5HRGA

The crystal structure of asfvpolx(d51n mutant):dna4 binary complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
177
Chain Sequence
GGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVNLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 48
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrgA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrgA01
1BPBA 3WFPA 4EBJA 3AU2A 3MDAA 4KLDA 2ZHBA 3RJEA 8ICRA 5DECA 1BPXA 4F5OA 4XRHA 1BPZA 3V72A 5HR9A 5DKWA 7ICQA 3JPPA 2ZH4A 3AUOA 4UAWA 1UETA 4KLSA 1ZQNA 2BPCA 4RQ1A 3JPSA 5J2JA 4XUSA 1RZTA 8ICTA 4M9LA 4LVSA 1MIWA 4NKUA 5J0RA 4KLQA 5HRKA 3RJHA 9ICJA 8ICOA 4RQ0A 8ICIA 8ICSA 4WCWA 7ICLA 4UB3A 4I2JA 3JPQA 3C18A 3C2KA 2M2VA 4R66A 3GDXA 3RH5A 3JPOA 3ISBA 5IIMA 9ICUA 4JWNA 2M2WA 1JAJA 9ICSA 2DVIA 4PHEA 2DR7A 2DR5A 3UPQA 4F5PA 9ICBA 3V7LA 2M2TA 4RQ6A 5J2HA 4TURA 3RJIA 3JPNA 4NXZA 4GXKA 4PHPA 5CB1A 5DBCA 4YMOA 2FMPA 5J2CA 5HHIA 4UD5A 4PGYA 4WC1A 2M2UA 5HRDA 9ICNA 4RWPA 7ICJA 3TFRA 3H3AA 3JPTA 9ICIA 3HWTA 5HRFA 5D4BA 4QZAA 1ZQAA 2I9GA 2ZH2A 4O5KA 3C2LA 4AT9B 4XA5A 3C5GA 3HIYA 4AT9A 1ZQFA 4M9GA 4X4QA 5J0WA 4F5NA 4DO9A 4GXJA 4NLZA 9ICOA 3OV7A 4YMMA 5IIIA 4K4GA 1ZQOA 8ICUA 8ICXA 4KLMA 8ICYA 1NOMA 3C5FA 4QZHA 2FMSA 1ZQPA 4IG8A 3WFSC 1ZQJA 5D49A 1ZQIA 3B0YA 5J2DA 8ICFA 4I2HA 8ICEA 2HHPA 5BPCA 4JWMA 4XQ7A 4I2AA 1ZQXA 5HHHA 4F5RA 4M9HA 9ICTA 3H37A 3MDCA 1ZJMA 3UQ2A 5J0SA 4RT2A 5HC9A 1ZQUA 1KEJA 5J0QA 1ZQTA 1VFGA 3JPRA 4RPYA 4P4OA 3OVAA 4QZCA 3AQNA 5HRIA 4WC5A 4DOCA 4PGQA 3LQCB 4MFCA 4DOBA 1JQRA 1ZQBA 4RWQA 5J29A 4QZ8A 4I2BA 1ZQVA 3HJ4A 3HW8A 2PBEA 2RFFA 5CJ7A 4ATBA 4AT8B 4AT8A 4FH5A 4NLNA 4RWNA 7ICUA 1PX5A 1ZQRA 5IIOA 4RQ7A 1UEUA 3JYYA 5BOLA 3V7JA 5DBAA 1HUOA 9ICXA 5J0YA 4LT6A 2DR8A 1ZQLA 4PGXA 4I2CA 4E80A 1R8BA 3MGHA 5TZVA 5CHGA 1KNYA 3UPSA 7ICFA 2P66A 3JZ0A 4KLOA 1OU5A 5EOZA 4KLIA 3OGUA 4EP7A 8ICNA 9ICCA 4RPXA 4TUQA 4TUSA 5IINA 1BPYA 1TFYA 8ICQA 3OUYA 4YD2A 1R8AA 4YCXA 1ZQKA 4X4OA 4NLKA 4NM1A 3OVSA 3NYBA 7ICMA 2DRBA 2BCUA 2ID1A 4RQ4A 4QZIA 1R89A 2DR9A 9ICMA 2ZH7A 7ICGA 3MGIA 5J0UA 4PHAA 3WFRE 7ICPA 1V4AA 8ICJA 4K4HA 3HX0A 4P4MA 1ZQEA 1WOTA 3L9DA 4DOAA 5IIJA 2PFOA 1UEVA 3PMLA 4GXIA 3MBYA 4M9JA 5CR0A 3WFOA 2ZH6A 5CWRA 4I2FA 1XSPA 1XSNA 2PFPA 9ICEA 4R65A 4PPXA 4FO6A 4Z6FA 1ZQMA 5DEDA 4MFAA 8ICLA 3RJGA 1RPLA 4TUPA 4RQ8A 2FMQA 2BCQA 4WC4A 4X4NA 4R64A 4I2EA 4RQ3A 2PFQA 4NY8A 5J2EA 4QZDA 4UAZA 3AQKA 3H39A 4KLGA 4KLHA 9ICQA 1JMSA 4IQVA 1Q78A 4FH3A 1ZQHA 5DDMA 4QZGA 4M47A 3C66A 2Q66A 7ICOA 1R8CA 4S3NA 7ICRA 5BOMA 4UB2A 1MQ3A 1YLQA 5DB9A 4UB4A 7ICEA 4KLTA 5F2VO 3TFSA 4I2IA 1ZJNA 1TV9A 5DB7A 1ZQZA 4X4PA 4YMNA 8ICVA 4MFFA 4IQUA 4KLLA 5J2BA 4Z6DA 1MIYA 2BPFA 5HRHA 4QZ9A 3V7KA 8ICMA 8ICKA 1FA0A 3C2MA 5J0OA 9ICPA 4WC6A 8ICWA 4ATBB 4QZEA 5DB6A 3LK9A 1JN3A 4O5CA 3AU6A 1TVAA 1ZQYA 7ICSA 4FHPA 7ICTA 4IQTA 4UBBA 9ICRA 1MIVA 3PNCA 4EBKA 4I2GA 4KLFA 7ICNA 1Q79A 8ICCA 5J2FA 4WC0A 3B0XA 3AQLA 4LZDA 1NO5A 9ICVA 3H38A 5J2KA 2DRAA 4O5EA 3PMNA 4WBZA 4WC2A 1ZQDA 4MF2A 1ZQWA 3AQMA 5IIKA 5J2IA 4FHYA 4RT3A 7ICIA 4UB5A 3ISCA 4RPZA 3OUYB 1VJ7A 4WC7A 3UXOA 4M0AA 7ICVA 2ZH5A 4X4TA 5IILA 4AT7B 7ICHA 4AT7A 5HRGA 2NRKA 4UAYA 2IHMA 4E8FA 2ZH1A 4M2YA 5J2GA 1ZQGA 9ICKA 4RQ5A 4MF8A 1XSLA 2BCRA 2VANA 4Z6CA 4FHWA 2ZH8A 3HJ1A 5HREA 4RQ2A 4IQWA 1BPDA 8ICAA 4YN4A 2ZHAA 4XQ8A 4UB1A 4X5VA 1ZQCA 4K4IA 4KLEA 4E7XA 4M9NA 4KLUA 4NM2A 3UQ0A 7ICKA 5DBBA 2ISOA 2ZH3A 1ZQSA 1ZQQA 4NKTA 9ICAA 2BPGA 4P4PA 9ICWA 5J0XA 4UBCA 2PXIA 3RJJA 8ICZA 1HUZA 4R63A 1MQ2A 5HRBA 8ICPA 3OVBA 2BE3A 5D46A 4I27A 4I29A 8ICHA 5J2AA 4FHVA 2PFNA 1TFWA 5CA7A 3RJKA 4KLJA 5DB8A 4X4UA 3WFQE 9ICGA 4QZFA 1BPEA 2BCSA 4YD1A 5J0TA 4M04A 9ICFA 5DDYA 4F5QA 5CP2A 3RH4A 2ZH9A 4FHXA 4WBYA 3UXNA 2GWSA 9ICLA 4I2DA 8ICGA 1F5AA 3RJFA 4UD4A 5HRLA 4X4RA 4WC3A 2W9MA 4QZBA 4I28A 2ISPA 4M5DA 4RWOA 4X0BA 3K75D 5J0PA 4X4SA 9ICHA 3RH6A 4PH5A 4X0AA 4LZGA 3ISDA 4PHDA 4X4VA 2O5AA 1KDHA 4P2HA 4Z6EA 3UXPA 2BCVA 4O9MA 8ICBA 2O1PA
