HUZA 3EF2A 2ID1A 4JWMA 4EP7A 5HRDA 7ICKA 1ZQFA 3JPRA 3K75D 2DRBA 4LEYA 4P4OA 5HHHA 3MCRA 4FHPA 4YMOA 4K4HA 4X4OA 9ICEA 8ICWA 5J2HA 2B4VA 1TFWA 3MBYA 4UD5A 8ICJA 4OAIZ 4OAGA 2BCUA 8ICLA 4UBCA 4K9BA 4TUQA 4QZ9A 4X5VA 4NLZA 9ICTA 4NKUA 3RJHA 5DDYA 1UETA 3ER8C 4F5NA 2GWSA 8ICVA 3RJFA 5JTGA 5J0WA 3AUOA 8ICMA 4I2FA 4PHPA 3PMLA 1ZQDA 4M9JA 3RJIA 3OUYA 2I9GA 8ICBA 1BPZA 7ICNA 4RPZA 1OU5A 3H38A 4I2JA 3RH4A 3H39A 9ICHA 4K97A 5IIKA 4IQTA 5DB6A 9ICGA 5D63A 4K96A 5HR9A 7ICEA 1ZJNA 9ICXA 2HN1A 4IQVA 2BE3A 4RPXA 2DVIA 5J2CA 4GXIA 4K4IA 3WFPA 2PFPA 4NXVA 4K99A 1BPDA 3TFSA 4AT8A 1ZJMA 3HWTA 4Z6CA 1ZQGA 1ZQOA 1RPLA 3C66A 4NM1A 8ICSA 4LZDA 1KNYA 1ZQSA 2ZH1A 4YD2A 5CWRA 4PPXA 3C5FA 4F5RA 4TUSA 5DBCA 4X0BA 4M9GA 1JN3A 4FHYA 4NLKA 4M2YA 1BPBA 3PMNA 4Z6FA 8ICZA 4LEVA 2ZHAA 3RH5A 4UAYA 4K4GA 3OWGA 1XSPA 4M04A 3AQNA 4WC5A 4NM2A 7ICJA 3JPSA 4I2CA 9ICWA 1JMSA 3L9DA 5HRHA 4I28A 3C5GA 7ICSA 1TV9A 4FO1A 1ZQBA 4RQ0A 4NXUA 5IILA 4EGWA 2ZH2A 2DR9A 3JZ0A 3MGIA 4KLFA 5HRKA 4IG8A 4N7RA 5J0YA 4FHXA 8ICXA 4KLLA 1MQ2A 4RQ6A 4JWNA 1YLQA 2DR7A 4M47A 2PFNA 7ICHA 9ICJA 2M2VA 5D49A 4EBKA 8ICPA 1WOTA 3LK9A 2FMSA 4LEZA 4EBJA 5HRIA 5J2JA 3ISCA 2GA9D 4XQ8A 9ICKA 5IIJA 4KLMA 4O9MA 8ICQA 8ICTA 5DBAA 5J0SA 3GDXA 4P4MA 2ISPA 4XA5A 3NYBA 1ZQJA 4XRHA 4WC7A 4NY8A 5B3PA 3B0YA 4TURA 4X4SA 9ICBA 4I29A 5CR0A 4EEBA 2BCSA 5CP2A 9ICOA 4I0UA 2BPGA 4R65A 1PX5A 4O5KA 3MGHA 5EOZA 2BPCA 1ZQYA 4X4UA 1ZQIA 5CFSA 1FA0A 4KLGA 9ICPA 5F2VO 4E7XA 1TFYA 3HW8A 5D61A 4RQ3A 1ZQRA 9ICCA 4AT8B 4RWQA 3UXOA 1ZQWA 4WCWA 4RQ2A 4P4PA 3OVSA 4UAZA 4QZEA 3C2KA 2BBJA 4RWNA 1Q79A 4K98A 3RJGA 8ICKA 9ICQA 2DR5A 5DDMA 3RJJA 3AU6A 5J2KA 4JLXA 3MDCA 3H3AA 1ZQUA 5IIMA 3RH6A 5HHIA 4O68A 4IQUA 3AQLA 4I27A 3HIYA 4WOYA 5HC9A 2ZH6A 4RQ1A 4MKPA 1KDHA 4FH5A 4R64A 2ZH5A 4ATBB 3TFRA 1ZQCA 4OAFA 8ICNA 5HRLA 4RWPA 4UAWA 5J2AA 4KLJA 4QZBA 2FMPA 4XJEA 7ICIA 4KLOA 2O1PA 5J0RA 2BBHA 4FHWA 5IIOA 3WFOA 3HJ1A 4K9AA 4MFFA 5HRBA 4KLHA 4AT7B 3CK6A 4WC6A 4YMNA 4I2IA 3C2LA 4RQ7A 4QZHA 5J0TA 1ZQEA 4O5EA 2HN2A 4WQKA 1R89A 4QZ8A 3HJ4A 3PNCA 1BPEA 1VJ7A 9ICNA 1JQRA 4RWOA 3C2MA 5D46A 4WC4A 4WC0A 4F5QA 9ICAA 4DOAA 8ICCA 8ICIA 4WBZA 2NRKA 4WH5A 3PHZA 3UQ0A 1ZQAA 2O5AA 5D62A 3V7JA 4RQ4A 4DOCA 5CHGA 8ICEA 3UXNA 3LQCB 3WFQE 2ZH9A 4WBYA 2DR8A 4X4NA 4OAHA 4GXKA 4NXWA 4M9NA 4I2BA 4Z6DA 8ICGA 9ICSA 1VFGA 7ICUA 5DB7A 1NOMA 5J2BA 5J0PA 1ZQHA 4LZGA 2FCLA 3K7DA 4NKTA 1RZTA 5TZVA 2ISOA 1KEJA 2BCVA 3JYYA 3HX0A 4UB5A 5DB8A 4RT3A 4QZGA 3OVBA 2BCRA 4KLSA 2PFQA 3ERCC 4YCXA 4LEWA 1GPJA 3OVAA 4UB4A 1NO5A 4PHEA 4QZIA 3AQMA 5DBBA 1TVAA 1R8AA 5BPCA 4F5OA 4MF2A 5J2GA 4M5DA 2ZH4A 5CFUA 9ICRA 4PGXA 7ICVA 4XQ7A 1ZQZA 3V72A 4K8VA 4X4TA 3UPQA 7ICPA 8ICHA 4GXJA 4DOBA 4KLDA 1R8CA 3OUYB 4KLIA 4KLTA 4QZDA 2IHMA 2IHOA 2VANA 4M9HA 3ISDA 4O5CA 4O69A 4KB6A 2P66A 1HUOA 1ZQPA 4EV6A 4WQLA 1ZQVA 4I2EA 3H37A 2ZH3A 3OGUA 4HX0A 4I2AA 8ICYA 4NXZA 4I2HA 4UB1A 5DEDA 3WFSC 7ICRA 5BOLA 9ICMA 1BPXA 2W9MA 4E80A 5IIIA 3NKUA 3JCFA 4YD1A 5J0UA 4UBBA 5D4BA 7ICQA 4R66A 1Q78A 3C18A 2M2UA 2B51A 2B56A 4S3NA 4X0AA 2M2WA 4MF8A 5J2IA 3JPTA 1ZQXA 3V7KA 2GAFD 8ICOA 9ICVA 7ICGA 4FO6A 1XSNA 5J2EA 4IQWA 4QZAA 3UQ2A 8ICUA 2RFFA 4X4PA 3OV7A 4X4VA 3MDAA 5CJ7A 7ICLA 4M0AA 2ZH8A 4KLEA
