5HREA

The crystal structure of asfvpolx:dna3 binary complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
177
Chain Sequence
GGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 48
structure length 177
sequence length 177
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hreA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hreA01
7ICJA 4DOAA 3PNCA 2M2VA 4FHWA 3LK9A 5HC9A 2ZH1A 4RQ0A 4KLTA 7ICOA 3ISBA 3L9DA 8ICTA 4M9NA 2I9GA 5DB8A 7ICPA 4KLUA 4P4MA 2DR5A 4JWMA 1ZQRA 4UAWA 3C5FA 1ZQQA 4X4SA 3HJ4A 4YMOA 4RQ2A 3MDCA 3MDAA 4TUSA 1TFWA 3JPSA 4R65A 4NKUA 5J0TA 8ICXA 5EOZA 3RH6A 7ICLA 4XQ7A 4WC2A 4WC3A 8ICGA 3ISCA 2DRAA 3OVBA 5HRLA 3JPTA 4X0AA 3RJHA 4K4GA 1XSPA 4M9JA 4X0BA 2BPGA 4UAZA 8ICSA 4NLNA 3UPQA 4KLQA 4Z6CA 1UEVA 1ZQOA 5IIIA 4RT3A 7ICEA 9ICCA 4GXIA 5DECA 5J2GA 4KLSA 4PGYA 8ICQA 9ICUA 4WC4A 4DO9A 4UB3A 5HRBA 4M47A 5CJ7A 8ICMA 3JPPA 1KNYA 3JPRA 1MIYA 3HWTA 9ICEA 5J2CA 4FHPA 1ZQUA 7ICQA 2PBEA 3MBYA 1VFGA 4R63A 4DOCA 4UBCA 5J0PA 4PGQA 3HJ1A 4X4TA 7ICFA 5DDYA 1F5AA 1BPBA 4I2IA 5D46A 2BCSA 4UB4A 4DOBA 1ZQYA 1JAJA 4RWQA 4KLIA 3AQKA 5D49A 3GDXA 1BPXA 4F5OA 4KLJA 4RQ4A 9ICPA 4IG8A 5J2JA 1JQRA 4K4HA 4IQUA 5J2BA 1ZQSA 5HR9A 1MIVA 2ZH8A 2FMSA 7ICVA 3WFRE 4O9MA 4WBZA 3JZ0A 4WCWA 3V7JA 5F2VO 4GXKA 1UETA 5J0QA 4WC0A 1ZJNA 3OUYB 4P2HA 2W9MA 4WC6A 5J29A 9ICVA 2M2TA 5J0OA 2ZHAA 8ICHA 4UB2A 4E80A 4YD2A 2M2WA 8ICBA 4FH3A 3JPNA 3MGIA 9ICOA 1R8CA 8ICAA 3LQCB 9ICLA 1ZQPA 2BCUA 4F5QA 3RJFA 8ICEA 4O5KA 3AQMA 4YN4A 2DR8A 3MGHA 5IIJA 4RQ3A 4S3NA 8ICKA 1ZQHA 4NM2A 5HRFA 5J0WA 4KLGA 5J0RA 2VANA 8ICLA 3C2KA 1ZQWA 1BPYA 3RJJA 1TVAA 4I2JA 4I2BA 4ATBA 2P66A 1XSLA 3HW8A 5J2HA 4NLZA 4RPZA 4RWNA 5HRIA 4UB5A 4K4IA 4M0AA 1YLQA 1NO5A 1ZQGA 4X4UA 4QZFA 9ICGA 4RWPA 4I28A 4KLFA 4I29A 2ZH4A 1ZQEA 1Q78A 4RPXA 4TUPA 4FHVA 9ICIA 3HX0A 5CWRA 5IIOA 9ICHA 5TZVA 5J2EA 5D4BA 4X5VA 4WBYA 2DVIA 3H37A 7ICKA 2Q66A 3OVAA 2ZH2A 4UBBA 4M5DA 2PFQA 3H38A 1TV9A 4MF2A 4RQ8A 4M9GA 9ICBA 8ICOA 8ICYA 4RQ1A 5IIMA 2BPCA 3JYYA 3WFSC 2GWSA 8ICNA 3RH5A 1KEJA 3HIYA 1XSNA 4E8FA 3V7KA 3PMLA 8ICVA 4NM1A 4QZBA 4KLLA 3JPQA 1BPZA 4FHYA 4TURA 5J0YA 4AT7A 4PHPA 4F5NA 4E7XA 4XUSA 4UD5A 1NOMA 7ICSA 1ZJMA 8ICUA 5BOMA 5IILA 2ZH9A 4QZ8A 5J2FA 2ISPA 3NYBA 1MIWA 2FMPA 4EBKA 4RT2A 4KLDA 3V7LA 3C2MA 5J2DA 9ICSA 5CB1A 5DDMA 5J2AA 4QZGA 2IHMA 4R66A 5CA7A 3C18A 5BOLA 1ZQTA 4I2FA 5HREA 8ICRA 3B0XA 3AU6A 2O1PA 9ICXA 4FO6A 7ICUA 3UXNA 4TUQA 4AT8A 4X4VA 2RFFA 4KLOA 8ICWA 4WC5A 3RJGA 4YD1A 9ICJA 3TFRA 2DR9A 3AUOA 8ICPA 9ICTA 5DKWA 4X4QA 5IIKA 7ICTA 3AU2A 4GXJA 3C2LA 3OVSA 4M04A 3UXOA 1JMSA 2ZHBA 4IQTA 4PHEA 8ICFA 2DRBA 2ID1A 1RPLA 3RJKA 4UB1A 4QZAA 1R89A 4XA5A 4QZEA 1HUZA 4Z6DA 3TFSA 3C66A 4NKTA 4X4NA 1ZQKA 4QZHA 4RQ6A 4M9LA 1WOTA 4AT9A 1ZQMA 8ICIA 1PX5A 4X4RA 9ICQA 5DB6A 3AQLA 4X4OA 3UQ2A 8ICCA 4QZIA 1R8BA 4ATBB 4XRHA 1OU5A 5HRGA 5J0XA 4MF8A 1ZQJA 4PHAA 1ZQDA 7ICHA 5CP2A 4FH5A 4LT6A 5DB9A 2BPFA 4KLMA 1RZTA 4RQ5A 1UEUA 4MFAA 1MQ3A 4PPXA 5HHHA 5HHIA 2ZH7A 4LVSA 5HRHA 3RJIA 2ISOA 4MFCA 9ICRA 3K75D 8ICJA 4YCXA 4O5CA 5DBCA 3RH4A 5DBAA 1FA0A 2BCVA 3H3AA 3WFOA 4QZDA 2PFNA 4PGXA 3B0YA 3PMNA 1ZQZA 7ICMA 5DEDA 1Q79A 1BPDA 1ZQBA 5CHGA 9ICMA 4I2HA 3C5GA 4NY8A 3RJEA 4I27A 3OV7A 5CR0A 5DB7A 4UAYA 3UQ0A 4YMMA 5J0UA 5HRKA 4AT7B 2ZH3A 4KLHA 1R8AA 5BPCA 4WC7A 4I2CA 5J0SA 1ZQFA 4M2YA 2FMQA 5HRDA 5IINA 4KLEA 4RQ7A 4Z6FA 2BCRA 4NLKA 1ZQLA 2DR7A 3WFQE 1ZQCA 1JN3A 1HUOA 3OGUA 7ICIA 3AQNA 4EBJA 3UPSA 2PXIA 4R64A 4MFFA 1V4AA 7ICNA 4M9HA 4PHDA 3V72A 1ZQVA 1VJ7A 4RPYA 4AT8B 2BCQA 2BE3A 7ICGA 2NRKA 4RWOA 4F5RA 4F5PA 4FHXA 1BPEA 4NXZA 4WC1A 4X4PA 5J2IA 4QZ9A 4PH5A 4IQVA 1ZQIA 4I2EA 9ICAA 4I2GA 4P4OA 3H39A 2O5AA 5DBBA 1KDHA 4LZGA 2HHPA 9ICNA 2ZH6A 1ZQAA 4XQ8A 3UXPA 3JPOA 3OUYA 9ICWA 2M2UA 1TFYA 7ICRA 5J2KA 4O5EA 4IQWA 1ZQXA 4P4PA 3ISDA 1MQ2A 8ICZA 2ZH5A 9ICFA 4UD4A 4EP7A 4I2AA 2PFPA 2PFOA 9ICKA 4I2DA 1ZQNA 4LZDA 4YMNA 4JWNA 4AT9B 3WFPA 4Z6EA 4QZCA