chains in the Genus database with same CATH superfamily
1BPBA 3WFPA 4EBJA 3AU2A 3MDAA 4KLDA 2ZHBA 3RJEA 8ICRA 5DECA 1BPXA 4LEYA 4F5OA 4XRHA 1BPZA 3V72A 5HR9A 5DKWA 7ICQA 3JPPA 2ZH4A 3AUOA 4UAWA 1UETA 4KLSA 1ZQNA 2BPCA 4RQ1A 4LEVA 3JPSA 5J2JA 4XUSA 1RZTA 8ICTA 4M9LA 4LVSA 1MIWA 4NKUA 2BBHA 5J0RA 1GPJA 4KLQA 4OAGA 3JCFA 5HRKA 3MCRA 3RJHA 9ICJA 8ICOA 4RQ0A 8ICIA 8ICSA 4WCWA 4KB6A 3ER8C 4EEDA 7ICLA 4UB3A 4I0UA 4I2JA 4N7RA 3JPQA 3C18A 3C2KA 2M2VA 4R66A 4WH5A 3GDXA 3RH5A 3JPOA 3ISBA 5IIMA 9ICUA 4JWNA 4HX0A 2M2WA 1JAJA 9ICSA 2DVIA 4PHEA 4WOYA 2DR7A 2DR5A 3UPQA 4F5PA 9ICBA 3NWIA 3V7LA 2M2TA 4RQ6A 5J2HA 4TURA 3RJIA 3JPNA 4NXZA 4GXKA 5CHEA 4PHPA 5CB1A 5DBCA 4YMOA 2FMPA 5J2CA 4K98A 5HHIA 4UD5A 2GAFD 4PGYA 4WC1A 2M2UA 5HRDA 9ICNA 4RWPA 4OAIZ 7ICJA 3TFRA 3H3AA 2HN2A 3JPTA 9ICIA 3HWTA 5HRFA 5D4BA 4QZAA 1ZQAA 2I9GA 2ZH2A 4O5KA 3C2LA 4AT9B 4XA5A 3C5GA 3HIYA 4AT9A 1ZQFA 4M9GA 4X4QA 5J0WA 4F5NA 4DO9A 4GXJA 2B56A 4NLZA 9ICOA 3OV7A 4NXTA 4YMMA 5IIIA 4K4GA 1ZQOA 2IUBA 8ICUA 8ICXA 4KLMA 8ICYA 1NOMA 3C5FA 4QZHA 2FMSA 1ZQPA 4IG8A 3WFSC 1ZQJA 5D49A 1ZQIA 3B0YA 5J2DA 8ICFA 4I2HA 8ICEA 2HHPA 5BPCA 4JWMA 4XQ7A 4I2AA 1ZQXA 5HHHA 4F5RA 4M9HA 9ICTA 5CFSA 3H37A 3MDCA 1ZJMA 3UQ2A 5J0SA 4RT2A 2FCLA 5HC9A 1ZQUA 1KEJA 3OWGA 5J0QA 1ZQTA 1VFGA 3JPRA 4RPYA 4P4OA 3OVAA 4QZCA 3AQNA 5HRIA 4WC5A 4DOCA 4PGQA 3LQCB 4MFCA 4DOBA 1JQRA 1ZQBA 4RWQA 5J29A 4QZ8A 4I2BA 1ZQVA 3HJ4A 3HW8A 2PBEA 2RFFA 5CJ7A 4ATBA 4AT8B 4AT8A 4FH5A 4NLNA 4RWNA 7ICUA 1PX5A 1ZQRA 5JTGA 5IIOA 4RQ7A 1UEUA 3JYYA 4KM5A 5BOLA 3V7JA 5DBAA 1HUOA 9ICXA 5J0YA 4LT6A 2DR8A 1ZQLA 4PGXA 4I2CA 4E80A 1R8BA 3MGHA 3K7DA 5TZVA 5CHGA 1KNYA 3UPSA 7ICFA 2P66A 3JZ0A 4KLOA 1OU5A 5EOZA 4KLIA 3OGUA 4EP7A 8ICNA 9ICCA 4RPXA 4TUQA 4TUSA 5IINA 1BPYA 1TFYA 8ICQA 3OUYA 5D61A 4YD2A 1R8AA 4YCXA 1ZQKA 4K9BA 4X4OA 4NLKA 5D62A 4NM1A 3OVSA 3NYBA 7ICMA 2DRBA 2BCUA 4NXXA 2ID1A 4RQ4A 4QZIA 1R89A 4K8VA 5CFUA 2DR9A 9ICMA 2ZH7A 7ICGA 3MGIA 5J0UA 4PHAA 3WFRE 7ICPA 1V4AA 8ICJA 4K4HA 3HX0A 4P4MA 1ZQEA 1WOTA 3L9DA 4DOAA 5B3PA 5IIJA 2PFOA 1UEVA 3PMLA 4GXIA 3MBYA 4M9JA 5CR0A 3WFOA 2ZH6A 5CWRA 4OAFA 4I2FA 1XSPA 4FO1A 4JLXA 5B3QA 1XSNA 2PFPA 9ICEA 4R65A 4PPXA 4FO6A 4Z6FA 1ZQMA 5DEDA 4MFAA 8ICLA 3RJGA 3EF2A 1RPLA 4TUPA 4RQ8A 2FMQA 2BCQA 4WC4A 4X4NA 4R64A 4I2EA 4RQ3A 2PFQA 4NY8A 3NVOA 5J2EA 4QZDA 4UAZA 3AQKA 3H39A 4KLGA 4KLHA 9ICQA 1JMSA 4IQVA 1Q78A 4FH3A 1ZQHA 3ER9B 5DDMA 4QZGA 4M47A 3C66A 2Q66A 7ICOA 1R8CA 4S3NA 7ICRA 5BOMA 4NXVA 4UB2A 1MQ3A 1YLQA 5DB9A 4UB4A 4K9AA 7ICEA 3PHZA 4KLTA 5F2VO 3TFSA 4I2IA 1ZJNA 1TV9A 5DB7A 1ZQZA 4EEBA 4X4PA 4YMNA 8ICVA 4MFFA 4IQUA 4KLLA 5J2BA 4Z6DA 1MIYA 2BPFA 5HRHA 4QZ9A 3V7KA 8ICMA 4O67A 8ICKA 1FA0A 3C2MA 5J0OA 9ICPA 4WC6A 8ICWA 4ATBB 4QZEA 5DB6A 3LK9A 1JN3A 4O5CA 3AU6A 1TVAA 2BBJA 4K96A 1ZQYA 7ICSA 4FHPA 7ICTA 4IQTA 4UBBA 9ICRA 1MIVA 2EWRA 3PNCA 4NXUA 4EBKA 4I2GA 4KLFA 7ICNA 1Q79A 8ICCA 5J2FA 4WC0A 3NKUA 3B0XA 3AQLA 4LZDA 1NO5A 4O69A 9ICVA 3H38A 5J2KA 2DRAA 4O5EA 3PMNA 4WBZA 4WC2A 1ZQDA 4O6AA 4MF2A 4O68A 2B4VA 1ZQWA 3AQMA 5IIKA 5J2IA 4FHYA 4RT3A 7ICIA 4UB5A 3ISCA 4RPZA 3OUYB 1VJ7A 4WC7A 3UXOA 4M0AA 7ICVA 2GA9D 2B51A 4X4TA 5IILA 2ZH5A 4AT7B 7ICHA 4AT7A 5HRGA 2NRKA 4UAYA 