chains in the Genus database with same CATH topology
9ICIA 1ZQKA 4RPYA 3RJKA 5BOMA 7ICOA 5HRGA 3UPSA 5DB9A 4PGYA 4AT9A 2Q66A 3AQKA 1MIYA 3JPQA 3UXPA 4WC3A 4XUSA 4ATBA 4PH5A 1F5AA 4UD4A 5DECA 1UEUA 2FMQA 4RQ5A 4WC2A 1MIVA 5HREA 5IINA 4QZFA 2ZH7A 3V7LA 2HHPA 4KLUA 4TUPA 9ICUA 1UEVA 2PBEA 1ZQMA 8ICAA 4AT7A 1ZQQA 2BCQA 8ICFA 7ICTA 5CB1A 3JPPA 5J0QA 4QZCA 1BPYA 1ZQNA 4LVSA 4DO9A 4RT2A 4AT9B 4R63A 4F5PA 1ZQLA 4RQ8A 4M9LA 2DRAA 9ICFA 4X4QA 4KLQA 4MFAA 1MQ3A 3ISBA 7ICMA 5J29A 5J0XA 4I2DA 3JPNA 4FHVA 7ICFA 4LT6A 4YMMA 3RJEA 2ZHBA 4MFCA 2BPFA 4Z6EA 2PXIA 1R8BA 4E8FA 3AU2A 1ZQTA 1JAJA 9ICLA 1MIWA 4X4RA 4UB2A 4PHDA 1V4AA 8ICRA 5J0OA 5J2FA 5HRFA 4I2GA 4NLNA 3WFRE 4WC1A 4FH3A 2PFOA 2M2TA 4UB3A 3JPOA 4PHAA 4YN4A 3B0XA 5CA7A 5DKWA 4PGQA 4P2HA 1XSLA 5J2DA 1HUZA 2ID1A 4JWMA 4EP7A 5HRDA 7ICKA 1ZQFA 3JPRA 3K75D 2DRBA 4P4OA 5HHHA 4FHPA 4YMOA 4K4HA 4X4OA 9ICEA 8ICWA 5J2HA 1TFWA 3MBYA 4UD5A 8ICJA 2BCUA 8ICLA 4UBCA 4TUQA 4QZ9A 4X5VA 4NLZA 9ICTA 4NKUA 3RJHA 5DDYA 1UETA 4F5NA 2GWSA 8ICVA 3RJFA 5J0WA 3AUOA 8ICMA 4I2FA 4PHPA 3PMLA 1ZQDA 4M9JA 3RJIA 3OUYA 2I9GA 8ICBA 1BPZA 7ICNA 4RPZA 1OU5A 3H38A 4I2JA 3RH4A 3H39A 9ICHA 5IIKA 4IQTA 5DB6A 9ICGA 5HR9A 7ICEA 1ZJNA 9ICXA 4IQVA 2BE3A 4RPXA 2DVIA 5J2CA 4GXIA 4K4IA 3WFPA 2PFPA 1BPDA 3TFSA 4AT8A 1ZJMA 3HWTA 4Z6CA 1ZQGA 1ZQOA 1RPLA 3C66A 4NM1A 8ICSA 4LZDA 1KNYA 1ZQSA 2ZH1A 4YD2A 5CWRA 4PPXA 3C5FA 4F5RA 4TUSA 5DBCA 4X0BA 4M9GA 1JN3A 4FHYA 4NLKA 4M2YA 1BPBA 3PMNA 4Z6FA 8ICZA 2ZHAA 3RH5A 4UAYA 4K4GA 1XSPA 4M04A 3AQNA 4WC5A 4NM2A 7ICJA 3JPSA 4I2CA 9ICWA 1JMSA 3L9DA 5HRHA 4I28A 3C5GA 7ICSA 1TV9A 1ZQBA 4RQ0A 5IILA 2ZH2A 2DR9A 3JZ0A 3MGIA 4KLFA 5HRKA 4IG8A 5J0YA 4FHXA 8ICXA 4KLLA 1MQ2A 4RQ6A 4JWNA 1YLQA 2DR7A 4M47A 2PFNA 7ICHA 9ICJA 2M2VA 5D49A 4EBKA 8ICPA 1WOTA 3LK9A 2FMSA 4EBJA 5HRIA 5J2JA 3ISCA 4XQ8A 9ICKA 5IIJA 4KLMA 4O9MA 8ICQA 8ICTA 5DBAA 5J0SA 3GDXA 4P4MA 2ISPA 4XA5A 3NYBA 1ZQJA 4XRHA 4WC7A 4NY8A 3B0YA 4TURA 4X4SA 9ICBA 4I29A 5CR0A 2BCSA 5CP2A 9ICOA 2BPGA 4R65A 1PX5A 4O5KA 3MGHA 5EOZA 2BPCA 1ZQYA 4X4UA 1ZQIA 1FA0A 4KLGA 9ICPA 5F2VO 4E7XA 1TFYA 3HW8A 4RQ3A 1ZQRA 9ICCA 4AT8B 4RWQA 3UXOA 1ZQWA 4WCWA 4RQ2A 4P4PA 3OVSA 4UAZA 4QZEA 3C2KA 4RWNA 1Q79A 3RJGA 8ICKA 9ICQA 2DR5A 5DDMA 3RJJA 3AU6A 5J2KA 3MDCA 3H3AA 1ZQUA 5IIMA 3RH6A 5HHIA 4IQUA 3AQLA 4I27A 3HIYA 5HC9A 2ZH6A 4RQ1A 1KDHA 4FH5A 4R64A 2ZH5A 4ATBB 3TFRA 1ZQCA 8ICNA 5HRLA 4RWPA 4UAWA 5J2AA 4KLJA 4QZBA 2FMPA 7ICIA 4KLOA 2O1PA 5J0RA 4FHWA 5IIOA 3WFOA 3HJ1A 4MFFA 5HRBA 4KLHA 4AT7B 4WC6A 4YMNA 4I2IA 3C2LA 4RQ7A 4QZHA 5J0TA 1ZQEA 4O5EA 1R89A 4QZ8A 3HJ4A 3PNCA 1BPEA 1VJ7A 9ICNA 1JQRA 4RWOA 3C2MA 5D46A 4WC4A 4WC0A 4F5QA 9ICAA 4DOAA 8ICCA 8ICIA 4WBZA 2NRKA 3UQ0A 1ZQAA 2O5AA 3V7JA 