chains in the Genus database with same CATH superfamily
5B3QA 7ICJA 4DOAA 3PNCA 2M2VA 4FHWA 3LK9A 5HC9A 2ZH1A 4RQ0A 4KLTA 7ICOA 3ISBA 3L9DA 8ICTA 4M9NA 2I9GA 4LEZA 4K9AA 5DB8A 7ICPA 4K9BA 4KLUA 4O67A 4P4MA 2DR5A 4JWMA 1ZQRA 4UAWA 3C5FA 1ZQQA 4X4SA 3HJ4A 4YMOA 4RQ2A 4WQKA 3ER8C 4OAFA 3MDCA 3MDAA 4TUSA 1TFWA 3JPSA 4R65A 4NKUA 5J0TA 8ICXA 5EOZA 3RH6A 7ICLA 4XQ7A 4WC2A 4WC3A 8ICGA 3ISCA 2DRAA 3OVBA 5HRLA 3JPTA 4X0AA 3CK6A 3RJHA 4K4GA 1XSPA 4M9JA 4X0BA 2BPGA 4UAZA 8ICSA 4NLNA 3UPQA 4KLQA 4Z6CA 1UEVA 1ZQOA 5IIIA 4RT3A 7ICEA 9ICCA 4GXIA 5DECA 5J2GA 4KLSA 4PGYA 8ICQA 9ICUA 4WC4A 4DO9A 3JCFA 4UB3A 5HRBA 4M47A 5CJ7A 8ICMA 3NVOA 3JPPA 1KNYA 3JPRA 1MIYA 3HWTA 9ICEA 5J2CA 4FHPA 1ZQUA 7ICQA 5CHEA 2PBEA 4WQLA 3MBYA 1VFGA 4R63A 4DOCA 4NXTA 4UBCA 5J0PA 4PGQA 3HJ1A 4X4TA 7ICFA 5DDYA 5B3PA 1F5AA 1BPBA 4I2IA 4K96A 5D46A 4EGWA 4KM5A 2BCSA 4UB4A 4DOBA 1ZQYA 1JAJA 4RWQA 4KLIA 3AQKA 5D49A 3GDXA 1BPXA 4F5OA 4KLJA 4RQ4A 9ICPA 4IG8A 5J2JA 1JQRA 4K4HA 4IQUA 5J2BA 1ZQSA 5HR9A 1MIVA 2ZH8A 2FMSA 7ICVA 3WFRE 4O9MA 4WBZA 3JZ0A 4WCWA 3V7JA 5F2VO 4GXKA 1UETA 5J0QA 4WC0A 1ZJNA 3OUYB 4P2HA 2W9MA 4WC6A 5J29A 3ERCC 9ICVA 2M2TA 5J0OA 2ZHAA 8ICHA 4UB2A 4E80A 4YD2A 2M2WA 8ICBA 4FH3A 3JPNA 3MGIA 9ICOA 1R8CA 8ICAA 3LQCB 9ICLA 1ZQPA 2BCUA 4F5QA 3RJFA 4K99A 8ICEA 4O5KA 4LEVA 3AQMA 4NXUA 4YN4A 4WOYA 2DR8A 4I0UA 3MCRA 3K7DA 3MGHA 5IIJA 4OAHA 4RQ3A 4S3NA 8ICKA 1ZQHA 2FCLA 4NM2A 5HRFA 5J0WA 4KLGA 5J0RA 2VANA 8ICLA 3C2KA 1ZQWA 1BPYA 3RJJA 2BBHA 1TVAA 4I2JA 4I2BA 2GA9D 2P66A 4ATBA 1XSLA 3HW8A 5J2HA 4NLZA 4RPZA 3ER9B 4RWNA 5HRIA 4UB5A 4K4IA 4M0AA 1YLQA 1NO5A 1ZQGA 4X4UA 4QZFA 9ICGA 4RWPA 4I28A 4KLFA 4HX0A 4I29A 2ZH4A 1ZQEA 1Q78A 4RPXA 4TUPA 4FHVA 9ICIA 4JLZA 5JTGA 3HX0A 5CWRA 5IIOA 9ICHA 5TZVA 5J2EA 5D4BA 4X5VA 4WBYA 2DVIA 3H37A 7ICKA 2Q66A 3OVAA 2ZH2A 4UBBA 4M5DA 2PFQA 3H38A 1TV9A 4MF2A 2BBJA 4RQ8A 4MKPA 4M9GA 9ICBA 8ICOA 4EV6A 8ICYA 4RQ1A 5IIMA 2BPCA 3JYYA 3WFSC 2GWSA 8ICNA 3RH5A 1KEJA 3HIYA 4N7RA 1XSNA 4E8FA 3V7KA 3PMLA 8ICVA 4NM1A 4QZBA 4LEYA 4KLLA 3JPQA 1BPZA 3EF2A 4FHYA 4WH5A 4TURA 5J0YA 4AT7A 4PHPA 4F5NA 4E7XA 4XUSA 4UD5A 1NOMA 7ICSA 1ZJMA 8ICUA 5BOMA 5IILA 2ZH9A 4QZ8A 2HN2A 2B56A 5J2FA 2ISPA 3NYBA 1MIWA 2FMPA 4EBKA 4RT2A 4KLDA 3V7LA 3C2MA 5J2DA 9ICSA 5CB1A 5DDMA 5J2AA 4QZGA 2IHMA 4R66A 5CA7A 3C18A 5BOLA 1ZQTA 4I2FA 5HREA 8ICRA 3B0XA 3AU6A 2EWRA 2O1PA 9ICXA 4FO6A 7ICUA 3UXNA 4TUQA 4AT8A 4XJEA 4X4VA 2RFFA 4KLOA 8ICWA 4WC5A 3RJGA 4YD1A 9ICJA 4OAGA 3TFRA 2DR9A 3AUOA 8ICPA 9ICTA 5DKWA 4NXXA 4X4QA 5IIKA 7ICTA 3AU2A 4JLXA 4GXJA 3C2LA 3OVSA 4M04A 3UXOA 1JMSA 2ZHBA 4IQTA 4PHEA 8ICFA 2DRBA 2ID1A 4O6AA 1RPLA 3RJKA 4UB1A 4QZAA 1R89A 4XA5A 4QZEA 4KB6A 1HUZA 2GAFD 4Z6DA 3TFSA 3C66A 4NKTA 4X4NA 1ZQKA 4QZHA 4RQ6A 4M9LA 5D63A 1WOTA 4AT9A 4K8VA 1ZQMA 8ICIA 1PX5A 4X4RA 9ICQA 5DB6A 3AQLA 5CFTA 4X4OA 3UQ2A 8ICCA 4QZIA 1R8BA 4ATBB 4XRHA 1OU5A 5HRGA 5J0XA 4MF8A 1ZQJA 4PHAA 1ZQDA 7ICHA 5CP2A 4FH5A 4LT6A 5DB9A 1GPJA 2BPFA 4KLMA 1RZTA 4RQ5A 1UEUA 4MFAA 1MQ3A 4PPXA 5HHHA 5HHIA 2ZH7A 4LVSA 5HRHA 3RJIA 2ISOA 2IHOA 4MFCA 9ICRA 3K75D 8ICJA 4YCXA 4O5CA 5DBCA 3RH4A 5DBAA 1FA0A 2BCVA 3H3AA 3WFOA 4QZDA 2PFNA 4PGXA 3B0YA 3PMNA 1ZQZA 7ICMA 5DEDA 1Q79A 1BPDA 1ZQBA 5CHGA 9ICMA 5CFUA 