2IHMA 4E8FA 2ZH1A 4M2YA 5J2GA 1ZQGA 9ICKA 4RQ5A 4MF8A 1XSLA 4WQKA 2BCRA 2VANA 4Z6CA 4FHWA 2ZH8A 3HJ1A 5HREA 4RQ2A 4IQWA 1BPDA 8ICAA 4YN4A 2ZHAA 4XQ8A 4UB1A 4X5VA 1ZQCA 4K4IA 4KLEA 4K99A 4E7XA 4M9NA 4KLUA 5CFTA 4NM2A 3UQ0A 4MKPA 7ICKA 5DBBA 2ISOA 4K97A 2ZH3A 1ZQSA 1ZQQA 4NKTA 9ICAA 4JLZA 2BPGA 4P4PA 4LEWA 9ICWA 5J0XA 4UBCA 2PXIA 3RJJA 8ICZA 1HUZA 4R63A 1MQ2A 5HRBA 8ICPA 3OVBA 2BE3A 5D46A 4I27A 4I29A 4EGWA 8ICHA 5J2AA 3ERCC 4FHVA 2PFNA 1TFWA 5CA7A 3RJKA 4KLJA 5DB8A 2HN1A 4WQLA 5D63A 4X4UA 3WFQE 9ICGA 4QZFA 1BPEA 2BCSA 4YD1A 5J0TA 4M04A 9ICFA 5DDYA 4F5QA 5CP2A 3RH4A 2ZH9A 4FHXA 4WBYA 3UXNA 2GWSA 9ICLA 2IHOA 4I2DA 8ICGA 1F5AA 3RJFA 4UD4A 4LEZA 5HRLA 4X4RA 4NXWA 4WC3A 2W9MA 4XJEA 4QZBA 4I28A 3CK6A 2ISPA 4M5DA 4RWOA 4X0BA 3K75D 5J0PA 4X4SA 9ICHA 3RH6A 4EV6A 4PH5A 4X0AA 4LZGA 3ISDA 4PHDA 4X4VA 2O5AA 1KDHA 4P2HA 4Z6EA 3UXPA 2BCVA 4O9MA 4OAHA 8ICBA 2O1PA
chains in the Genus database with same CATH topology
1BPBA 3WFPA 4EBJA 3AU2A 3MDAA 4KLDA 2ZHBA 3RJEA 8ICRA 5DECA 1BPXA 4F5OA 4XRHA 1BPZA 3V72A 5HR9A 5DKWA 7ICQA 3JPPA 2ZH4A 3AUOA 4UAWA 1UETA 4KLSA 1ZQNA 2BPCA 4RQ1A 3JPSA 5J2JA 4XUSA 1RZTA 8ICTA 4M9LA 4LVSA 1MIWA 4NKUA 5J0RA 4KLQA 5HRKA 3RJHA 9ICJA 8ICOA 4RQ0A 8ICIA 8ICSA 4WCWA 7ICLA 4UB3A 4I2JA 3JPQA 3C18A 3C2KA 2M2VA 4R66A 3GDXA 3RH5A 3JPOA 3ISBA 5IIMA 9ICUA 4JWNA 2M2WA 1JAJA 9ICSA 2DVIA 4PHEA 2DR7A 2DR5A 3UPQA 4F5PA 9ICBA 3V7LA 2M2TA 4RQ6A 5J2HA 4TURA 3RJIA 3JPNA 4NXZA 4GXKA 4PHPA 5CB1A 5DBCA 4YMOA 2FMPA 5J2CA 5HHIA 4UD5A 4PGYA 4WC1A 2M2UA 5HRDA 9ICNA 4RWPA 7ICJA 3TFRA 3H3AA 3JPTA 9ICIA 3HWTA 5HRFA 5D4BA 4QZAA 1ZQAA 2I9GA 2ZH2A 4O5KA 3C2LA 4AT9B 4XA5A 3C5GA 3HIYA 4AT9A 1ZQFA 4M9GA 4X4QA 5J0WA 4F5NA 4DO9A 4GXJA 4NLZA 9ICOA 3OV7A 4YMMA 5IIIA 4K4GA 1ZQOA 8ICUA 8ICXA 4KLMA 8ICYA 1NOMA 3C5FA 4QZHA 2FMSA 1ZQPA 4IG8A 3WFSC 1ZQJA 5D49A 1ZQIA 3B0YA 5J2DA 8ICFA 4I2HA 8ICEA 2HHPA 5BPCA 4JWMA 4XQ7A 4I2AA 1ZQXA 5HHHA 4F5RA 4M9HA 9ICTA 3H37A 3MDCA 1ZJMA 3UQ2A 5J0SA 4RT2A 5HC9A 1ZQUA 1KEJA 5J0QA 1ZQTA 1VFGA 3JPRA 4RPYA 4P4OA 3OVAA 4QZCA 3AQNA 5HRIA 4WC5A 4DOCA 4PGQA 3LQCB 4MFCA 4DOBA 1JQRA 1ZQBA 4RWQA 5J29A 4QZ8A 4I2BA 1ZQVA 3HJ4A 3HW8A 2PBEA 2RFFA 5CJ7A 4ATBA 4AT8B 4AT8A 4FH5A 4NLNA 4RWNA 7ICUA 1PX5A 1ZQRA 5IIOA 4RQ7A 1UEUA 3JYYA 5BOLA 3V7JA 5DBAA 1HUOA 9ICXA 5J0YA 4LT6A 2DR8A 1ZQLA 4PGXA 4I2CA 4E80A 1R8BA 3MGHA 5TZVA 5CHGA 1KNYA 3UPSA 7ICFA 2P66A 3JZ0A 4KLOA 1OU5A 5EOZA 4KLIA 3OGUA 4EP7A 8ICNA 9ICCA 4RPXA 4TUQA 4TUSA 5IINA 1BPYA 1TFYA 8ICQA 3OUYA 4YD2A 1R8AA 4YCXA 1ZQKA 4X4OA 4NLKA 4NM1A 3OVSA 3NYBA 7ICMA 2DRBA 2BCUA 2ID1A 4RQ4A 4QZIA 1R89A 2DR9A 9ICMA 2ZH7A 7ICGA 3MGIA 5J0UA 4PHAA 3WFRE 7ICPA 1V4AA 8ICJA 4K4HA 3HX0A 4P4MA 1ZQEA 1WOTA 3L9DA 4DOAA 5IIJA 2PFOA 1UEVA 3PMLA 4GXIA 3MBYA 4M9JA 5CR0A 3WFOA 2ZH6A 5CWRA 4I2FA 1XSPA 1XSNA 2PFPA 9ICEA 4R65A 4PPXA 4FO6A 4Z6FA 1ZQMA 5DEDA 4MFAA 8ICLA 3RJGA 1RPLA 4TUPA 4RQ8A 2FMQA 2BCQA 4WC4A 4X4NA 4R64A 4I2EA 4RQ3A 2PFQA 4NY8A 5J2EA 4QZDA 4UAZA 3AQKA 3H39A 4KLGA 4KLHA 9ICQA 1JMSA 4IQVA 1Q78A 4FH3A 1ZQHA 5DDMA 4QZGA 4M47A 3C66A 2Q66A 7ICOA 1R8CA 4S3NA 7ICRA 5BOMA 4UB2A 1MQ3A 1YLQA 5DB9A 4UB4A 7ICEA 4KLTA 5F2VO 3TFSA 4I2IA 1ZJNA 1TV9A 5DB7A 1ZQZA 4X4PA 4YMNA 8ICVA 4MFFA 4IQUA 4KLLA 5J2BA 4Z6DA 1MIYA 2BPFA 5HRHA 4QZ9A 3V7KA 8ICMA 8ICKA 1FA0A 3C2MA 5J0OA 9ICPA 4WC6A 8ICWA 4ATBB 4QZEA 5DB6A 3LK9A 1JN3A 4O5CA 3AU6A 1TVAA 1ZQYA 7ICSA 4FHPA 7ICTA 4IQTA 4UBBA 9ICRA 1MIVA 3PNCA 4EBKA 4I2GA 4KLFA 7ICNA 1Q79A 8ICCA 5J2FA 4WC0A 3B0XA 3AQLA 4LZDA 1NO5A 9ICVA 3H38A 5J2KA 2DRAA 4O5EA 3PMNA 4WBZA 4WC2A 1ZQDA 4MF2A 1ZQWA 3AQMA 