4RQ4A 4DOCA 5CHGA 8ICEA 3UXNA 3LQCB 3WFQE 2ZH9A 4WBYA 2DR8A 4X4NA 4GXKA 4M9NA 4I2BA 4Z6DA 8ICGA 9ICSA 1VFGA 7ICUA 5DB7A 1NOMA 5J2BA 5J0PA 1ZQHA 4LZGA 4NKTA 1RZTA 5TZVA 2ISOA 1KEJA 2BCVA 3JYYA 3HX0A 4UB5A 5DB8A 4RT3A 4QZGA 3OVBA 2BCRA 4KLSA 2PFQA 4YCXA 3OVAA 4UB4A 1NO5A 4PHEA 4QZIA 3AQMA 5DBBA 1TVAA 1R8AA 5BPCA 4F5OA 4MF2A 5J2GA 4M5DA 2ZH4A 9ICRA 4PGXA 7ICVA 4XQ7A 1ZQZA 3V72A 4X4TA 3UPQA 7ICPA 8ICHA 4GXJA 4DOBA 4KLDA 1R8CA 3OUYB 4KLIA 4KLTA 4QZDA 2IHMA 2VANA 4M9HA 3ISDA 4O5CA 2P66A 1HUOA 1ZQPA 1ZQVA 4I2EA 3H37A 2ZH3A 3OGUA 4I2AA 8ICYA 4NXZA 4I2HA 4UB1A 5DEDA 3WFSC 7ICRA 5BOLA 9ICMA 1BPXA 2W9MA 4E80A 5IIIA 4YD1A 5J0UA 4UBBA 5D4BA 7ICQA 4R66A 1Q78A 3C18A 2M2UA 4S3NA 4X0AA 2M2WA 4MF8A 5J2IA 3JPTA 1ZQXA 3V7KA 8ICOA 9ICVA 7ICGA 4FO6A 1XSNA 5J2EA 4IQWA 4QZAA 3UQ2A 8ICUA 2RFFA 4X4PA 3OV7A 4X4VA 3MDAA 5CJ7A 7ICLA 4M0AA 2ZH8A 4KLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICI A;  1ZQK A;  4RPY A;  3RJK A;  5BOM A;  7ICO A;  5HRG A;  3UPS A;  5DB9 A;  4PGY A;  4AT9 A;  2Q66 A;  3AQK A;  1MIY A;  3JPQ A;  3UXP A;  4WC3 A;  4XUS A;  4ATB A;  4PH5 A;  1F5A A;  4UD4 A;  5DEC A;  1UEU A;  2FMQ A;  4RQ5 A;  4WC2 A;  1MIV A;  5HRE A;  5IIN A;  4QZF A;  2ZH7 A;  3V7L A;  2HHP A;  4KLU A;  4TUP A;  9ICU A;  1UEV A;  2PBE A;  1ZQM A;  8ICA A;  4AT7 A;  1ZQQ A;  2BCQ A;  8ICF A;  7ICT A;  5CB1 A;  3JPP A;  5J0Q A;  4QZC A;  1BPY A;  1ZQN A;  4LVS A;  4DO9 A;  4RT2 A;  4AT9 B;  4R63 A;  4F5P A;  1ZQL A;  4RQ8 A;  4M9L A;  2DRA A;  9ICF A;  4X4Q A;  4KLQ A;  4MFA A;  1MQ3 A;  3ISB A;  7ICM A;  5J29 A;  5J0X A;  4I2D A;  3JPN A;  4FHV A;  7ICF A;  4LT6 A;  4YMM A;  3RJE A;  2ZHB A;  4MFC A;  2BPF A;  4Z6E A;  2PXI A;  1R8B A;  4E8F A;  3AU2 A;  1ZQT A;  1JAJ A;  9ICL A;  1MIW A;  4X4R A;  4UB2 A;  4PHD A;  1V4A A;  8ICR A;  5J0O A;  5J2F A;  5HRF A;  4I2G A;  4NLN A;  3WFR E;  4WC1 A;  4FH3 A;  2PFO A;  2M2T A;  4UB3 A;  3JPO A;  4PHA A;  4YN4 A;  3B0X A;  5CA7 A;  5DKW A;  4PGQ A;  4P2H A;  1XSL A;  5J2D A;  1HUZ A;  2ID1 A;  4JWM A;  4EP7 A;  5HRD A;  7ICK A;  1ZQF A;  3JPR A;  3K75 D;  2DRB A;  4P4O A;  5HHH A;  4FHP A;  4YMO A;  4K4H A;  4X4O A;  9ICE A;  8ICW A;  5J2H A;  1TFW A;  3MBY A;  4UD5 A;  8ICJ A;  2BCU A;  8ICL A;  4UBC A;  4TUQ A;  4QZ9 A;  4X5V A;  4NLZ A;  9ICT A;  4NKU A;  3RJH A;  5DDY A;  1UET A;  4F5N A;  2GWS A;  8ICV A;  3RJF A;  5J0W A;  3AUO A;  8ICM A;  4I2F A;  4PHP A;  3PML A;  1ZQD A;  4M9J A;  3RJI A;  3OUY A;  2I9G A;  8ICB A;  1BPZ A;  7ICN A;  4RPZ A;  1OU5 A;  3H38 A;  4I2J A;  3RH4 A;  3H39 A;  9ICH A;  5IIK A;  4IQT A;  5DB6 A;  9ICG A;  5HR9 A;  7ICE A;  1ZJN A;  9ICX A;  4IQV A;  2BE3 A;  4RPX A;  2DVI A;  5J2C A;  4GXI A;  4K4I A;  3WFP A;  2PFP A;  1BPD A;  3TFS A;  4AT8 A;  1ZJM A;  3HWT A;  4Z6C A;  1ZQG A;  1ZQO A;  1RPL A;  3C66 A;  4NM1 A;  8ICS A;  4LZD A;  1KNY A;  1ZQS A;  2ZH1 A;  4YD2 A;  5CWR A;  4PPX A;  3C5F A;  4F5R A;  