2IUBA 4I2HA 3C5GA 4EEDA 4NY8A 4EEBA 3RJEA 4I27A 3OV7A 5CR0A 5DB7A 3OWGA 4UAYA 4LEWA 3UQ0A 4YMMA 5D61A 5J0UA 5HRKA 4AT7B 2ZH3A 4KLHA 1R8AA 5BPCA 4WC7A 4I2CA 5J0SA 1ZQFA 4M2YA 4NXWA 2FMQA 5HRDA 5IINA 4KLEA 4RQ7A 4Z6FA 2BCRA 4NLKA 1ZQLA 2DR7A 3WFQE 1ZQCA 1JN3A 1HUOA 3OGUA 7ICIA 3NWIA 3AQNA 4EBJA 3UPSA 2PXIA 4R64A 5CFSA 4MFFA 1V4AA 4O69A 7ICNA 4M9HA 4PHDA 3V72A 1ZQVA 1VJ7A 4RPYA 4AT8B 4K97A 2BCQA 2BE3A 7ICGA 2NRKA 4FO1A 3PHZA 4RWOA 4F5RA 4F5PA 4FHXA 1BPEA 4NXZA 4WC1A 4X4PA 5J2IA 4QZ9A 4PH5A 4IQVA 1ZQIA 4I2EA 9ICAA 4I2GA 4K98A 4P4OA 3H39A 4O68A 2O5AA 5DBBA 1KDHA 4LZGA 2HHPA 9ICNA 2ZH6A 1ZQAA 4XQ8A 3UXPA 3JPOA 2HN1A 3OUYA 9ICWA 2M2UA 1TFYA 7ICRA 5J2KA 4O5EA 4IQWA 1ZQXA 4P4PA 2B51A 3ISDA 1MQ2A 8ICZA 2B4VA 3NKUA 2ZH5A 9ICFA 4UD4A 4EP7A 4I2AA 2PFPA 4NXVA 5D62A 2PFOA 9ICKA 4OAIZ 4I2DA 1ZQNA 4LZDA 4YMNA 4JWNA 4AT9B 3WFPA 4Z6EA 4QZCA
chains in the Genus database with same CATH topology
7ICJA 4DOAA 3PNCA 2M2VA 4FHWA 3LK9A 5HC9A 2ZH1A 4RQ0A 4KLTA 7ICOA 3ISBA 3L9DA 8ICTA 4M9NA 2I9GA 5DB8A 7ICPA 4KLUA 4P4MA 2DR5A 4JWMA 1ZQRA 4UAWA 3C5FA 1ZQQA 4X4SA 3HJ4A 4YMOA 4RQ2A 3MDCA 3MDAA 4TUSA 1TFWA 3JPSA 4R65A 4NKUA 5J0TA 8ICXA 5EOZA 3RH6A 7ICLA 4XQ7A 4WC2A 4WC3A 8ICGA 3ISCA 2DRAA 3OVBA 5HRLA 3JPTA 4X0AA 3RJHA 4K4GA 1XSPA 4M9JA 4X0BA 2BPGA 4UAZA 8ICSA 4NLNA 3UPQA 4KLQA 4Z6CA 1UEVA 1ZQOA 5IIIA 4RT3A 7ICEA 9ICCA 4GXIA 5DECA 5J2GA 4KLSA 4PGYA 8ICQA 9ICUA 4WC4A 4DO9A 4UB3A 5HRBA 4M47A 5CJ7A 8ICMA 3JPPA 1KNYA 3JPRA 1MIYA 3HWTA 9ICEA 5J2CA 4FHPA 1ZQUA 7ICQA 2PBEA 3MBYA 1VFGA 4R63A 4DOCA 4UBCA 5J0PA 4PGQA 3HJ1A 4X4TA 7ICFA 5DDYA 1F5AA 1BPBA 4I2IA 5D46A 2BCSA 4UB4A 4DOBA 1ZQYA 1JAJA 4RWQA 4KLIA 3AQKA 5D49A 3GDXA 1BPXA 4F5OA 4KLJA 4RQ4A 9ICPA 4IG8A 5J2JA 1JQRA 4K4HA 4IQUA 5J2BA 1ZQSA 5HR9A 1MIVA 2ZH8A 2FMSA 7ICVA 3WFRE 4O9MA 4WBZA 3JZ0A 4WCWA 3V7JA 5F2VO 4GXKA 1UETA 5J0QA 4WC0A 1ZJNA 3OUYB 4P2HA 2W9MA 4WC6A 5J29A 9ICVA 2M2TA 5J0OA 2ZHAA 8ICHA 4UB2A 4E80A 4YD2A 2M2WA 8ICBA 4FH3A 3JPNA 3MGIA 9ICOA 1R8CA 8ICAA 3LQCB 9ICLA 1ZQPA 2BCUA 4F5QA 3RJFA 8ICEA 4O5KA 3AQMA 4YN4A 2DR8A 3MGHA 5IIJA 4RQ3A 4S3NA 8ICKA 1ZQHA 4NM2A 5HRFA 5J0WA 4KLGA 5J0RA 2VANA 8ICLA 3C2KA 1ZQWA 1BPYA 3RJJA 1TVAA 4I2JA 4I2BA 4ATBA 2P66A 1XSLA 3HW8A 5J2HA 4NLZA 4RPZA 4RWNA 5HRIA 4UB5A 4K4IA 4M0AA 1YLQA 1NO5A 1ZQGA 4X4UA 4QZFA 9ICGA 4RWPA 4I28A 4KLFA 4I29A 2ZH4A 1ZQEA 1Q78A 4RPXA 4TUPA 4FHVA 9ICIA 3HX0A 5CWRA 5IIOA 9ICHA 5TZVA 5J2EA 5D4BA 4X5VA 4WBYA 2DVIA 3H37A 7ICKA 2Q66A 3OVAA 2ZH2A 4UBBA 4M5DA 2PFQA 3H38A 1TV9A 4MF2A 4RQ8A 4M9GA 9ICBA 8ICOA 8ICYA 4RQ1A 5IIMA 2BPCA 3JYYA 3WFSC 2GWSA 8ICNA 3RH5A 1KEJA 3HIYA 1XSNA 4E8FA 3V7KA 3PMLA 8ICVA 4NM1A 4QZBA 4KLLA 3JPQA 1BPZA 4FHYA 4TURA 5J0YA 4AT7A 4PHPA 4F5NA 4E7XA 4XUSA 4UD5A 1NOMA 7ICSA 1ZJMA 8ICUA 5BOMA 5IILA 2ZH9A 4QZ8A 5J2FA 2ISPA 3NYBA 1MIWA 2FMPA 4EBKA 4RT2A 4KLDA 3V7LA 3C2MA 5J2DA 9ICSA 5CB1A 5DDMA 5J2AA 4QZGA 2IHMA 4R66A 5CA7A 3C18A 5BOLA 1ZQTA 4I2FA 5HREA 8ICRA 3B0XA 3AU6A 2O1PA 9ICXA 4FO6A 7ICUA 3UXNA 4TUQA 4AT8A 4X4VA 2RFFA 4KLOA 8ICWA 4WC5A 3RJGA 4YD1A 9ICJA 3TFRA 2DR9A 3AUOA 8ICPA 9ICTA 5DKWA 4X4QA 5IIKA 7ICTA 3AU2A 4GXJA 3C2LA 3OVSA 4M04A 3UXOA 1JMSA 2ZHBA 4IQTA 4PHEA 8ICFA 2DRBA 2ID1A 1RPLA 3RJKA 4UB1A 4QZAA 1R89A 4XA5A 4QZEA 1HUZA 4Z6DA 3TFSA 3C66A 4NKTA 4X4NA 1ZQKA 4QZHA 4RQ6A 4M9LA 1WOTA 4AT9A 1ZQMA 8ICIA 1PX5A 4X4RA 9ICQA 5DB6A 3AQLA 4X4OA 3UQ2A 8ICCA 4QZIA 1R8BA 4ATBB 4XRHA 1OU5A 5HRGA 5J0XA 4MF8A 1ZQJA 4PHAA 1ZQDA 7ICHA 5CP2A 4FH5A 4LT6A 5DB9A 2BPFA 4KLMA 1RZTA 4RQ5A 1UEUA 4MFAA 1MQ3A 4PPXA 5HHHA 5HHIA 2ZH7A 4LVSA 5HRHA 3RJIA 