5IIKA 5J2IA 4FHYA 4RT3A 7ICIA 4UB5A 3ISCA 4RPZA 3OUYB 1VJ7A 4WC7A 3UXOA 4M0AA 7ICVA 2ZH5A 4X4TA 5IILA 4AT7B 7ICHA 4AT7A 5HRGA 2NRKA 4UAYA 2IHMA 4E8FA 2ZH1A 4M2YA 5J2GA 1ZQGA 9ICKA 4RQ5A 4MF8A 1XSLA 2BCRA 2VANA 4Z6CA 4FHWA 2ZH8A 3HJ1A 5HREA 4RQ2A 4IQWA 1BPDA 8ICAA 4YN4A 2ZHAA 4XQ8A 4UB1A 4X5VA 1ZQCA 4K4IA 4KLEA 4E7XA 4M9NA 4KLUA 4NM2A 3UQ0A 7ICKA 5DBBA 2ISOA 2ZH3A 1ZQSA 1ZQQA 4NKTA 9ICAA 2BPGA 4P4PA 9ICWA 5J0XA 4UBCA 2PXIA 3RJJA 8ICZA 1HUZA 4R63A 1MQ2A 5HRBA 8ICPA 3OVBA 2BE3A 5D46A 4I27A 4I29A 8ICHA 5J2AA 4FHVA 2PFNA 1TFWA 5CA7A 3RJKA 4KLJA 5DB8A 4X4UA 3WFQE 9ICGA 4QZFA 1BPEA 2BCSA 4YD1A 5J0TA 4M04A 9ICFA 5DDYA 4F5QA 5CP2A 3RH4A 2ZH9A 4FHXA 4WBYA 3UXNA 2GWSA 9ICLA 4I2DA 8ICGA 1F5AA 3RJFA 4UD4A 5HRLA 4X4RA 4WC3A 2W9MA 4QZBA 4I28A 2ISPA 4M5DA 4RWOA 4X0BA 3K75D 5J0PA 4X4SA 9ICHA 3RH6A 4PH5A 4X0AA 4LZGA 3ISDA 4PHDA 4X4VA 2O5AA 1KDHA 4P2HA 4Z6EA 3UXPA 2BCVA 4O9MA 8ICBA 2O1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPB A;  3WFP A;  4EBJ A;  3AU2 A;  3MDA A;  4KLD A;  2ZHB A;  3RJE A;  8ICR A;  5DEC A;  1BPX A;  4F5O A;  4XRH A;  1BPZ A;  3V72 A;  5HR9 A;  5DKW A;  7ICQ A;  3JPP A;  2ZH4 A;  3AUO A;  4UAW A;  1UET A;  4KLS A;  1ZQN A;  2BPC A;  4RQ1 A;  3JPS A;  5J2J A;  4XUS A;  1RZT A;  8ICT A;  4M9L A;  4LVS A;  1MIW A;  4NKU A;  5J0R A;  4KLQ A;  5HRK A;  3RJH A;  9ICJ A;  8ICO A;  4RQ0 A;  8ICI A;  8ICS A;  4WCW A;  7ICL A;  4UB3 A;  4I2J A;  3JPQ A;  3C18 A;  3C2K A;  2M2V A;  4R66 A;  3GDX A;  3RH5 A;  3JPO A;  3ISB A;  5IIM A;  9ICU A;  4JWN A;  2M2W A;  1JAJ A;  9ICS A;  2DVI A;  4PHE A;  2DR7 A;  2DR5 A;  3UPQ A;  4F5P A;  9ICB A;  3V7L A;  2M2T A;  4RQ6 A;  5J2H A;  4TUR A;  3RJI A;  3JPN A;  4NXZ A;  4GXK A;  4PHP A;  5CB1 A;  5DBC A;  4YMO A;  2FMP A;  5J2C A;  5HHI A;  4UD5 A;  4PGY A;  4WC1 A;  2M2U A;  5HRD A;  9ICN A;  4RWP A;  7ICJ A;  3TFR A;  3H3A A;  3JPT A;  9ICI A;  3HWT A;  5HRF A;  5D4B A;  4QZA A;  1ZQA A;  2I9G A;  2ZH2 A;  4O5K A;  3C2L A;  4AT9 B;  4XA5 A;  3C5G A;  3HIY A;  4AT9 A;  1ZQF A;  4M9G A;  4X4Q A;  5J0W A;  4F5N A;  4DO9 A;  4GXJ A;  4NLZ A;  9ICO A;  3OV7 A;  4YMM A;  5III A;  4K4G A;  1ZQO A;  8ICU A;  8ICX A;  4KLM A;  8ICY A;  1NOM A;  3C5F A;  4QZH A;  2FMS A;  1ZQP A;  4IG8 A;  3WFS C;  1ZQJ A;  5D49 A;  1ZQI A;  3B0Y A;  5J2D A;  8ICF A;  4I2H A;  8ICE A;  2HHP A;  5BPC A;  4JWM A;  4XQ7 A;  4I2A A;  1ZQX A;  5HHH A;  4F5R A;  4M9H A;  9ICT A;  3H37 A;  3MDC A;  1ZJM A;  3UQ2 A;  5J0S A;  4RT2 A;  5HC9 A;  1ZQU A;  1KEJ A;  5J0Q A;  1ZQT A;  1VFG A;  3JPR A;  4RPY A;  4P4O A;  3OVA A;  4QZC A;  3AQN A;  5HRI A;  4WC5 A;  4DOC A;  4PGQ A;  3LQC B;  4MFC A;  4DOB A;  1JQR A;  1ZQB A;  4RWQ A;  5J29 A;  4QZ8 A;  4I2B A;  1ZQV A;  3HJ4 A;  3HW8 A;  2PBE A;  2RFF A;  5CJ7 A;  4ATB A;  4AT8 B;  4AT8 A;  4FH5 A;  4NLN A;  4RWN A;  7ICU A;  1PX5 A;  1ZQR A;  5IIO A;  4RQ7 A;  1UEU A;  3JYY A;  5BOL A;  3V7J A;  5DBA A;  1HUO A;  9ICX A;  5J0Y A;  4LT6 A;  2DR8 A;  1ZQL A;  4PGX A;  4I2C A;  4E80 A;  1R8B A;  3MGH A;  5TZV A;  5CHG A;  1KNY A;  3UPS A;  7ICF A;  2P66 A;  3JZ0 A;  4KLO A;  1OU5 A;  5EOZ A;  4KLI A;  3OGU A;  4EP7 A;  8ICN A;  9ICC A;  4RPX A;  4TUQ A;  4TUS A;  5IIN A;  1BPY A;  1TFY A;  8ICQ A;  3OUY A;  4YD2 A;  1R8A A;  4YCX A;  1ZQK A;  4X4O A;  4NLK A;  4NM1 A;  3OVS A;  3NYB A;  7ICM A;  2DRB A;  2BCU A;  2ID1 A;  4RQ4 A;  4QZI A;  1R89 A;  2DR9 A;  9ICM A;  2ZH7 A;  7ICG A;  3MGI A;  5J0U A;  4PHA A;  3WFR E;  7ICP A;  1V4A A;  8ICJ A;  4K4H A;  3HX0 A;  4P4M