5HRGA

The crystal structure of asfvpolx(d51n mutant):dna4 binary complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
177
Chain Sequence
GGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVNLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
total genus 48
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrgA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrgA01
4LZDA 4RQ3A 2DVIA 9ICVA 1MQ3A 3AQMA 3PMNA 3UQ0A 5CP2A 4PGQA 4X4UA 3HX0A 4RPZA 8ICWA 4RPYA 1TFWA 4AT9A 2FMSA 7ICNA 3WFRE 5J0RA 4AT8B 4LZGA 4GXKA 1JQRA 4F5OA 4TUQA 4FO6A 3OVBA 4RQ4A 4UBCA 3JPTA 4Z6FA 5J2KA 3TFSA 4X4NA 1R8BA 4WBYA 4S3NA 5J0XA 4UB4A 2ISPA 3C66A 1R8CA 4M9JA 5J0YA 4RWPA 3L9DA 4YMOA 4I28A 1HUZA 4X4PA 2BCRA 1TV9A 4NXZA 1ZQHA 4RQ2A 4YN4A 3UQ2A 4Z6CA 3RJEA 5CWRA 7ICFA 5HREA 1ZQFA 1BPXA 4MFCA 1HUOA 5HRFA 1ZQRA 3V7KA 4YMMA 3WFQE 5J2IA 9ICAA 4FHWA 4RT2A 4EBJA 4ATBB 4GXJA 1ZJMA 5HRGA 2PFPA 4NLNA 3H39A 4ATBA 5J0TA 3MDAA 1MIVA 5J29A 8ICOA 2PFQA 8ICIA 1ZQTA 2BCUA 5DB6A 5IIKA 4NM1A 1JN3A 4P4PA 8ICKA 4EBKA 3OGUA 7ICPA 9ICJA 4GXIA 4RWOA 2DR9A 1ZQNA 5IILA 5DB8A 2ZH1A 1VJ7A 1YLQA 9ICBA 4KLGA 2ZH4A 7ICLA 4UAWA 3V7JA 5D4BA 5J2EA 1XSLA 3C18A 1ZQBA 2ZH2A 4F5NA 4F5QA 4WBZA 4I2CA 3OVAA 1R89A 4YMNA 4FH3A 1KEJA 8ICEA 4NLKA 4M9GA 4E80A 4AT8A 1ZQGA 5TZVA 3WFPA 4UB2A 5DB9A 4FHVA 3JPNA 2ZH9A 3RH6A 4UBBA 3MGIA 7ICGA 4R65A 4KLJA 9ICSA 1PX5A 3JPOA 4M9NA 2M2WA 3AUOA 4PPXA 5J2GA 2ZH3A 7ICHA 1ZQJA 5J2AA 4AT9B 4IQTA 8ICHA 4P4OA 4TUSA 9ICKA 1ZQSA 2IHMA 2NRKA 4DOBA 1RZTA 3OUYB 1Q79A 4I2HA 4LT6A 5BOMA 4X0BA 5J0WA 3C2LA 3LK9A 1F5AA 9ICIA 4AT7B 8ICLA 4X5VA 4YCXA 2RFFA 3C5GA 1UEUA 4X4VA 4I2IA 4PHPA 4F5RA 2DRBA 1NO5A 2BPFA 5CJ7A 1BPYA 4X4OA 4M9HA 4I2GA 3UXPA 4DOAA 1UETA 4Z6EA 3V7LA 4RWQA 3WFSC 2BCVA 3B0YA 4XUSA 4UAYA 4R66A 4QZGA 4RQ8A 3ISDA 3AU2A 5HRLA 