2ISOA 4MFCA 9ICRA 3K75D 8ICJA 4YCXA 4O5CA 5DBCA 3RH4A 5DBAA 1FA0A 2BCVA 3H3AA 3WFOA 4QZDA 2PFNA 4PGXA 3B0YA 3PMNA 1ZQZA 7ICMA 5DEDA 1Q79A 1BPDA 1ZQBA 5CHGA 9ICMA 4I2HA 3C5GA 4NY8A 3RJEA 4I27A 3OV7A 5CR0A 5DB7A 4UAYA 3UQ0A 4YMMA 5J0UA 5HRKA 4AT7B 2ZH3A 4KLHA 1R8AA 5BPCA 4WC7A 4I2CA 5J0SA 1ZQFA 4M2YA 2FMQA 5HRDA 5IINA 4KLEA 4RQ7A 4Z6FA 2BCRA 4NLKA 1ZQLA 2DR7A 3WFQE 1ZQCA 1JN3A 1HUOA 3OGUA 7ICIA 3AQNA 4EBJA 3UPSA 2PXIA 4R64A 4MFFA 1V4AA 7ICNA 4M9HA 4PHDA 3V72A 1ZQVA 1VJ7A 4RPYA 4AT8B 2BCQA 2BE3A 7ICGA 2NRKA 4RWOA 4F5RA 4F5PA 4FHXA 1BPEA 4NXZA 4WC1A 4X4PA 5J2IA 4QZ9A 4PH5A 4IQVA 1ZQIA 4I2EA 9ICAA 4I2GA 4P4OA 3H39A 2O5AA 5DBBA 1KDHA 4LZGA 2HHPA 9ICNA 2ZH6A 1ZQAA 4XQ8A 3UXPA 3JPOA 3OUYA 9ICWA 2M2UA 1TFYA 7ICRA 5J2KA 4O5EA 4IQWA 1ZQXA 4P4PA 3ISDA 1MQ2A 8ICZA 2ZH5A 9ICFA 4UD4A 4EP7A 4I2AA 2PFPA 2PFOA 9ICKA 4I2DA 1ZQNA 4LZDA 4YMNA 4JWNA 4AT9B 3WFPA 4Z6EA 4QZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICJ A;  4DOA A;  3PNC A;  2M2V A;  4FHW A;  3LK9 A;  5HC9 A;  2ZH1 A;  4RQ0 A;  4KLT A;  7ICO A;  3ISB A;  3L9D A;  8ICT A;  4M9N A;  2I9G A;  5DB8 A;  7ICP A;  4KLU A;  4P4M A;  2DR5 A;  4JWM A;  1ZQR A;  4UAW A;  3C5F A;  1ZQQ A;  4X4S A;  3HJ4 A;  4YMO A;  4RQ2 A;  3MDC A;  3MDA A;  4TUS A;  1TFW A;  3JPS A;  4R65 A;  4NKU A;  5J0T A;  8ICX A;  5EOZ A;  3RH6 A;  7ICL A;  4XQ7 A;  4WC2 A;  4WC3 A;  8ICG A;  3ISC A;  2DRA A;  3OVB A;  5HRL A;  3JPT A;  4X0A A;  3RJH A;  4K4G A;  1XSP A;  4M9J A;  4X0B A;  2BPG A;  4UAZ A;  8ICS A;  4NLN A;  3UPQ A;  4KLQ A;  4Z6C A;  1UEV A;  1ZQO A;  5III A;  4RT3 A;  7ICE A;  9ICC A;  4GXI A;  5DEC A;  5J2G A;  4KLS A;  4PGY A;  8ICQ A;  9ICU A;  4WC4 A;  4DO9 A;  4UB3 A;  5HRB A;  4M47 A;  5CJ7 A;  8ICM A;  3JPP A;  1KNY A;  3JPR A;  1MIY A;  3HWT A;  9ICE A;  5J2C A;  4FHP A;  1ZQU A;  7ICQ A;  2PBE A;  3MBY A;  1VFG A;  4R63 A;  4DOC A;  4UBC A;  5J0P A;  4PGQ A;  3HJ1 A;  4X4T A;  7ICF A;  5DDY A;  1F5A A;  1BPB A;  4I2I A;  5D46 A;  2BCS A;  4UB4 A;  4DOB A;  1ZQY A;  1JAJ A;  4RWQ A;  4KLI A;  3AQK A;  5D49 A;  3GDX A;  1BPX A;  4F5O A;  4KLJ A;  4RQ4 A;  9ICP A;  4IG8 A;  5J2J A;  1JQR A;  4K4H A;  4IQU A;  5J2B A;  1ZQS A;  5HR9 A;  1MIV A;  2ZH8 A;  2FMS A;  7ICV A;  3WFR E;  4O9M A;  4WBZ A;  3JZ0 A;  4WCW A;  3V7J A;  5F2V O;  4GXK A;  1UET A;  5J0Q A;  4WC0 A;  1ZJN A;  3OUY B;  4P2H A;  2W9M A;  4WC6 A;  5J29 A;  9ICV A;  2M2T A;  5J0O A;  2ZHA A;  8ICH A;  4UB2 A;  4E80 A;  4YD2 A;  2M2W A;  8ICB A;  4FH3 A;  3JPN A;  3MGI A;  9ICO A;  1R8C A;  8ICA A;  3LQC B;  9ICL A;  1ZQP A;  2BCU A;  4F5Q A;  3RJF A;  8ICE A;  4O5K A;  3AQM A;  4YN4 A;  2DR8 A;  3MGH A;  5IIJ A;  4RQ3 A;  4S3N A;  8ICK A;  1ZQH A;  4NM2 A;  5HRF A;  5J0W A;  4KLG A;  5J0R A;  2VAN A;  8ICL A;  3C2K A;  1ZQW A;  1BPY A;  3RJJ A;  1TVA A;  4I2J A;  4I2B A;  4ATB A;  2P66 A;  1XSL A;  3HW8 A;  5J2H A;  4NLZ A;  4RPZ A;  4RWN A;  5HRI A;  4UB5 A;  4K4I A;  4M0A A;  1YLQ A;  1NO5 A;  1ZQG A;  4X4U A;  4QZF A;  9ICG A;  4RWP A;  4I28 A;  4KLF A;  4I29 A;  2ZH4 A;  1ZQE A;  1Q78 A;  4RPX A;  4TUP A;  4FHV A;  9ICI A;  3HX0 A;  5CWR A;  5IIO A;  9ICH A;  5TZV A;  5J2E A;  5D4B A;  4X5V A;  4WBY A;  2DVI A;  3H37 A;  7ICK A;  2Q66 A;  3OVA A;  2ZH2 A;  4UBB A;  4M5D A;  2PFQ A;  3H38 A;  1TV9 A;  4MF2 A;  4RQ8 A;  4M9G A;  9ICB A;  8ICO A;  8ICY A;  4RQ1 A;  5IIM A;  2BPC A;  3JYY A;  3WFS C;  2GWS A;  8ICN A;  3RH5 A;  1KEJ A;  3HIY A;  1XSN A;  4E8F A;  3V7K A;  3PML A;  8ICV A;  4NM1 A;  4QZB A;  4KLL A;  