A;  1ZQE A;  1WOT A;  3L9D A;  4DOA A;  5IIJ A;  2PFO A;  1UEV A;  3PML A;  4GXI A;  3MBY A;  4M9J A;  5CR0 A;  3WFO A;  2ZH6 A;  5CWR A;  4I2F A;  1XSP A;  1XSN A;  2PFP A;  9ICE A;  4R65 A;  4PPX A;  4FO6 A;  4Z6F A;  1ZQM A;  5DED A;  4MFA A;  8ICL A;  3RJG A;  1RPL A;  4TUP A;  4RQ8 A;  2FMQ A;  2BCQ A;  4WC4 A;  4X4N A;  4R64 A;  4I2E A;  4RQ3 A;  2PFQ A;  4NY8 A;  5J2E A;  4QZD A;  4UAZ A;  3AQK A;  3H39 A;  4KLG A;  4KLH A;  9ICQ A;  1JMS A;  4IQV A;  1Q78 A;  4FH3 A;  1ZQH A;  5DDM A;  4QZG A;  4M47 A;  3C66 A;  2Q66 A;  7ICO A;  1R8C A;  4S3N A;  7ICR A;  5BOM A;  4UB2 A;  1MQ3 A;  1YLQ A;  5DB9 A;  4UB4 A;  7ICE A;  4KLT A;  5F2V O;  3TFS A;  4I2I A;  1ZJN A;  1TV9 A;  5DB7 A;  1ZQZ A;  4X4P A;  4YMN A;  8ICV A;  4MFF A;  4IQU A;  4KLL A;  5J2B A;  4Z6D A;  1MIY A;  2BPF A;  5HRH A;  4QZ9 A;  3V7K A;  8ICM A;  8ICK A;  1FA0 A;  3C2M A;  5J0O A;  9ICP A;  4WC6 A;  8ICW A;  4ATB B;  4QZE A;  5DB6 A;  3LK9 A;  1JN3 A;  4O5C A;  3AU6 A;  1TVA A;  1ZQY A;  7ICS A;  4FHP A;  7ICT A;  4IQT A;  4UBB A;  9ICR A;  1MIV A;  3PNC A;  4EBK A;  4I2G A;  4KLF A;  7ICN A;  1Q79 A;  8ICC A;  5J2F A;  4WC0 A;  3B0X A;  3AQL A;  4LZD A;  1NO5 A;  9ICV A;  3H38 A;  5J2K A;  2DRA A;  4O5E A;  3PMN A;  4WBZ A;  4WC2 A;  1ZQD A;  4MF2 A;  1ZQW A;  3AQM A;  5IIK A;  5J2I A;  4FHY A;  4RT3 A;  7ICI A;  4UB5 A;  3ISC A;  4RPZ A;  3OUY B;  1VJ7 A;  4WC7 A;  3UXO A;  4M0A A;  7ICV A;  2ZH5 A;  4X4T A;  5IIL A;  4AT7 B;  7ICH A;  4AT7 A;  5HRG A;  2NRK A;  4UAY A;  2IHM A;  4E8F A;  2ZH1 A;  4M2Y A;  5J2G A;  1ZQG A;  9ICK A;  4RQ5 A;  4MF8 A;  1XSL A;  2BCR A;  2VAN A;  4Z6C A;  4FHW A;  2ZH8 A;  3HJ1 A;  5HRE A;  4RQ2 A;  4IQW A;  1BPD A;  8ICA A;  4YN4 A;  2ZHA A;  4XQ8 A;  4UB1 A;  4X5V A;  1ZQC A;  4K4I A;  4KLE A;  4E7X A;  4M9N A;  4KLU A;  4NM2 A;  3UQ0 A;  7ICK A;  5DBB A;  2ISO A;  2ZH3 A;  1ZQS A;  1ZQQ A;  4NKT A;  9ICA A;  2BPG A;  4P4P A;  9ICW A;  5J0X A;  4UBC A;  2PXI A;  3RJJ A;  8ICZ A;  1HUZ A;  4R63 A;  1MQ2 A;  5HRB A;  8ICP A;  3OVB A;  2BE3 A;  5D46 A;  4I27 A;  4I29 A;  8ICH A;  5J2A A;  4FHV A;  2PFN A;  1TFW A;  5CA7 A;  3RJK A;  4KLJ A;  5DB8 A;  4X4U A;  3WFQ E;  9ICG A;  4QZF A;  1BPE A;  2BCS A;  4YD1 A;  5J0T A;  4M04 A;  9ICF A;  5DDY A;  4F5Q A;  5CP2 A;  3RH4 A;  2ZH9 A;  4FHX A;  4WBY A;  3UXN A;  2GWS A;  9ICL A;  4I2D A;  8ICG A;  1F5A A;  3RJF A;  4UD4 A;  5HRL A;  4X4R A;  4WC3 A;  2W9M A;  4QZB A;  4I28 A;  2ISP A;  4M5D A;  4RWO A;  4X0B A;  3K75 D;  5J0P A;  4X4S A;  9ICH A;  3RH6 A;  4PH5 A;  4X0A A;  4LZG A;  3ISD A;  4PHD A;  4X4V A;  2O5A A;  1KDH A;  4P2H A;  4Z6E A;  3UXP A;  2BCV A;  4O9M A;  8ICB A;  2O1P A; 
#chains in the Genus database with same CATH topology
 1BPB A;  3WFP A;  4EBJ A;  3AU2 A;  3MDA A;  4KLD A;  2ZHB A;  3RJE A;  8ICR A;  5DEC A;  1BPX A;  4LEY A;  4F5O A;  4XRH A;  1BPZ A;  3V72 A;  5HR9 A;  5DKW A;  7ICQ A;  3JPP A;  2ZH4 A;  3AUO A;  4UAW A;  1UET A;  4KLS A;  1ZQN A;  2BPC A;  4RQ1 A;  4LEV A;  3JPS A;  5J2J A;  4XUS A;  1RZT A;  8ICT A;  4M9L A;  4LVS A;  1MIW A;  4NKU A;  2BBH A;  5J0R A;  1GPJ A;  4KLQ A;  4OAG A;  3JCF A;  5HRK A;  3MCR A;  3RJH A;  9ICJ A;  8ICO A;  4RQ0 A;  8ICI A;  8ICS A;  4WCW A;  4KB6 A;  3ER8 C;  4EED A;  7ICL A;  4UB3 A;  4I0U A;  4I2J A;  4N7R A;  3JPQ A;  3C18 A;  3C2K A;  2M2V A;  4R66 A;  4WH5 A;  3GDX A;  3RH5 A;  3JPO A;  3ISB A;  5IIM A;  9ICU A;  4JWN A;  4HX0 A;  2M2W A;  1JAJ A;  9ICS A;  2DVI A;  4PHE A;  4WOY A;  2DR7 A;  2DR5 