4TUS A;  5DBC A;  4X0B A;  4M9G A;  1JN3 A;  4FHY A;  4NLK A;  4M2Y A;  1BPB A;  3PMN A;  4Z6F A;  8ICZ A;  2ZHA A;  3RH5 A;  4UAY A;  4K4G A;  1XSP A;  4M04 A;  3AQN A;  4WC5 A;  4NM2 A;  7ICJ A;  3JPS A;  4I2C A;  9ICW A;  1JMS A;  3L9D A;  5HRH A;  4I28 A;  3C5G A;  7ICS A;  1TV9 A;  1ZQB A;  4RQ0 A;  5IIL A;  2ZH2 A;  2DR9 A;  3JZ0 A;  3MGI A;  4KLF A;  5HRK A;  4IG8 A;  5J0Y A;  4FHX A;  8ICX A;  4KLL A;  1MQ2 A;  4RQ6 A;  4JWN A;  1YLQ A;  2DR7 A;  4M47 A;  2PFN A;  7ICH A;  9ICJ A;  2M2V A;  5D49 A;  4EBK A;  8ICP A;  1WOT A;  3LK9 A;  2FMS A;  4EBJ A;  5HRI A;  5J2J A;  3ISC A;  4XQ8 A;  9ICK A;  5IIJ A;  4KLM A;  4O9M A;  8ICQ A;  8ICT A;  5DBA A;  5J0S A;  3GDX A;  4P4M A;  2ISP A;  4XA5 A;  3NYB A;  1ZQJ A;  4XRH A;  4WC7 A;  4NY8 A;  3B0Y A;  4TUR A;  4X4S A;  9ICB A;  4I29 A;  5CR0 A;  2BCS A;  5CP2 A;  9ICO A;  2BPG A;  4R65 A;  1PX5 A;  4O5K A;  3MGH A;  5EOZ A;  2BPC A;  1ZQY A;  4X4U A;  1ZQI A;  1FA0 A;  4KLG A;  9ICP A;  5F2V O;  4E7X A;  1TFY A;  3HW8 A;  4RQ3 A;  1ZQR A;  9ICC A;  4AT8 B;  4RWQ A;  3UXO A;  1ZQW A;  4WCW A;  4RQ2 A;  4P4P A;  3OVS A;  4UAZ A;  4QZE A;  3C2K A;  4RWN A;  1Q79 A;  3RJG A;  8ICK A;  9ICQ A;  2DR5 A;  5DDM A;  3RJJ A;  3AU6 A;  5J2K A;  3MDC A;  3H3A A;  1ZQU A;  5IIM A;  3RH6 A;  5HHI A;  4IQU A;  3AQL A;  4I27 A;  3HIY A;  5HC9 A;  2ZH6 A;  4RQ1 A;  1KDH A;  4FH5 A;  4R64 A;  2ZH5 A;  4ATB B;  3TFR A;  1ZQC A;  8ICN A;  5HRL A;  4RWP A;  4UAW A;  5J2A A;  4KLJ A;  4QZB A;  2FMP A;  7ICI A;  4KLO A;  2O1P A;  5J0R A;  4FHW A;  5IIO A;  3WFO A;  3HJ1 A;  4MFF A;  5HRB A;  4KLH A;  4AT7 B;  4WC6 A;  4YMN A;  4I2I A;  3C2L A;  4RQ7 A;  4QZH A;  5J0T A;  1ZQE A;  4O5E A;  1R89 A;  4QZ8 A;  3HJ4 A;  3PNC A;  1BPE A;  1VJ7 A;  9ICN A;  1JQR A;  4RWO A;  3C2M A;  5D46 A;  4WC4 A;  4WC0 A;  4F5Q A;  9ICA A;  4DOA A;  8ICC A;  8ICI A;  4WBZ A;  2NRK A;  3UQ0 A;  1ZQA A;  2O5A A;  3V7J A;  4RQ4 A;  4DOC A;  5CHG A;  8ICE A;  3UXN A;  3LQC B;  3WFQ E;  2ZH9 A;  4WBY A;  2DR8 A;  4X4N A;  4GXK A;  4M9N A;  4I2B A;  4Z6D A;  8ICG A;  9ICS A;  1VFG A;  7ICU A;  5DB7 A;  1NOM A;  5J2B A;  5J0P A;  1ZQH A;  4LZG A;  4NKT A;  1RZT A;  5TZV A;  2ISO A;  1KEJ A;  2BCV A;  3JYY A;  3HX0 A;  4UB5 A;  5DB8 A;  4RT3 A;  4QZG A;  3OVB A;  2BCR A;  4KLS A;  2PFQ A;  4YCX A;  3OVA A;  4UB4 A;  1NO5 A;  4PHE A;  4QZI A;  3AQM A;  5DBB A;  1TVA A;  1R8A A;  5BPC A;  4F5O A;  4MF2 A;  5J2G A;  4M5D A;  2ZH4 A;  9ICR A;  4PGX A;  7ICV A;  4XQ7 A;  1ZQZ A;  3V72 A;  4X4T A;  3UPQ A;  7ICP A;  8ICH A;  4GXJ A;  4DOB A;  4KLD A;  1R8C A;  3OUY B;  4KLI A;  4KLT A;  4QZD A;  2IHM A;  2VAN A;  4M9H A;  3ISD A;  4O5C A;  2P66 A;  1HUO A;  1ZQP A;  1ZQV A;  4I2E A;  3H37 A;  2ZH3 A;  3OGU A;  4I2A A;  8ICY A;  4NXZ A;  4I2H A;  4UB1 A;  5DED A;  3WFS C;  7ICR A;  5BOL A;  9ICM A;  1BPX A;  2W9M A;  4E80 A;  5III A;  4YD1 A;  5J0U A;  4UBB A;  5D4B A;  7ICQ A;  4R66 A;  1Q78 A;  3C18 A;  2M2U A;  4S3N A;  4X0A A;  2M2W A;  4MF8 A;  5J2I A;  3JPT A;  1ZQX A;  3V7K A;  8ICO A;  9ICV A;  7ICG A;  4FO6 A;  1XSN A;  5J2E A;  4IQW A;  4QZA A;  3UQ2 A;  8ICU A;  2RFF A;  4X4P A;  3OV7 A;  4X4V A;  3MDA A;  5CJ7 A;  7ICL A;  4M0A A;  2ZH8 A;  4KLE A; 