3JPQ A;  1BPZ A;  4FHY A;  4TUR A;  5J0Y A;  4AT7 A;  4PHP A;  4F5N A;  4E7X A;  4XUS A;  4UD5 A;  1NOM A;  7ICS A;  1ZJM A;  8ICU A;  5BOM A;  5IIL A;  2ZH9 A;  4QZ8 A;  5J2F A;  2ISP A;  3NYB A;  1MIW A;  2FMP A;  4EBK A;  4RT2 A;  4KLD A;  3V7L A;  3C2M A;  5J2D A;  9ICS A;  5CB1 A;  5DDM A;  5J2A A;  4QZG A;  2IHM A;  4R66 A;  5CA7 A;  3C18 A;  5BOL A;  1ZQT A;  4I2F A;  5HRE A;  8ICR A;  3B0X A;  3AU6 A;  2O1P A;  9ICX A;  4FO6 A;  7ICU A;  3UXN A;  4TUQ A;  4AT8 A;  4X4V A;  2RFF A;  4KLO A;  8ICW A;  4WC5 A;  3RJG A;  4YD1 A;  9ICJ A;  3TFR A;  2DR9 A;  3AUO A;  8ICP A;  9ICT A;  5DKW A;  4X4Q A;  5IIK A;  7ICT A;  3AU2 A;  4GXJ A;  3C2L A;  3OVS A;  4M04 A;  3UXO A;  1JMS A;  2ZHB A;  4IQT A;  4PHE A;  8ICF A;  2DRB A;  2ID1 A;  1RPL A;  3RJK A;  4UB1 A;  4QZA A;  1R89 A;  4XA5 A;  4QZE A;  1HUZ A;  4Z6D A;  3TFS A;  3C66 A;  4NKT A;  4X4N A;  1ZQK A;  4QZH A;  4RQ6 A;  4M9L A;  1WOT A;  4AT9 A;  1ZQM A;  8ICI A;  1PX5 A;  4X4R A;  9ICQ A;  5DB6 A;  3AQL A;  4X4O A;  3UQ2 A;  8ICC A;  4QZI A;  1R8B A;  4ATB B;  4XRH A;  1OU5 A;  5HRG A;  5J0X A;  4MF8 A;  1ZQJ A;  4PHA A;  1ZQD A;  7ICH A;  5CP2 A;  4FH5 A;  4LT6 A;  5DB9 A;  2BPF A;  4KLM A;  1RZT A;  4RQ5 A;  1UEU A;  4MFA A;  1MQ3 A;  4PPX A;  5HHH A;  5HHI A;  2ZH7 A;  4LVS A;  5HRH A;  3RJI A;  2ISO A;  4MFC A;  9ICR A;  3K75 D;  8ICJ A;  4YCX A;  4O5C A;  5DBC A;  3RH4 A;  5DBA A;  1FA0 A;  2BCV A;  3H3A A;  3WFO A;  4QZD A;  2PFN A;  4PGX A;  3B0Y A;  3PMN A;  1ZQZ A;  7ICM A;  5DED A;  1Q79 A;  1BPD A;  1ZQB A;  5CHG A;  9ICM A;  4I2H A;  3C5G A;  4NY8 A;  3RJE A;  4I27 A;  3OV7 A;  5CR0 A;  5DB7 A;  4UAY A;  3UQ0 A;  4YMM A;  5J0U A;  5HRK A;  4AT7 B;  2ZH3 A;  4KLH A;  1R8A A;  5BPC A;  4WC7 A;  4I2C A;  5J0S A;  1ZQF A;  4M2Y A;  2FMQ A;  5HRD A;  5IIN A;  4KLE A;  4RQ7 A;  4Z6F A;  2BCR A;  4NLK A;  1ZQL A;  2DR7 A;  3WFQ E;  1ZQC A;  1JN3 A;  1HUO A;  3OGU A;  7ICI A;  3AQN A;  4EBJ A;  3UPS A;  2PXI A;  4R64 A;  4MFF A;  1V4A A;  7ICN A;  4M9H A;  4PHD A;  3V72 A;  1ZQV A;  1VJ7 A;  4RPY A;  4AT8 B;  2BCQ A;  2BE3 A;  7ICG A;  2NRK A;  4RWO A;  4F5R A;  4F5P A;  4FHX A;  1BPE A;  4NXZ A;  4WC1 A;  4X4P A;  5J2I A;  4QZ9 A;  4PH5 A;  4IQV A;  1ZQI A;  4I2E A;  9ICA A;  4I2G A;  4P4O A;  3H39 A;  2O5A A;  5DBB A;  1KDH A;  4LZG A;  2HHP A;  9ICN A;  2ZH6 A;  1ZQA A;  4XQ8 A;  3UXP A;  3JPO A;  3OUY A;  9ICW A;  2M2U A;  1TFY A;  7ICR A;  5J2K A;  4O5E A;  4IQW A;  1ZQX A;  4P4P A;  3ISD A;  1MQ2 A;  8ICZ A;  2ZH5 A;  9ICF A;  4UD4 A;  4EP7 A;  4I2A A;  2PFP A;  2PFO A;  9ICK A;  4I2D A;  1ZQN A;  4LZD A;  4YMN A;  4JWN A;  4AT9 B;  3WFP A;  4Z6E A;  4QZC A; 
#chains in the Genus database with same CATH topology
 5B3Q A;  7ICJ A;  4DOA A;  3PNC A;  2M2V A;  4FHW A;  3LK9 A;  5HC9 A;  2ZH1 A;  4RQ0 A;  4KLT A;  7ICO A;  3ISB A;  3L9D A;  8ICT A;  4M9N A;  2I9G A;  4LEZ A;  4K9A A;  5DB8 A;  7ICP A;  4K9B A;  4KLU A;  4O67 A;  4P4M A;  2DR5 A;  4JWM A;  1ZQR A;  4UAW A;  3C5F A;  1ZQQ A;  4X4S A;  3HJ4 A;  4YMO A;  4RQ2 A;  4WQK A;  3ER8 C;  4OAF A;  3MDC A;  3MDA A;  4TUS A;  1TFW A;  3JPS A;  4R65 A;  4NKU A;  5J0T A;  8ICX A;  5EOZ A;  3RH6 A;  7ICL A;  4XQ7 A;  4WC2 A;  4WC3 A;  8ICG A;  3ISC A;  2DRA A;  3OVB A;  5HRL A;  3JPT A;  4X0A A;  3CK6 A;  3RJH A;  4K4G A;  1XSP A;  4M9J A;  4X0B A;  2BPG A;  4UAZ A;  8ICS A;  4NLN A;  3UPQ A;  4KLQ A;  4Z6C A;  1UEV A;  1ZQO A;  5III A;  4RT3 A;  7ICE A;  9ICC A;  4GXI A;  5DEC A;  5J2G A;  4KLS A;  4PGY