A;  3UPQ A;  4F5P A;  9ICB A;  3NWI A;  3V7L A;  2M2T A;  4RQ6 A;  5J2H A;  4TUR A;  3RJI A;  3JPN A;  4NXZ A;  4GXK A;  5CHE A;  4PHP A;  5CB1 A;  5DBC A;  4YMO A;  2FMP A;  5J2C A;  4K98 A;  5HHI A;  4UD5 A;  2GAF D;  4PGY A;  4WC1 A;  2M2U A;  5HRD A;  9ICN A;  4RWP A;  4OAI Z;  7ICJ A;  3TFR A;  3H3A A;  2HN2 A;  3JPT A;  9ICI A;  3HWT A;  5HRF A;  5D4B A;  4QZA A;  1ZQA A;  2I9G A;  2ZH2 A;  4O5K A;  3C2L A;  4AT9 B;  4XA5 A;  3C5G A;  3HIY A;  4AT9 A;  1ZQF A;  4M9G A;  4X4Q A;  5J0W A;  4F5N A;  4DO9 A;  4GXJ A;  2B56 A;  4NLZ A;  9ICO A;  3OV7 A;  4NXT A;  4YMM A;  5III A;  4K4G A;  1ZQO A;  2IUB A;  8ICU A;  8ICX A;  4KLM A;  8ICY A;  1NOM A;  3C5F A;  4QZH A;  2FMS A;  1ZQP A;  4IG8 A;  3WFS C;  1ZQJ A;  5D49 A;  1ZQI A;  3B0Y A;  5J2D A;  8ICF A;  4I2H A;  8ICE A;  2HHP A;  5BPC A;  4JWM A;  4XQ7 A;  4I2A A;  1ZQX A;  5HHH A;  4F5R A;  4M9H A;  9ICT A;  5CFS A;  3H37 A;  3MDC A;  1ZJM A;  3UQ2 A;  5J0S A;  4RT2 A;  2FCL A;  5HC9 A;  1ZQU A;  1KEJ A;  3OWG A;  5J0Q A;  1ZQT A;  1VFG A;  3JPR A;  4RPY A;  4P4O A;  3OVA A;  4QZC A;  3AQN A;  5HRI A;  4WC5 A;  4DOC A;  4PGQ A;  3LQC B;  4MFC A;  4DOB A;  1JQR A;  1ZQB A;  4RWQ A;  5J29 A;  4QZ8 A;  4I2B A;  1ZQV A;  3HJ4 A;  3HW8 A;  2PBE A;  2RFF A;  5CJ7 A;  4ATB A;  4AT8 B;  4AT8 A;  4FH5 A;  4NLN A;  4RWN A;  7ICU A;  1PX5 A;  1ZQR A;  5JTG A;  5IIO A;  4RQ7 A;  1UEU A;  3JYY A;  4KM5 A;  5BOL A;  3V7J A;  5DBA A;  1HUO A;  9ICX A;  5J0Y A;  4LT6 A;  2DR8 A;  1ZQL A;  4PGX A;  4I2C A;  4E80 A;  1R8B A;  3MGH A;  3K7D A;  5TZV A;  5CHG A;  1KNY A;  3UPS A;  7ICF A;  2P66 A;  3JZ0 A;  4KLO A;  1OU5 A;  5EOZ A;  4KLI A;  3OGU A;  4EP7 A;  8ICN A;  9ICC A;  4RPX A;  4TUQ A;  4TUS A;  5IIN A;  1BPY A;  1TFY A;  8ICQ A;  3OUY A;  5D61 A;  4YD2 A;  1R8A A;  4YCX A;  1ZQK A;  4K9B A;  4X4O A;  4NLK A;  5D62 A;  4NM1 A;  3OVS A;  3NYB A;  7ICM A;  2DRB A;  2BCU A;  4NXX A;  2ID1 A;  4RQ4 A;  4QZI A;  1R89 A;  4K8V A;  5CFU A;  2DR9 A;  9ICM A;  2ZH7 A;  7ICG A;  3MGI A;  5J0U A;  4PHA A;  3WFR E;  7ICP A;  1V4A A;  8ICJ A;  4K4H A;  3HX0 A;  4P4M A;  1ZQE A;  1WOT A;  3L9D A;  4DOA A;  5B3P A;  5IIJ A;  2PFO A;  1UEV A;  3PML A;  4GXI A;  3MBY A;  4M9J A;  5CR0 A;  3WFO A;  2ZH6 A;  5CWR A;  4OAF A;  4I2F A;  1XSP A;  4FO1 A;  4JLX A;  5B3Q A;  1XSN A;  2PFP A;  9ICE A;  4R65 A;  4PPX A;  4FO6 A;  4Z6F A;  1ZQM A;  5DED A;  4MFA A;  8ICL A;  3RJG A;  3EF2 A;  1RPL A;  4TUP A;  4RQ8 A;  2FMQ A;  2BCQ A;  4WC4 A;  4X4N A;  4R64 A;  4I2E A;  4RQ3 A;  2PFQ A;  4NY8 A;  3NVO A;  5J2E A;  4QZD A;  4UAZ A;  3AQK A;  3H39 A;  4KLG A;  4KLH A;  9ICQ A;  1JMS A;  4IQV A;  1Q78 A;  4FH3 A;  1ZQH A;  3ER9 B;  5DDM A;  4QZG A;  4M47 A;  3C66 A;  2Q66 A;  7ICO A;  1R8C A;  4S3N A;  7ICR A;  5BOM A;  4NXV A;  4UB2 A;  1MQ3 A;  1YLQ A;  5DB9 A;  4UB4 A;  4K9A A;  7ICE A;  3PHZ A;  4KLT A;  5F2V O;  3TFS A;  4I2I A;  1ZJN A;  1TV9 A;  5DB7 A;  1ZQZ A;  4EEB A;  4X4P A;  4YMN A;  8ICV A;  4MFF A;  4IQU A;  4KLL A;  5J2B A;  4Z6D A;  1MIY A;  2BPF A;  5HRH A;  4QZ9 A;  3V7K A;  8ICM A;  4O67 A;  8ICK A;  1FA0 A;  3C2M A;  5J0O A;  9ICP A;  4WC6 A;  8ICW A;  4ATB B;  4QZE A;  5DB6 A;  3LK9 A;  1JN3 A;  4O5C A;  3AU6 A;  1TVA A;  2BBJ A;  4K96 A;  1ZQY A;  7ICS A;  4FHP A;  7ICT A;  4IQT A;  4UBB A;  9ICR A;  1MIV A;  2EWR A;  3PNC A;  4NXU A;  4EBK A;  4I2G A;  4KLF A;  7ICN A;  1Q79 A;  8ICC A;  5J2F A;  4WC0 A;  3NKU A;  3B0X A;  3AQL A;  4LZD A;  1NO5 A;  4O69 A;  9ICV A;  3H38 A;  5J2K