#chains in the Genus database with same CATH topology
 9ICI A;  1ZQK A;  5CFT A;  4RPY A;  3RJK A;  5BOM A;  7ICO A;  5HRG A;  3UPS A;  5DB9 A;  4NXX A;  4PGY A;  4AT9 A;  2Q66 A;  3AQK A;  1MIY A;  5B3Q A;  3JPQ A;  3UXP A;  4WC3 A;  4XUS A;  4ATB A;  4PH5 A;  1F5A A;  4UD4 A;  5DEC A;  1UEU A;  2FMQ A;  4RQ5 A;  4WC2 A;  1MIV A;  5HRE A;  5IIN A;  4EED A;  4QZF A;  4O6A A;  2ZH7 A;  3V7L A;  2HHP A;  4KLU A;  4TUP A;  9ICU A;  1UEV A;  2PBE A;  5CHE A;  3NWI A;  1ZQM A;  8ICA A;  4AT7 A;  1ZQQ A;  2EWR A;  2BCQ A;  8ICF A;  7ICT A;  5CB1 A;  3JPP A;  5J0Q A;  4QZC A;  1BPY A;  1ZQN A;  4LVS A;  4DO9 A;  4RT2 A;  4AT9 B;  4R63 A;  4F5P A;  1ZQL A;  4RQ8 A;  4M9L A;  2DRA A;  9ICF A;  4X4Q A;  4KLQ A;  4MFA A;  1MQ3 A;  3ISB A;  7ICM A;  5J29 A;  5J0X A;  4KM5 A;  4I2D A;  3JPN A;  4FHV A;  7ICF A;  4LT6 A;  4YMM A;  4O67 A;  3RJE A;  2ZHB A;  4MFC A;  2BPF A;  4Z6E A;  2PXI A;  1R8B A;  3NVO A;  4NXT A;  4E8F A;  3AU2 A;  1ZQT A;  1JAJ A;  9ICL A;  1MIW A;  4X4R A;  4UB2 A;  4PHD A;  1V4A A;  8ICR A;  5J0O A;  5J2F A;  5HRF A;  4I2G A;  4NLN A;  3WFR E;  4WC1 A;  4FH3 A;  3ER9 B;  2PFO A;  2M2T A;  4UB3 A;  3JPO A;  4PHA A;  4JLZ A;  4YN4 A;  3B0X A;  5CA7 A;  5DKW A;  4PGQ A;  4P2H A;  1XSL A;  2IUB A;  5J2D A;  1HUZ A;  3EF2 A;  2ID1 A;  4JWM A;  4EP7 A;  5HRD A;  7ICK A;  1ZQF A;  3JPR A;  3K75 D;  2DRB A;  4LEY A;  4P4O A;  5HHH A;  3MCR A;  4FHP A;  4YMO A;  4K4H A;  4X4O A;  9ICE A;  8ICW A;  5J2H A;  2B4V A;  1TFW A;  3MBY A;  4UD5 A;  8ICJ A;  4OAI Z;  4OAG A;  2BCU A;  8ICL A;  4UBC A;  4K9B A;  4TUQ A;  4QZ9 A;  4X5V A;  4NLZ A;  9ICT A;  4NKU A;  3RJH A;  5DDY A;  1UET A;  3ER8 C;  4F5N A;  2GWS A;  8ICV A;  3RJF A;  5JTG A;  5J0W A;  3AUO A;  8ICM A;  4I2F A;  4PHP A;  3PML A;  1ZQD A;  4M9J A;  3RJI A;  3OUY A;  2I9G A;  8ICB A;  1BPZ A;  7ICN A;  4RPZ A;  1OU5 A;  3H38 A;  4I2J A;  3RH4 A;  3H39 A;  9ICH A;  4K97 A;  5IIK A;  4IQT A;  5DB6 A;  9ICG A;  5D63 A;  4K96 A;  5HR9 A;  7ICE A;  1ZJN A;  9ICX A;  2HN1 A;  4IQV A;  2BE3 A;  4RPX A;  2DVI A;  5J2C A;  4GXI A;  4K4I A;  3WFP A;  2PFP A;  4NXV A;  4K99 A;  1BPD A;  3TFS A;  4AT8 A;  1ZJM A;  3HWT A;  4Z6C A;  1ZQG A;  1ZQO A;  1RPL A;  3C66 A;  4NM1 A;  8ICS A;  4LZD A;  1KNY A;  1ZQS A;  2ZH1 A;  4YD2 A;  5CWR A;  4PPX A;  3C5F A;  4F5R A;  4TUS A;  5DBC A;  4X0B A;  4M9G A;  1JN3 A;  4FHY A;  4NLK A;  4M2Y A;  1BPB A;  3PMN A;  4Z6F A;  8ICZ A;  4LEV A;  2ZHA A;  3RH5 A;  4UAY A;  4K4G A;  3OWG A;  1XSP A;  4M04 A;  3AQN A;  4WC5 A;  4NM2 A;  7ICJ A;  3JPS A;  4I2C A;  9ICW A;  1JMS A;  3L9D A;  