A;  8ICQ A;  9ICU A;  4WC4 A;  4DO9 A;  3JCF A;  4UB3 A;  5HRB A;  4M47 A;  5CJ7 A;  8ICM A;  3NVO A;  3JPP A;  1KNY A;  3JPR A;  1MIY A;  3HWT A;  9ICE A;  5J2C A;  4FHP A;  1ZQU A;  7ICQ A;  5CHE A;  2PBE A;  4WQL A;  3MBY A;  1VFG A;  4R63 A;  4DOC A;  4NXT A;  4UBC A;  5J0P A;  4PGQ A;  3HJ1 A;  4X4T A;  7ICF A;  5DDY A;  5B3P A;  1F5A A;  1BPB A;  4I2I A;  4K96 A;  5D46 A;  4EGW A;  4KM5 A;  2BCS A;  4UB4 A;  4DOB A;  1ZQY A;  1JAJ A;  4RWQ A;  4KLI A;  3AQK A;  5D49 A;  3GDX A;  1BPX A;  4F5O A;  4KLJ A;  4RQ4 A;  9ICP A;  4IG8 A;  5J2J A;  1JQR A;  4K4H A;  4IQU A;  5J2B A;  1ZQS A;  5HR9 A;  1MIV A;  2ZH8 A;  2FMS A;  7ICV A;  3WFR E;  4O9M A;  4WBZ A;  3JZ0 A;  4WCW A;  3V7J A;  5F2V O;  4GXK A;  1UET A;  5J0Q A;  4WC0 A;  1ZJN A;  3OUY B;  4P2H A;  2W9M A;  4WC6 A;  5J29 A;  3ERC C;  9ICV A;  2M2T A;  5J0O A;  2ZHA A;  8ICH A;  4UB2 A;  4E80 A;  4YD2 A;  2M2W A;  8ICB A;  4FH3 A;  3JPN A;  3MGI A;  9ICO A;  1R8C A;  8ICA A;  3LQC B;  9ICL A;  1ZQP A;  2BCU A;  4F5Q A;  3RJF A;  4K99 A;  8ICE A;  4O5K A;  4LEV A;  3AQM A;  4NXU A;  4YN4 A;  4WOY A;  2DR8 A;  4I0U A;  3MCR A;  3K7D A;  3MGH A;  5IIJ A;  4OAH A;  4RQ3 A;  4S3N A;  8ICK A;  1ZQH A;  2FCL A;  4NM2 A;  5HRF A;  5J0W A;  4KLG A;  5J0R A;  2VAN A;  8ICL A;  3C2K A;  1ZQW A;  1BPY A;  3RJJ A;  2BBH A;  1TVA A;  4I2J A;  4I2B A;  2GA9 D;  2P66 A;  4ATB A;  1XSL A;  3HW8 A;  5J2H A;  4NLZ A;  4RPZ A;  3ER9 B;  4RWN A;  5HRI A;  4UB5 A;  4K4I A;  4M0A A;  1YLQ A;  1NO5 A;  1ZQG A;  4X4U A;  4QZF A;  9ICG A;  4RWP A;  4I28 A;  4KLF A;  4HX0 A;  4I29 A;  2ZH4 A;  1ZQE A;  1Q78 A;  4RPX A;  4TUP A;  4FHV A;  9ICI A;  4JLZ A;  5JTG A;  3HX0 A;  5CWR A;  5IIO A;  9ICH A;  5TZV A;  5J2E A;  5D4B A;  4X5V A;  4WBY A;  2DVI A;  3H37 A;  7ICK A;  2Q66 A;  3OVA A;  2ZH2 A;  4UBB A;  4M5D A;  2PFQ A;  3H38 A;  1TV9 A;  4MF2 A;  2BBJ A;  4RQ8 A;  4MKP A;  4M9G A;  9ICB A;  8ICO A;  4EV6 A;  8ICY A;  4RQ1 A;  5IIM A;  2BPC A;  3JYY A;  3WFS C;  2GWS A;  8ICN A;  3RH5 A;  1KEJ A;  3HIY A;  4N7R A;  1XSN A;  4E8F A;  3V7K A;  3PML A;  8ICV A;  4NM1 A;  4QZB A;  4LEY A;  4KLL A;  3JPQ A;  1BPZ A;  3EF2 A;  4FHY A;  4WH5 A;  4TUR A;  5J0Y A;  4AT7 A;  4PHP A;  4F5N A;  4E7X A;  4XUS A;  4UD5 A;  1NOM A;  7ICS A;  1ZJM A;  8ICU A;  5BOM A;  5IIL A;  2ZH9 A;  4QZ8 A;  2HN2 A;  2B56 A;  5J2F A;  2ISP A;  3NYB A;  1MIW A;  2FMP A;  4EBK A;  4RT2 A;  4KLD A;  3V7L A;  3C2M A;  5J2D A;  9ICS A;  5CB1 A;  5DDM A;  5J2A A;  4QZG A;  2IHM A;  4R66 A;  5CA7 A;  3C18 A;  5BOL A;  1ZQT A;  4I2F A;  5HRE A;  8ICR A;  3B0X A;  3AU6 A;  2EWR A;  2O1P A;  9ICX A;  4FO6 A;  7ICU A;  3UXN A;  4TUQ A;  4AT8 A;  4XJE A;  4X4V A;  2RFF A;  4KLO A;  8ICW A;  4WC5 A;  3RJG A;  4YD1 A;  9ICJ A;  4OAG A;  3TFR A;  2DR9 A;  3AUO A;  8ICP A;  9ICT A;  5DKW A;  4NXX A;  4X4Q A;  5IIK A;  7ICT A;  3AU2 A;  4JLX A;  4GXJ A;  3C2L A;  3OVS A;  4M04 A;  3UXO A;  1JMS A;  2ZHB A;  4IQT A;  4PHE A;  8ICF A;  2DRB A;  2ID1 A;  4O6A A;  1RPL A;  3RJK A;  4UB1 A;  4QZA A;  1R89 A;  4XA5 A;  4QZE A;  4KB6 A;  1HUZ A;  2GAF D;  4Z6D A;  3TFS A;  3C66 A;  4NKT A;  4X4N A;  1ZQK A;  4QZH A;  4RQ6 A;  4M9L A;  5D63 A;  1WOT A;  4AT9 A;  4K8V A;  1ZQM A;  8ICI A;  1PX5 A;  4X4R A;  9ICQ A;  5DB6 A;  3AQL A;  5CFT A;  4X4O A;  3UQ2 A;  8ICC A;  4QZI A;  1R8B A;  4ATB B;  4XRH A;  1OU5 A;  5HRG A;  5J0X A;  4MF8 A;  1ZQJ A;  4PHA A;  1ZQD A;  7ICH A;  5CP2 A;  4FH5 A;  4LT6 A;  5DB9 A;  1GPJ A;  2BPF A;  4KLM A;  