A;  2DRA A;  4O5E A;  3PMN A;  4WBZ A;  4WC2 A;  1ZQD A;  4O6A A;  4MF2 A;  4O68 A;  2B4V A;  1ZQW A;  3AQM A;  5IIK A;  5J2I A;  4FHY A;  4RT3 A;  7ICI A;  4UB5 A;  3ISC A;  4RPZ A;  3OUY B;  1VJ7 A;  4WC7 A;  3UXO A;  4M0A A;  7ICV A;  2GA9 D;  2B51 A;  4X4T A;  5IIL A;  2ZH5 A;  4AT7 B;  7ICH A;  4AT7 A;  5HRG A;  2NRK A;  4UAY A;  2IHM A;  4E8F A;  2ZH1 A;  4M2Y A;  5J2G A;  1ZQG A;  9ICK A;  4RQ5 A;  4MF8 A;  1XSL A;  4WQK A;  2BCR A;  2VAN A;  4Z6C A;  4FHW A;  2ZH8 A;  3HJ1 A;  5HRE A;  4RQ2 A;  4IQW A;  1BPD A;  8ICA A;  4YN4 A;  2ZHA A;  4XQ8 A;  4UB1 A;  4X5V A;  1ZQC A;  4K4I A;  4KLE A;  4K99 A;  4E7X A;  4M9N A;  4KLU A;  5CFT A;  4NM2 A;  3UQ0 A;  4MKP A;  7ICK A;  5DBB A;  2ISO A;  4K97 A;  2ZH3 A;  1ZQS A;  1ZQQ A;  4NKT A;  9ICA A;  4JLZ A;  2BPG A;  4P4P A;  4LEW A;  9ICW A;  5J0X A;  4UBC A;  2PXI A;  3RJJ A;  8ICZ A;  1HUZ A;  4R63 A;  1MQ2 A;  5HRB A;  8ICP A;  3OVB A;  2BE3 A;  5D46 A;  4I27 A;  4I29 A;  4EGW A;  8ICH A;  5J2A A;  3ERC C;  4FHV A;  2PFN A;  1TFW A;  5CA7 A;  3RJK A;  4KLJ A;  5DB8 A;  2HN1 A;  4WQL A;  5D63 A;  4X4U A;  3WFQ E;  9ICG A;  4QZF A;  1BPE A;  2BCS A;  4YD1 A;  5J0T A;  4M04 A;  9ICF A;  5DDY A;  4F5Q A;  5CP2 A;  3RH4 A;  2ZH9 A;  4FHX A;  4WBY A;  3UXN A;  2GWS A;  9ICL A;  2IHO A;  4I2D A;  8ICG A;  1F5A A;  3RJF A;  4UD4 A;  4LEZ A;  5HRL A;  4X4R A;  4NXW A;  4WC3 A;  2W9M A;  4XJE A;  4QZB A;  4I28 A;  3CK6 A;  2ISP A;  4M5D A;  4RWO A;  4X0B A;  3K75 D;  5J0P A;  4X4S A;  9ICH A;  3RH6 A;  4EV6 A;  4PH5 A;  4X0A A;  4LZG A;  3ISD A;  4PHD A;  4X4V A;  2O5A A;  1KDH A;  4P2H A;  4Z6E A;  3UXP A;  2BCV A;  4O9M A;  4OAH A;  8ICB A;  2O1P A; 
#chains in the Genus database with same CATH homology
 1BPB A;  3WFP A;  4EBJ A;  3AU2 A;  3MDA A;  4KLD A;  2ZHB A;  3RJE A;  8ICR A;  5DEC A;  1BPX A;  4F5O A;  4XRH A;  1BPZ A;  3V72 A;  5HR9 A;  5DKW A;  7ICQ A;  3JPP A;  2ZH4 A;  3AUO A;  4UAW A;  1UET A;  4KLS A;  1ZQN A;  2BPC A;  4RQ1 A;  3JPS A;  5J2J A;  4XUS A;  1RZT A;  8ICT A;  4M9L A;  4LVS A;  1MIW A;  4NKU A;  5J0R A;  4KLQ A;  5HRK A;  3RJH A;  9ICJ A;  8ICO A;  4RQ0 A;  8ICI A;  8ICS A;  4WCW A;  7ICL A;  4UB3 A;  4I2J A;  3JPQ A;  3C18 A;  3C2K A;  2M2V A;  4R66 A;  3GDX A;  3RH5 A;  3JPO A;  3ISB A;  5IIM A;  9ICU A;  4JWN A;  2M2W A;  1JAJ A;  9ICS A;  2DVI A;  4PHE A;  2DR7 A;  2DR5 A;  3UPQ A;  4F5P A;  9ICB A;  3V7L A;  2M2T A;  4RQ6 A;  5J2H A;  4TUR A;  3RJI A;  3JPN A;  4NXZ A;  4GXK A;  4PHP A;  5CB1 A;  5DBC A;  4YMO A;  2FMP A;  5J2C A;  5HHI A;  4UD5 A;  4PGY A;  4WC1 A;  2M2U A;  5HRD A;  9ICN A;  4RWP A;  7ICJ A;  3TFR A;  3H3A A;  3JPT A;  9ICI A;  3HWT A;  5HRF A;  5D4B A;  4QZA A;  1ZQA A;  2I9G A;  2ZH2 A;  4O5K A;  3C2L A;  4AT9 B;  4XA5 A;  3C5G A;  3HIY A;  4AT9 A;  1ZQF A;  4M9G A;  4X4Q A;  5J0W A;  4F5N A;  4DO9 A;  4GXJ A;  4NLZ A;  9ICO A;  3OV7 A;  4YMM A;  5III A;  4K4G A;  1ZQO A;  8ICU A;  8ICX A;  4KLM A;  8ICY A;  1NOM A;  3C5F A;  4QZH A;  2FMS A;  1ZQP A;  4IG8 A;  3WFS C;  1ZQJ A;  5D49 A;  1ZQI A;  3B0Y A;  5J2D A;  8ICF A;  4I2H A;  8ICE A;  2HHP A;  5BPC A;  4JWM A;  4XQ7 A;  4I2A A;  1ZQX A;  5HHH A;  4F5R A;  4M9H A;  9ICT A;  3H37 A;  3MDC A;  1ZJM A;  3UQ2 A;  5J0S A;  4RT2 A;  5HC9 A;  1ZQU A;  1KEJ A;  5J0Q A;  1ZQT A;  1VFG A;  3JPR A;  4RPY A;  4P4O A;  3OVA A;  4QZC A;  3AQN A;  5HRI A;  4WC5 A;  4DOC A;  4PGQ A;  3LQC B;  4MFC A;  4DOB A;  1JQR A;  1ZQB A;  4RWQ A;  5J29 A;  4QZ8 A;  4I2B A;  1ZQV A;  3HJ4 A;  3HW8 