1XSPA 4QZHA 4UB1A 4QZIA 1WOTA 3MBYA 9ICQA 2ISOA 4NLZA 5J0QA 1BPEA 4PH5A 7ICEA 4QZCA 2PBEA 4RQ6A 5DDMA 4IG8A 3PNCA 4UD4A 8ICUA 4QZFA 5J2HA 4QZ8A 5HRKA 3HJ4A 3MGHA 1ZQKA 1MQ2A 7ICOA 3C2KA 3V72A 1R8AA 3C5FA 9ICMA 4NKUA 2DR7A 4KLLA 1ZQLA 4X4SA 4I27A 4I2AA 5J2FA 3GDXA 3RJIA 5DB7A 1BPZA 4AT7A 4RQ0A 1OU5A 2FMPA 2DRAA 4WCWA 1ZQXA 1ZQZA 2ZHBA 4UB3A 4QZ9A 5BOLA 1TVAA 5CHGA 2P66A 4QZEA 8ICPA 4NM2A 1FA0A 5HRHA 4R63A 5J2JA 3WFOA 4I2FA 5CA7A 2M2TA 8ICJA 3AQNA 4QZDA 4M04A 3AU6A 3JPQA 8ICNA 5DKWA 3H37A 4FH5A 2ID1A 2M2VA 3OVSA 2O5AA 4XQ8A 3LQCB 3RJFA 3PMLA 2PFOA 4NY8A 4M9LA 5BPCA 1ZQMA 9ICOA 3TFRA 2GWSA 1XSNA 7ICQA 3K75D 4X4RA 1TFYA 5HHHA 1ZQEA 3HWTA 2DR5A 1ZJNA 2DR8A 2ZH7A 3JPPA 5J0OA 4F5PA 4KLOA 2ZH8A 4X4QA 3ISBA 4DO9A 5IIIA 7ICSA 4P4MA 2Q66A 3RH4A 1KDHA 5DEDA 5D49A 1NOMA 3UXOA 1V4AA 3RJGA 2O1PA 3H3AA 5F2VO 4JWMA 4M0AA 4RQ7A 4IQUA 4UB5A 4O5CA 2BPGA 1Q78A 4K4HA 5HR9A 4TUPA 3RH5A 5J2BA 4WC3A 3RJHA 3UPSA 9ICEA 4I2DA 9ICNA 5DBBA 4PHAA 5IIOA 5CB1A 3AQKA 4E8FA 4UD5A 5IIMA 4K4GA 8ICMA 1JAJA 1ZQOA 4O9MA 4XQ7A 1ZQVA 3JPRA 4YD1A 8ICQA 4FHYA 4WC6A 9ICFA 3JPSA 2HHPA 9ICWA 3HW8A 3MDCA 4MFAA 1ZQDA 8ICTA 5HRBA 4PGXA 4Z6DA 4KLTA 4UAZA 5HRIA 5CR0A 4TURA 4PGYA 5J0SA 7ICKA 9ICGA 2BE3A 8ICXA 2VANA 4KLDA 5J0UA 7ICUA 4FHPA 8ICBA 4X4TA 4KLEA 5HC9A 4RPXA 4EP7A 4O5EA 1BPDA 7ICMA 4X0AA 2PFNA 4IQVA 5J2DA 9ICCA 9ICHA 2ZH5A 4I2JA 4MF2A 8ICZA 4XRHA 1BPBA 4I2BA 4IQWA 4WC7A 4E7XA 3B0XA 4RQ1A 4M47A 8ICAA 8ICSA 3RJJA 3ISCA 7ICVA 4WC1A 2BPCA 4WC5A 5IINA 3AQLA 4KLSA 5HRDA 2FMQA 4K4IA 4PHDA 1ZQPA 4QZAA 4WC0A 4KLQA 1ZQYA 3JYYA 4PHEA 9ICXA 5IIJA 4KLFA 3HJ1A 1VFGA 8ICFA 9ICRA 4FHXA 8ICRA 4NKTA 4RWNA 4XA5A 4KLMA 4YD2A 3HIYA 4LVSA 4KLHA 2M2UA 1UEVA 2BCSA 9ICTA 3H38A 7ICRA 4I2EA 7ICJA 1MIWA 1JMSA 5D46A 4DOCA 1ZQWA 4R64A 4MF8A 2ZHAA 4RT3A 1RPLA 5DECA 4QZBA 