1RZT A;  4RQ5 A;  1UEU A;  4MFA A;  1MQ3 A;  4PPX A;  5HHH A;  5HHI A;  2ZH7 A;  4LVS A;  5HRH A;  3RJI A;  2ISO A;  2IHO A;  4MFC A;  9ICR A;  3K75 D;  8ICJ A;  4YCX A;  4O5C A;  5DBC A;  3RH4 A;  5DBA A;  1FA0 A;  2BCV A;  3H3A A;  3WFO A;  4QZD A;  2PFN A;  4PGX A;  3B0Y A;  3PMN A;  1ZQZ A;  7ICM A;  5DED A;  1Q79 A;  1BPD A;  1ZQB A;  5CHG A;  9ICM A;  5CFU A;  2IUB A;  4I2H A;  3C5G A;  4EED A;  4NY8 A;  4EEB A;  3RJE A;  4I27 A;  3OV7 A;  5CR0 A;  5DB7 A;  3OWG A;  4UAY A;  4LEW A;  3UQ0 A;  4YMM A;  5D61 A;  5J0U A;  5HRK A;  4AT7 B;  2ZH3 A;  4KLH A;  1R8A A;  5BPC A;  4WC7 A;  4I2C A;  5J0S A;  1ZQF A;  4M2Y A;  4NXW A;  2FMQ A;  5HRD A;  5IIN A;  4KLE A;  4RQ7 A;  4Z6F A;  2BCR A;  4NLK A;  1ZQL A;  2DR7 A;  3WFQ E;  1ZQC A;  1JN3 A;  1HUO A;  3OGU A;  7ICI A;  3NWI A;  3AQN A;  4EBJ A;  3UPS A;  2PXI A;  4R64 A;  5CFS A;  4MFF A;  1V4A A;  4O69 A;  7ICN A;  4M9H A;  4PHD A;  3V72 A;  1ZQV A;  1VJ7 A;  4RPY A;  4AT8 B;  4K97 A;  2BCQ A;  2BE3 A;  7ICG A;  2NRK A;  4FO1 A;  3PHZ A;  4RWO A;  4F5R A;  4F5P A;  4FHX A;  1BPE A;  4NXZ A;  4WC1 A;  4X4P A;  5J2I A;  4QZ9 A;  4PH5 A;  4IQV A;  1ZQI A;  4I2E A;  9ICA A;  4I2G A;  4K98 A;  4P4O A;  3H39 A;  4O68 A;  2O5A A;  5DBB A;  1KDH A;  4LZG A;  2HHP A;  9ICN A;  2ZH6 A;  1ZQA A;  4XQ8 A;  3UXP A;  3JPO A;  2HN1 A;  3OUY A;  9ICW A;  2M2U A;  1TFY A;  7ICR A;  5J2K A;  4O5E A;  4IQW A;  1ZQX A;  4P4P A;  2B51 A;  3ISD A;  1MQ2 A;  8ICZ A;  2B4V A;  3NKU A;  2ZH5 A;  9ICF A;  4UD4 A;  4EP7 A;  4I2A A;  2PFP A;  4NXV A;  5D62 A;  2PFO A;  9ICK A;  4OAI Z;  4I2D A;  1ZQN A;  4LZD A;  4YMN A;  4JWN A;  4AT9 B;  3WFP A;  4Z6E A;  4QZC A; 
#chains in the Genus database with same CATH homology
 7ICJ A;  4DOA A;  3PNC A;  2M2V A;  4FHW A;  3LK9 A;  5HC9 A;  2ZH1 A;  4RQ0 A;  4KLT A;  7ICO A;  3ISB A;  3L9D A;  8ICT A;  4M9N A;  2I9G A;  5DB8 A;  7ICP A;  4KLU A;  4P4M A;  2DR5 A;  4JWM A;  1ZQR A;  4UAW A;  3C5F A;  1ZQQ A;  4X4S A;  3HJ4 A;  4YMO A;  4RQ2 A;  3MDC A;  3MDA A;  4TUS A;  1TFW A;  3JPS A;  4R65 A;  4NKU A;  5J0T A;  8ICX A;  5EOZ A;  3RH6 A;  7ICL A;  4XQ7 A;  4WC2 A;  4WC3 A;  8ICG A;  3ISC A;  2DRA A;  3OVB A;  5HRL A;  3JPT A;  4X0A A;  3RJH A;  4K4G A;  1XSP A;  4M9J A;  4X0B A;  2BPG A;  4UAZ A;  8ICS A;  4NLN A;  3UPQ A;  4KLQ A;  4Z6C A;  1UEV A;  1ZQO A;  5III A;  4RT3 A;  7ICE A;  9ICC A;  4GXI A;  5DEC A;  5J2G A;  4KLS A;  4PGY A;  8ICQ A;  9ICU A;  4WC4 A;  4DO9 A;  4UB3 A;  5HRB A;  4M47 A;  5CJ7 A;  8ICM A;  3JPP A;  1KNY A;  3JPR A;  1MIY A;  3HWT A;  9ICE A;  5J2C A;  4FHP A;  1ZQU A;  7ICQ A;  2PBE A;  3MBY A;  1VFG A;  4R63 A;  4DOC A;  4UBC A;  5J0P A;  4PGQ A;  3HJ1 A;  4X4T A;  7ICF A;  5DDY A;  1F5A A;  1BPB A;  4I2I A;  5D46 A;  2BCS A;  4UB4 A;  4DOB A;  1ZQY A;  1JAJ A;  4RWQ A;  4KLI A;  3AQK A;  5D49 A;  3GDX A;  1BPX A;  4F5O A;  4KLJ A;  4RQ4 A;  9ICP A;  4IG8 A;  5J2J A;  1JQR A;  4K4H A;  4IQU A;  5J2B A;  1ZQS A;  5HR9 A;  1MIV A;  2ZH8 A;  2FMS A;  7ICV A;  3WFR E;  4O9M A;  4WBZ A;  3JZ0 A;  4WCW A;  3V7J A;  5F2V O;  4GXK A;  1UET A;  5J0Q A;  4WC0 A;  1ZJN A;  3OUY B;  4P2H A;  2W9M A;  4WC6 A;  5J29 A;  9ICV A;  2M2T A;  5J0O A;  2ZHA A;  8ICH A;  4UB2 A;  4E80 A;  4YD2 A;  2M2W A;  8ICB A;  4FH3 A;  3JPN A;  3MGI A;  9ICO A;  1R8C A;  8ICA A;  3LQC B;  9ICL A;  1ZQP A;  2BCU A;  4F5Q A;  3RJF A;  8ICE A;  4O5K A;  3AQM A;  4YN4 A;  2DR8 A;  3MGH A;  5IIJ A;  4RQ3 A;  4S3N A;  8ICK A;  1ZQH A;  4NM2 A;  5HRF A;  5J0W A;  4KLG A;  5J0R A;  2VAN A;  8ICL A;  3C2K A;  1ZQW A;  1BPY A;  3RJJ A;  1TVA A;  4I2J A;  4I2B A;  4ATB A;  2P66 A;  1XSL A;  3HW8 A;  5J2H A;  4NLZ A;  4RPZ A;  4RWN A;  5HRI A;  4UB5 A;  4K4I A;  4M0A A;  1YLQ A;  1NO5 A;  1ZQG A;  4X4U A;  4QZF A;  9ICG A;  4RWP A;  4I28 A;  4KLF A;  4I29 A;  2ZH4 A;  1ZQE A;  1Q78 A;  4RPX A;  4TUP A;  4FHV A;  9ICI A;  3HX0 A;  5CWR A;  5IIO A;  9ICH A;  5TZV A;  5J2E A;  5D4B A;  4X5V A;  4WBY A;  2DVI A;  3H37 A;  7ICK A;  2Q66 A;  3OVA A;  2ZH2 A;  4UBB A;  4M5D A;  2PFQ A;  3H38 A;  1TV9 A;  4MF2 A;  4RQ8 A;  4M9G A;  9ICB A;  8ICO A;  8ICY A;  4RQ1 A;  5IIM A;  2BPC A;  3JYY A;  3WFS C;  2GWS A;  8ICN A;  3RH5 A;  1KEJ A;  3HIY A;  1XSN A;  4E8F A;  3V7K A;  3PML A;  8ICV A;  4NM1 A;  4QZB A;  4KLL A;  3JPQ A;  1BPZ A;  4FHY A;  4TUR A;  5J0Y A;  4AT7 A;  4PHP A;  4F5N A;  4E7X A;  4XUS A;  4UD5 A;  1NOM A;  7ICS A;  1ZJM A;  8ICU A;  5BOM A;  5IIL A;  2ZH9 A;  4QZ8 A;  5J2F A;  2ISP A;  3NYB A;  1MIW A;  2FMP A;  4EBK A;  4RT2 A;  4KLD A;  3V7L A;  3C2M A;  5J2D A;  9ICS A;  5CB1 A;  5DDM A;  5J2A A;  4QZG A;  2IHM A;  4R66 A;  5CA7 A;  3C18 A;  5BOL A;  1ZQT A;  4I2F A;  5HRE A;  8ICR A;  3B0X A;  3AU6 A;  2O1P A;  9ICX A;  4FO6 A;  7ICU A;  3UXN A;  4TUQ A;  4AT8 A;  4X4V A;  2RFF A;  4KLO A;  8ICW A;  4WC5 A;  3RJG A;  4YD1 A;  9ICJ A;  3TFR A;  2DR9 A;  3AUO A;  8ICP A;  9ICT A;  5DKW A;  4X4Q A;  5IIK A;  7ICT A;  3AU2 A;  4GXJ A;  3C2L A;  3OVS A;  4M04 A;  3UXO A;  1JMS A;  2ZHB A;  4IQT A;  4PHE A;  8ICF A;  2DRB A;  2ID1 A;  1RPL A;  3RJK A;  4UB1 A;  4QZA A;  1R89 A;  4XA5 A;  4QZE A;  1HUZ A;  4Z6D A;  3TFS A;  3C66 A;  4NKT A;  4X4N A;  1ZQK A;  4QZH A;  4RQ6 A;  4M9L A;  1WOT A;  4AT9 A;  1ZQM A;  8ICI A;  1PX5 A;  4X4R A;  9ICQ A;  5DB6 A;  3AQL A;  4X4O A;  3UQ2 A;  8ICC A;  4QZI A;  1R8B A;  4ATB B;  4XRH A;  1OU5 A;  5HRG A;  5J0X A;  4MF8 A;  1ZQJ A;  4PHA A;  1ZQD A;  7ICH A;  5CP2 A;  4FH5 A;  4LT6 A;  5DB9 A;  2BPF A;  4KLM A;  1RZT A;  4RQ5 A;  1UEU A;  4MFA A;  1MQ3 A;  4PPX A;  5HHH A;  5HHI A;  2ZH7 A;  4LVS A;  5HRH A;  3RJI A;  2ISO A;  4MFC A;  9ICR A;  3K75 D;  8ICJ A;  4YCX A;  4O5C A;  5DBC A;  3RH4 A;  5DBA A;  1FA0 A;  2BCV A;  3H3A A;  3WFO A;  4QZD A;  2PFN A;  4PGX A;  3B0Y A;  3PMN A;  1ZQZ A;  7ICM A;  5DED A;  1Q79 A;  1BPD A;  1ZQB A;  5CHG A;  9ICM A;  4I2H A;  3C5G A;  4NY8 A;  3RJE A;  4I27 A;  3OV7 A;  5CR0 A;  5DB7 A;  4UAY A;  3UQ0 A;  4YMM A;  5J0U A;  5HRK A;  4AT7 B;  2ZH3 A;  4KLH A;  1R8A A;  5BPC A;  4WC7 A;  4I2C A;  5J0S A;  1ZQF A;  4M2Y A;  2FMQ A;  5HRD A;  5IIN A;  4KLE A;  4RQ7 A;  4Z6F A;  2BCR A;  4NLK A;  1ZQL A;  2DR7 A;  3WFQ E;  1ZQC A;  1JN3 A;  1HUO A;  3OGU A;  7ICI A;  3AQN A;  4EBJ A;  3UPS A;  2PXI A;  4R64 A;  4MFF A;  1V4A A;  7ICN A;  4M9H A;  4PHD A;  3V72 A;  1ZQV A;  1VJ7 A;  4RPY A;  4AT8 B;  2BCQ A;  2BE3 A;  7ICG A;  2NRK A;  4RWO A;  4F5R A;  4F5P A;  4FHX A;  1BPE A;  4NXZ A;  4WC1 A;  4X4P A;  5J2I A;  4QZ9 A;  4PH5 A;  4IQV A;  1ZQI A;  4I2E A;  9ICA A;  4I2G A;  4P4O A;  3H39 A;  2O5A A;  5DBB A;  1KDH A;  4LZG A;  2HHP A;  9ICN A;  2ZH6 A;  1ZQA A;  4XQ8 A;  3UXP A;  3JPO A;  3OUY A;  9ICW A;  2M2U A;  1TFY A;  7ICR A;  5J2K A;  4O5E A;  4IQW A;  1ZQX A;  4P4P A;  3ISD A;  1MQ2 A;  8ICZ A;  2ZH5 A;  9ICF A;  4UD4 A;  4EP7 A;  4I2A A;  2PFP A;  2PFO A;  9ICK A;  4I2D A;  1ZQN A;  4LZD A;  4YMN A;  4JWN A;  4AT9 B;  3WFP A;  4Z6E A;  4QZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...