A;  2PBE A;  2RFF A;  5CJ7 A;  4ATB A;  4AT8 B;  4AT8 A;  4FH5 A;  4NLN A;  4RWN A;  7ICU A;  1PX5 A;  1ZQR A;  5IIO A;  4RQ7 A;  1UEU A;  3JYY A;  5BOL A;  3V7J A;  5DBA A;  1HUO A;  9ICX A;  5J0Y A;  4LT6 A;  2DR8 A;  1ZQL A;  4PGX A;  4I2C A;  4E80 A;  1R8B A;  3MGH A;  5TZV A;  5CHG A;  1KNY A;  3UPS A;  7ICF A;  2P66 A;  3JZ0 A;  4KLO A;  1OU5 A;  5EOZ A;  4KLI A;  3OGU A;  4EP7 A;  8ICN A;  9ICC A;  4RPX A;  4TUQ A;  4TUS A;  5IIN A;  1BPY A;  1TFY A;  8ICQ A;  3OUY A;  4YD2 A;  1R8A A;  4YCX A;  1ZQK A;  4X4O A;  4NLK A;  4NM1 A;  3OVS A;  3NYB A;  7ICM A;  2DRB A;  2BCU A;  2ID1 A;  4RQ4 A;  4QZI A;  1R89 A;  2DR9 A;  9ICM A;  2ZH7 A;  7ICG A;  3MGI A;  5J0U A;  4PHA A;  3WFR E;  7ICP A;  1V4A A;  8ICJ A;  4K4H A;  3HX0 A;  4P4M A;  1ZQE A;  1WOT A;  3L9D A;  4DOA A;  5IIJ A;  2PFO A;  1UEV A;  3PML A;  4GXI A;  3MBY A;  4M9J A;  5CR0 A;  3WFO A;  2ZH6 A;  5CWR A;  4I2F A;  1XSP A;  1XSN A;  2PFP A;  9ICE A;  4R65 A;  4PPX A;  4FO6 A;  4Z6F A;  1ZQM A;  5DED A;  4MFA A;  8ICL A;  3RJG A;  1RPL A;  4TUP A;  4RQ8 A;  2FMQ A;  2BCQ A;  4WC4 A;  4X4N A;  4R64 A;  4I2E A;  4RQ3 A;  2PFQ A;  4NY8 A;  5J2E A;  4QZD A;  4UAZ A;  3AQK A;  3H39 A;  4KLG A;  4KLH A;  9ICQ A;  1JMS A;  4IQV A;  1Q78 A;  4FH3 A;  1ZQH A;  5DDM A;  4QZG A;  4M47 A;  3C66 A;  2Q66 A;  7ICO A;  1R8C A;  4S3N A;  7ICR A;  5BOM A;  4UB2 A;  1MQ3 A;  1YLQ A;  5DB9 A;  4UB4 A;  7ICE A;  4KLT A;  5F2V O;  3TFS A;  4I2I A;  1ZJN A;  1TV9 A;  5DB7 A;  1ZQZ A;  4X4P A;  4YMN A;  8ICV A;  4MFF A;  4IQU A;  4KLL A;  5J2B A;  4Z6D A;  1MIY A;  2BPF A;  5HRH A;  4QZ9 A;  3V7K A;  8ICM A;  8ICK A;  1FA0 A;  3C2M A;  5J0O A;  9ICP A;  4WC6 A;  8ICW A;  4ATB B;  4QZE A;  5DB6 A;  3LK9 A;  1JN3 A;  4O5C A;  3AU6 A;  1TVA A;  1ZQY A;  7ICS A;  4FHP A;  7ICT A;  4IQT A;  4UBB A;  9ICR A;  1MIV A;  3PNC A;  4EBK A;  4I2G A;  4KLF A;  7ICN A;  1Q79 A;  8ICC A;  5J2F A;  4WC0 A;  3B0X A;  3AQL A;  4LZD A;  1NO5 A;  9ICV A;  3H38 A;  5J2K A;  2DRA A;  4O5E A;  3PMN A;  4WBZ A;  4WC2 A;  1ZQD A;  4MF2 A;  1ZQW A;  3AQM A;  5IIK A;  5J2I A;  4FHY A;  4RT3 A;  7ICI A;  4UB5 A;  3ISC A;  4RPZ A;  3OUY B;  1VJ7 A;  4WC7 A;  3UXO A;  4M0A A;  7ICV A;  2ZH5 A;  4X4T A;  5IIL A;  4AT7 B;  7ICH A;  4AT7 A;  5HRG A;  2NRK A;  4UAY A;  2IHM A;  4E8F A;  2ZH1 A;  4M2Y A;  5J2G A;  1ZQG A;  9ICK A;  4RQ5 A;  4MF8 A;  1XSL A;  2BCR A;  2VAN A;  4Z6C A;  4FHW A;  2ZH8 A;  3HJ1 A;  5HRE A;  4RQ2 A;  4IQW A;  1BPD A;  8ICA A;  4YN4 A;  2ZHA A;  4XQ8 A;  4UB1 A;  4X5V A;  1ZQC A;  4K4I A;  4KLE A;  4E7X A;  4M9N A;  4KLU A;  4NM2 A;  3UQ0 A;  7ICK A;  5DBB A;  2ISO A;  2ZH3 A;  1ZQS A;  1ZQQ A;  4NKT A;  9ICA A;  2BPG A;  4P4P A;  9ICW A;  5J0X A;  4UBC A;  2PXI A;  3RJJ A;  8ICZ A;  1HUZ A;  4R63 A;  1MQ2 A;  5HRB A;  8ICP A;  3OVB A;  2BE3 A;  5D46 A;  4I27 A;  4I29 A;  8ICH A;  5J2A A;  4FHV A;  2PFN A;  1TFW A;  5CA7 A;  3RJK A;  4KLJ A;  5DB8 A;  4X4U A;  3WFQ E;  9ICG A;  4QZF A;  1BPE A;  2BCS A;  4YD1 A;  5J0T A;  4M04 A;  9ICF A;  5DDY A;  4F5Q A;  5CP2 A;  3RH4 A;  2ZH9 A;  4FHX A;  4WBY A;  3UXN A;  2GWS A;  9ICL A;  4I2D A;  8ICG A;  1F5A A;  3RJF A;  4UD4 A;  5HRL A;  4X4R A;  4WC3 A;  2W9M A;  4QZB A;  4I28 A;  2ISP A;  4M5D A;  4RWO A;  4X0B A;  3K75 D;  5J0P A;  4X4S A;  9ICH A;  3RH6 A;  4PH5 A;  4X0A A;  4LZG A;  3ISD A;  4PHD A;  4X4V A;  2O5A A;  1KDH A;  4P2H A;  4Z6E A;  3UXP A;  2BCV A;  4O9M A;  8ICB A;  2O1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...