5HRH A;  4I28 A;  3C5G A;  7ICS A;  1TV9 A;  4FO1 A;  1ZQB A;  4RQ0 A;  4NXU A;  5IIL A;  4EGW A;  2ZH2 A;  2DR9 A;  3JZ0 A;  3MGI A;  4KLF A;  5HRK A;  4IG8 A;  4N7R A;  5J0Y A;  4FHX A;  8ICX A;  4KLL A;  1MQ2 A;  4RQ6 A;  4JWN A;  1YLQ A;  2DR7 A;  4M47 A;  2PFN A;  7ICH A;  9ICJ A;  2M2V A;  5D49 A;  4EBK A;  8ICP A;  1WOT A;  3LK9 A;  2FMS A;  4LEZ A;  4EBJ A;  5HRI A;  5J2J A;  3ISC A;  2GA9 D;  4XQ8 A;  9ICK A;  5IIJ A;  4KLM A;  4O9M A;  8ICQ A;  8ICT A;  5DBA A;  5J0S A;  3GDX A;  4P4M A;  2ISP A;  4XA5 A;  3NYB A;  1ZQJ A;  4XRH A;  4WC7 A;  4NY8 A;  5B3P A;  3B0Y A;  4TUR A;  4X4S A;  9ICB A;  4I29 A;  5CR0 A;  4EEB A;  2BCS A;  5CP2 A;  9ICO A;  4I0U A;  2BPG A;  4R65 A;  1PX5 A;  4O5K A;  3MGH A;  5EOZ A;  2BPC A;  1ZQY A;  4X4U A;  1ZQI A;  5CFS A;  1FA0 A;  4KLG A;  9ICP A;  5F2V O;  4E7X A;  1TFY A;  3HW8 A;  5D61 A;  4RQ3 A;  1ZQR A;  9ICC A;  4AT8 B;  4RWQ A;  3UXO A;  1ZQW A;  4WCW A;  4RQ2 A;  4P4P A;  3OVS A;  4UAZ A;  4QZE A;  3C2K A;  2BBJ A;  4RWN A;  1Q79 A;  4K98 A;  3RJG A;  8ICK A;  9ICQ A;  2DR5 A;  5DDM A;  3RJJ A;  3AU6 A;  5J2K A;  4JLX A;  3MDC A;  3H3A A;  1ZQU A;  5IIM A;  3RH6 A;  5HHI A;  4O68 A;  4IQU A;  3AQL A;  4I27 A;  3HIY A;  4WOY A;  5HC9 A;  2ZH6 A;  4RQ1 A;  4MKP A;  1KDH A;  4FH5 A;  4R64 A;  2ZH5 A;  4ATB B;  3TFR A;  1ZQC A;  4OAF A;  8ICN A;  5HRL A;  4RWP A;  4UAW A;  5J2A A;  4KLJ A;  4QZB A;  2FMP A;  4XJE A;  7ICI A;  4KLO A;  2O1P A;  5J0R A;  2BBH A;  4FHW A;  5IIO A;  3WFO A;  3HJ1 A;  4K9A A;  4MFF A;  5HRB A;  4KLH A;  4AT7 B;  3CK6 A;  4WC6 A;  4YMN A;  4I2I A;  3C2L A;  4RQ7 A;  4QZH A;  5J0T A;  1ZQE A;  4O5E A;  2HN2 A;  4WQK A;  1R89 A;  4QZ8 A;  3HJ4 A;  3PNC A;  1BPE A;  1VJ7 A;  9ICN A;  1JQR A;  4RWO A;  3C2M A;  5D46 A;  4WC4 A;  4WC0 A;  4F5Q A;  9ICA A;  4DOA A;  8ICC A;  8ICI A;  4WBZ A;  2NRK A;  4WH5 A;  3PHZ A;  3UQ0 A;  1ZQA A;  2O5A A;  5D62 A;  3V7J A;  4RQ4 A;  4DOC A;  5CHG A;  8ICE A;  3UXN A;  3LQC B;  3WFQ E;  2ZH9 A;  4WBY A;  2DR8 A;  4X4N A;  4OAH A;  4GXK A;  4NXW A;  4M9N A;  4I2B A;  4Z6D A;  8ICG A;  9ICS A;  1VFG A;  7ICU A;  5DB7 A;  1NOM A;  5J2B A;  5J0P A;  1ZQH A;  4LZG A;  2FCL A;  3K7D A;  4NKT A;  1RZT A;  5TZV A;  2ISO A;  1KEJ A;  2BCV A;  3JYY A;  3HX0 A;  4UB5 A;  5DB8 A;  4RT3 A;  4QZG A;  3OVB A;  2BCR A;  4KLS A;  2PFQ A;  3ERC C;  4YCX A;  4LEW A;  1GPJ A;  3OVA A;  4UB4 A;  1NO5 A;  4PHE A;  4QZI A;  3AQM A;  5DBB A;  1TVA A;  1R8A A;  5BPC A;  4F5O A;  4MF2 A;  5J2G A;  4M5D A;  2ZH4 A;  5CFU A;  9ICR A;  4PGX A;  7ICV A;  4XQ7 A;  1ZQZ A;  3V72 A;  4K8V A;  4X4T A;  3UPQ A;  7ICP A;  8ICH A;  4GXJ A;  4DOB A;  4KLD A;  1R8C A;  3OUY B;  4KLI A;  4KLT A;  4QZD A;  2IHM A;  2IHO A;  2VAN A;  4M9H A;  3ISD A;  4O5C A;  4O69 A;  4KB6 A;  2P66 A;  1HUO A;  1ZQP A;  4EV6 A;  4WQL A;  1ZQV A;  4I2E A;  3H37 A;  2ZH3 A;  3OGU A;  4HX0 A;  4I2A A;  8ICY A;  4NXZ A;  4I2H A;  4UB1 A;  5DED A;  3WFS C;  7ICR A;  5BOL A;  9ICM A;  1BPX A;  2W9M A;  4E80 A;  5III A;  3NKU A;  3JCF A;  4YD1 A;  5J0U A;  4UBB A;  5D4B A;  7ICQ A;  4R66 A;  1Q78 A;  3C18 A;  2M2U A;  2B51 A;  2B56 A;  4S3N A;  4X0A A;  2M2W A;  4MF8 A;  5J2I A;  3JPT A;  1ZQX A;  3V7K A;  2GAF D;  8ICO A;  9ICV A;  7ICG A;  4FO6 A;  1XSN A;  5J2E A;  4IQW A;  4QZA A;  3UQ2 A;  8ICU A;  2RFF A;  4X4P A;  3OV7 A;  4X4V A;  3MDA A;  5CJ7 A;  7ICL A;  4M0A A;  2ZH8 A;  4KLE A; 
#chains in the Genus database with same CATH homology
 9ICI A;  1ZQK A;  4RPY A;  3RJK A;  5BOM A;  7ICO A;  5HRG A;  3UPS A;  5DB9 A;  4PGY A;  4AT9 A;  2Q66 A;  3AQK A;  1MIY A;  3JPQ A;  3UXP A;  4WC3 A;  4XUS A;  4ATB A;  4PH5 A;  1F5A A;  4UD4 A;  5DEC A;  1UEU A;  2FMQ A;  4RQ5 A;  4WC2 A;  1MIV A;  5HRE A;  5IIN A;  4QZF A;  2ZH7 A;  3V7L A;  2HHP A;  4KLU A;  4TUP A;  9ICU A;  1UEV A;  2PBE A;  1ZQM A;  8ICA A;  4AT7 A;  1ZQQ A;  2BCQ A;  8ICF A;  7ICT A;  5CB1 A;  3JPP A;  5J0Q A;  4QZC A;  1BPY A;  1ZQN A;  4LVS A;  4DO9 A;  4RT2 A;  4AT9 B;  4R63 A;  4F5P A;  1ZQL A;  4RQ8 A;  4M9L A;  2DRA A;  9ICF A;  4X4Q A;  4KLQ A;  4MFA A;  1MQ3 A;  3ISB A;  7ICM A;  5J29 A;  5J0X A;  4I2D A;  3JPN A;  4FHV A;  7ICF A;  4LT6 A;  4YMM A;  3RJE A;  2ZHB A;  4MFC A;  2BPF A;  4Z6E A;  2PXI A;  1R8B A;  4E8F A;  3AU2 A;  1ZQT A;  1JAJ A;  9ICL A;  1MIW A;  4X4R A;  4UB2 A;  4PHD A;  1V4A A;  8ICR A;  5J0O A;  5J2F A;  5HRF A;  4I2G A;  4NLN A;  3WFR E;  4WC1 A;  4FH3 A;  2PFO A;  2M2T A;  4UB3 A;  3JPO A;  4PHA A;  4YN4 A;  3B0X A;  5CA7 A;  5DKW A;  4PGQ A;  4P2H A;  1XSL A;  5J2D A;  1HUZ A;  2ID1 A;  4JWM A;  4EP7 A;  5HRD A;  7ICK A;  1ZQF A;  3JPR A;  3K75 D;  2DRB A;  4P4O A;  5HHH A;  4FHP A;  4YMO A;  4K4H A;  4X4O A;  9ICE A;  8ICW A;  5J2H A;  1TFW A;  3MBY A;  4UD5 A;  8ICJ A;  2BCU A;  8ICL A;  4UBC A;  4TUQ A;  4QZ9 A;  4X5V A;  4NLZ A;  9ICT A;  4NKU A;  3RJH A;  5DDY A;  1UET A;  4F5N A;  2GWS A;  8ICV A;  3RJF A;  5J0W A;  3AUO A;  8ICM A;  4I2F A;  4PHP A;  3PML A;  1ZQD A;  4M9J A;  3RJI A;  3OUY A;  2I9G A;  8ICB A;  1BPZ A;  7ICN A;  4RPZ A;  1OU5 A;  3H38 A;  4I2J A;  3RH4 A;  3H39 A;  9ICH A;  5IIK A;  4IQT A;  5DB6 A;  9ICG A;  5HR9 A;  7ICE A;  1ZJN A;  9ICX A;  4IQV A;  2BE3 A;  4RPX A;  2DVI A;  5J2C A;  4GXI A;  4K4I A;  3WFP A;  2PFP A;  1BPD A;  3TFS A;  4AT8 A;  1ZJM A;  3HWT A;  4Z6C A;  1ZQG A;  1ZQO A;  1RPL A;  3C66 A;  4NM1 A;  8ICS A;  4LZD A;  1KNY A;  1ZQS A;  2ZH1 A;  4YD2 A;  5CWR A;  4PPX A;  3C5F A;  4F5R A;  4TUS A;  5DBC A;  4X0B A;  4M9G A;  1JN3 A;  4FHY A;  4NLK A;  4M2Y A;  1BPB A;  3PMN A;  4Z6F A;  8ICZ A;  2ZHA A;  3RH5 A;  4UAY A;  4K4G A;  1XSP A;  4M04 A;  3AQN A;  4WC5 A;  4NM2 A;  7ICJ A;  3JPS A;  4I2C A;  9ICW A;  1JMS A;  3L9D A;  5HRH A;  4I28 A;  3C5G A;  7ICS A;  1TV9 A;  1ZQB A;  4RQ0 A;  5IIL A;  2ZH2 A;  2DR9 A;  3JZ0 A;  3MGI A;  