3OV7A 8ICYA 3RJKA 4M2YA 3UPQA 3NYBA 1ZQAA 4I29A 4KLIA 8ICVA 1ZQQA 4O5KA 7ICTA 2ZH6A 2W9MA 2I9GA 4MFFA 3UXNA 4KLUA 5DBAA 3C2MA 7ICIA 3JZ0A 5DBCA 5J2CA 4WC2A 9ICPA 8ICCA 2BCQA 2PXIA 4JWNA 4M5DA 4WC4A 1ZQIA 8ICGA 1MIYA 5J0PA 1ZQCA 1ZQUA 5DDYA 5EOZA 9ICLA 1KNYA 3OUYA 4P2HA 4RQ5A 9ICUA 5HHIA
chains in the Genus database with same CATH superfamily
4LZDA 4RQ3A 2DVIA 9ICVA 1MQ3A 3AQMA 3PMNA 3UQ0A 5CP2A 4PGQA 4X4UA 3HX0A 4RPZA 8ICWA 4RPYA 1TFWA 4AT9A 2FMSA 4K8VA 7ICNA 4WOYA 3WFRE 5J0RA 4AT8B 4LZGA 4GXKA 1JQRA 4N7RA 4F5OA 4TUQA 4FO6A 3OVBA 4RQ4A 3EF2A 4UBCA 4EGWA 2BBHA 3JPTA 4Z6FA 5J2KA 3TFSA 4X4NA 1R8BA 4WBYA 4S3NA 5J0XA 4UB4A 2ISPA 3C66A 1R8CA 4M9JA 5J0YA 4RWPA 3L9DA 4YMOA 4I28A 4MKPA 1HUZA 4X4PA 2BCRA 4K96A 4WQKA 1TV9A 4NXZA 4I0UA 1ZQHA 4RQ2A 4YN4A 3UQ2A 4Z6CA 3RJEA 5CWRA 7ICFA 5HREA 1ZQFA 1BPXA 4MFCA 1HUOA 5HRFA 1ZQRA 3CK6A 2GA9D 4K99A 3V7KA 4YMMA 3WFQE 5J2IA 9ICAA 3ER9B 4FHWA 4RT2A 4EBJA 4ATBB 2B4VA 4GXJA 1ZJMA 5HRGA 4LEWA 2PFPA 4NLNA 3H39A 4ATBA 3NKUA 5J0TA 3MDAA 1MIVA 5J29A 8ICOA 2PFQA 4KM5A 8ICIA 1ZQTA 2BCUA 5DB6A 5IIKA 4NM1A 1JN3A 4P4PA 8ICKA 4EBKA 3OGUA 7ICPA 9ICJA 4GXIA 4RWOA 2DR9A 1ZQNA 5IILA 5DB8A 2ZH1A 4JLZA 4LEVA 4K97A 1VJ7A 1YLQA 9ICBA 4KLGA 2BBJA 2ZH4A 7ICLA 4UAWA 3V7JA 4O69A 5D4BA 5J2EA 1XSLA 3C18A 5CFSA 1ZQBA 2ZH2A 4F5NA 4F5QA 4NXXA 4WBZA 4I2CA 3OVAA 1R89A 4YMNA 4FH3A 1KEJA 8ICEA 4EEDA 4NLKA 4M9GA 4E80A 4AT8A 1ZQGA 5TZVA 3WFPA 4UB2A 4LEYA 5DB9A 4FHVA 3JPNA 2ZH9A 3RH6A 4UBBA 3MGIA 7ICGA 4R65A 4OAFA 4KLJA 9ICSA 1PX5A 3JPOA 4M9NA 3PHZA 2M2WA 3AUOA 4PPXA 4OAHA 5J2GA 2ZH3A 7ICHA 1ZQJA 5J2AA 4AT9B 4IQTA 8ICHA 4P4OA 4TUSA 9ICKA 1ZQSA 2IHMA 2NRKA 4EEBA 4DOBA 1RZTA 3OUYB 1Q79A 1GPJA 4I2HA 4LT6A 5BOMA 4X0BA 5J0WA 3C2LA 3LK9A 2HN1A 1F5AA 9ICIA 3OWGA 4AT7B 8ICLA 4X5VA 4YCXA 2RFFA 3C5GA 1UEUA 4X4VA 