4KLF A;  5HRK A;  4IG8 A;  5J0Y A;  4FHX A;  8ICX A;  4KLL A;  1MQ2 A;  4RQ6 A;  4JWN A;  1YLQ A;  2DR7 A;  4M47 A;  2PFN A;  7ICH A;  9ICJ A;  2M2V A;  5D49 A;  4EBK A;  8ICP A;  1WOT A;  3LK9 A;  2FMS A;  4EBJ A;  5HRI A;  5J2J A;  3ISC A;  4XQ8 A;  9ICK A;  5IIJ A;  4KLM A;  4O9M A;  8ICQ A;  8ICT A;  5DBA A;  5J0S A;  3GDX A;  4P4M A;  2ISP A;  4XA5 A;  3NYB A;  1ZQJ A;  4XRH A;  4WC7 A;  4NY8 A;  3B0Y A;  4TUR A;  4X4S A;  9ICB A;  4I29 A;  5CR0 A;  2BCS A;  5CP2 A;  9ICO A;  2BPG A;  4R65 A;  1PX5 A;  4O5K A;  3MGH A;  5EOZ A;  2BPC A;  1ZQY A;  4X4U A;  1ZQI A;  1FA0 A;  4KLG A;  9ICP A;  5F2V O;  4E7X A;  1TFY A;  3HW8 A;  4RQ3 A;  1ZQR A;  9ICC A;  4AT8 B;  4RWQ A;  3UXO A;  1ZQW A;  4WCW A;  4RQ2 A;  4P4P A;  3OVS A;  4UAZ A;  4QZE A;  3C2K A;  4RWN A;  1Q79 A;  3RJG A;  8ICK A;  9ICQ A;  2DR5 A;  5DDM A;  3RJJ A;  3AU6 A;  5J2K A;  3MDC A;  3H3A A;  1ZQU A;  5IIM A;  3RH6 A;  5HHI A;  4IQU A;  3AQL A;  4I27 A;  3HIY A;  5HC9 A;  2ZH6 A;  4RQ1 A;  1KDH A;  4FH5 A;  4R64 A;  2ZH5 A;  4ATB B;  3TFR A;  1ZQC A;  8ICN A;  5HRL A;  4RWP A;  4UAW A;  5J2A A;  4KLJ A;  4QZB A;  2FMP A;  7ICI A;  4KLO A;  2O1P A;  5J0R A;  4FHW A;  5IIO A;  3WFO A;  3HJ1 A;  4MFF A;  5HRB A;  4KLH A;  4AT7 B;  4WC6 A;  4YMN A;  4I2I A;  3C2L A;  4RQ7 A;  4QZH A;  5J0T A;  1ZQE A;  4O5E A;  1R89 A;  4QZ8 A;  3HJ4 A;  3PNC A;  1BPE A;  1VJ7 A;  9ICN A;  1JQR A;  4RWO A;  3C2M A;  5D46 A;  4WC4 A;  4WC0 A;  4F5Q A;  9ICA A;  4DOA A;  8ICC A;  8ICI A;  4WBZ A;  2NRK A;  3UQ0 A;  1ZQA A;  2O5A A;  3V7J A;  4RQ4 A;  4DOC A;  5CHG A;  8ICE A;  3UXN A;  3LQC B;  3WFQ E;  2ZH9 A;  4WBY A;  2DR8 A;  4X4N A;  4GXK A;  4M9N A;  4I2B A;  4Z6D A;  8ICG A;  9ICS A;  1VFG A;  7ICU A;  5DB7 A;  1NOM A;  5J2B A;  5J0P A;  1ZQH A;  4LZG A;  4NKT A;  1RZT A;  5TZV A;  2ISO A;  1KEJ A;  2BCV A;  3JYY A;  3HX0 A;  4UB5 A;  5DB8 A;  4RT3 A;  4QZG A;  3OVB A;  2BCR A;  4KLS A;  2PFQ A;  4YCX A;  3OVA A;  4UB4 A;  1NO5 A;  4PHE A;  4QZI A;  3AQM A;  5DBB A;  1TVA A;  1R8A A;  5BPC A;  4F5O A;  4MF2 A;  5J2G A;  4M5D A;  2ZH4 A;  9ICR A;  4PGX A;  7ICV A;  4XQ7 A;  1ZQZ A;  3V72 A;  4X4T A;  3UPQ A;  7ICP A;  8ICH A;  4GXJ A;  4DOB A;  4KLD A;  1R8C A;  3OUY B;  4KLI A;  4KLT A;  4QZD A;  2IHM A;  2VAN A;  4M9H A;  3ISD A;  4O5C A;  2P66 A;  1HUO A;  1ZQP A;  1ZQV A;  4I2E A;  3H37 A;  2ZH3 A;  3OGU A;  4I2A A;  8ICY A;  4NXZ A;  4I2H A;  4UB1 A;  5DED A;  3WFS C;  7ICR A;  5BOL A;  9ICM A;  1BPX A;  2W9M A;  4E80 A;  5III A;  4YD1 A;  5J0U A;  4UBB A;  5D4B A;  7ICQ A;  4R66 A;  1Q78 A;  3C18 A;  2M2U A;  4S3N A;  4X0A A;  2M2W A;  4MF8 A;  5J2I A;  3JPT A;  1ZQX A;  3V7K A;  8ICO A;  9ICV A;  7ICG A;  4FO6 A;  1XSN A;  5J2E A;  4IQW A;  4QZA A;  3UQ2 A;  8ICU A;  2RFF A;  4X4P A;  3OV7 A;  4X4V A;  3MDA A;  5CJ7 A;  7ICL A;  4M0A A;  2ZH8 A;  4KLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...