4I2IA 4PHPA 5D61A 4F5RA 2DRBA 1NO5A 2BPFA 2IHOA 5CJ7A 1BPYA 4X4OA 4M9HA 4I2GA 3UXPA 4DOAA 1UETA 4Z6EA 3V7LA 4RWQA 3WFSC 3JCFA 2BCVA 3B0YA 4XUSA 4UAYA 4R66A 4QZGA 4RQ8A 3ISDA 3AU2A 5HRLA 1XSPA 4QZHA 4UB1A 4QZIA 1WOTA 3MBYA 9ICQA 2ISOA 4NLZA 5J0QA 1BPEA 4PH5A 7ICEA 4QZCA 2PBEA 4RQ6A 5DDMA 4IG8A 3PNCA 4UD4A 8ICUA 4QZFA 5J2HA 4QZ8A 5HRKA 3HJ4A 3MGHA 4OAIZ 1ZQKA 1MQ2A 7ICOA 5CFUA 3C2KA 2HN2A 3V72A 1R8AA 3C5FA 9ICMA 4LEZA 4NKUA 2DR7A 4KLLA 1ZQLA 4X4SA 4I27A 4I2AA 5J2FA 3GDXA 4NXWA 3RJIA 5JTGA 5DB7A 1BPZA 4O6AA 4AT7A 5B3PA 4RQ0A 1OU5A 2FMPA 2DRAA 4WCWA 1ZQXA 1ZQZA 2ZHBA 4UB3A 4QZ9A 5BOLA 1TVAA 5CHGA 2P66A 4QZEA 8ICPA 4NM2A 1FA0A 5HRHA 4R63A 5J2JA 3WFOA 4I2FA 5CA7A 2M2TA 8ICJA 3AQNA 4QZDA 4M04A 3AU6A 3JPQA 8ICNA 5DKWA 3H37A 4FH5A 2ID1A 2M2VA 3OVSA 2O5AA 4XQ8A 3LQCB 3RJFA 3PMLA 2PFOA 4NY8A 4M9LA 5BPCA 1ZQMA 9ICOA 3TFRA 2GWSA 2B51A 4WQLA 1XSNA 7ICQA 3K75D 4X4RA 1TFYA 5HHHA 1ZQEA 3HWTA 5B3QA 1ZJNA 4XJEA 2DR5A 2DR8A 2ZH7A 3JPPA 5J0OA 4F5PA 4KLOA 2ZH8A 4X4QA 3ISBA 4DO9A 5IIIA 7ICSA 4P4MA 2Q66A 3RH4A 1KDHA 5DEDA 5D49A 1NOMA 3UXOA 1V4AA 3RJGA 2O1PA 3H3AA 5F2VO 4JWMA 4M0AA 4RQ7A 4IQUA 4UB5A 4O5CA 2GAFD 2BPGA 1Q78A 4JLXA 4K4HA 5HR9A 4TUPA 3RH5A 5J2BA 2IUBA 4WC3A 3RJHA 3UPSA 9ICEA 4I2DA 9ICNA 5DBBA 4PHAA 5IIOA 5CB1A 3AQKA 4E8FA 3NWIA 4UD5A 5IIMA 4K4GA 8ICMA 1JAJA 1ZQOA 2FCLA 4O9MA 4XQ7A 1ZQVA 3JPRA 4YD1A 8ICQA 4FHYA 4WC6A 9ICFA 3JPSA 2HHPA 9ICWA 3HW8A 3MDCA 4MFAA 1ZQDA 8ICTA 5HRBA 4PGXA 4Z6DA 4KLTA 4HX0A 4KB6A 4UAZA 5HRIA 5CR0A 5CHEA 4TURA 4PGYA 5J0SA 7ICKA 9ICGA 4K9AA 2BE3A 8ICXA 2VANA 4KLDA 4OAGA 3MCRA 5J0UA 7ICUA 4FHPA 8ICBA 4X4TA 4KLEA 5HC9A 4RPXA 4EP7A 4O5EA 1BPDA 7ICMA 4X0AA 2PFNA 4IQVA 5J2DA 9ICCA 9ICHA 2ZH5A 4I2JA 4MF2A 8ICZA 4XRHA 1BPBA 4I2BA 4IQWA 4WC7A 4E7XA 3B0XA 4RQ1A 4M47A 8ICAA 8ICSA 3NVOA 3RJJA 3ISCA 7ICVA 4WC1A 2BPCA 4WC5A 5IINA 3AQLA 4KLSA 5HRDA 2FMQA 4K4IA 4PHDA 1ZQPA 4QZAA 4WC0A 4KLQA 1ZQYA 3JYYA 4PHEA 9ICXA 5IIJA 4KLFA 3HJ1A 1VFGA 8ICFA 9ICRA 4FHXA 8ICRA 4NKTA 2EWRA 4RWNA 4XA5A 4KLMA 4YD2A 3HIYA 4FO1A 4EV6A 4LVSA 4KLHA 2M2UA 1UEVA 4WH5A 2BCSA 9ICTA 3H38A 7ICRA 5CFTA 4K9BA 4I2EA 7ICJA 1MIWA 1JMSA 5D46A 4DOCA 3ER8C 1ZQWA 4R64A 4MF8A 2ZHAA 3ERCC 4RT3A 1RPLA 5DECA 4QZBA 3OV7A 8ICYA 3RJKA 4M2YA 3UPQA 3NYBA 1ZQAA 4I29A 4KLIA 8ICVA 1ZQQA 5D62A 2B56A 4O5KA 7ICTA 2ZH6A 2W9MA 2I9GA 4MFFA 3UXNA 4KLUA 5DBAA 3C2MA 7ICIA 4NXVA 3JZ0A 5DBCA 5J2CA 4K98A 5D63A 4WC2A 9ICPA 8ICCA 2BCQA 4O67A 2PXIA 4JWNA 4O68A 4M5DA 4WC4A 1ZQIA 8ICGA 1MIYA 5J0PA 4NXTA 1ZQCA 3K7DA 1ZQUA 5DDYA 5EOZA 9ICLA 1KNYA 4NXUA 4P2HA 3OUYA 4RQ5A 9ICUA 5HHIA
chains in the Genus database with same CATH topology
4LZDA 4RQ3A 2DVIA 9ICVA 1MQ3A 3AQMA 3PMNA 3UQ0A 5CP2A 4PGQA 4X4UA 3HX0A 4RPZA 8ICWA 4RPYA 1TFWA 4AT9A 2FMSA 7ICNA 3WFRE 5J0RA 4AT8B 4LZGA 4GXKA 1JQRA 4F5OA 4TUQA 4FO6A 3OVBA 4RQ4A 4UBCA 3JPTA 4Z6FA 5J2KA 3TFSA 4X4NA 1R8BA 4WBYA 4S3NA 5J0XA 4UB4A 2ISPA 3C66A 1R8CA 4M9JA 5J0YA 4RWPA 3L9DA 4YMOA 4I28A 1HUZA 4X4PA 2BCRA 1TV9A 4NXZA 1ZQHA 4RQ2A 4YN4A 3UQ2A 4Z6CA 3RJEA 5CWRA 7ICFA 5HREA 1ZQFA 1BPXA 4MFCA 1HUOA 5HRFA 1ZQRA 3V7KA 4YMMA 3WFQE 5J2IA 9ICAA 4FHWA 4RT2A 4EBJA 4ATBB 4GXJA 1ZJMA 5HRGA 2PFPA 4NLNA 3H39A 4ATBA 5J0TA 3MDAA 1MIVA 5J29A 8ICOA 2PFQA 8ICIA 1ZQTA 2BCUA 5DB6A 5IIKA 4NM1A 1JN3A 4P4PA 8ICKA 4EBKA 3OGUA 7ICPA 9ICJA 4GXIA 4RWOA 2DR9A 1ZQNA 5IILA 5DB8A 2ZH1A 1VJ7A 1YLQA 9ICBA 4KLGA 2ZH4A 7ICLA 4UAWA 3V7JA 5D4BA 5J2EA 1XSLA 3C18A 1ZQBA 2ZH2A 4F5NA 4F5QA 4WBZA 4I2CA 3OVAA 1R89A 4YMNA 4FH3A 1KEJA 8ICEA 4NLKA 4M9GA 4E80A 4AT8A 1ZQGA 5TZVA 3WFPA 4UB2A 5DB9A 4FHVA 3JPNA 2ZH9A 3RH6A 4UBBA 3MGIA 7ICGA 4R65A 4KLJA 9ICSA 1PX5A 3JPOA 4M9NA 2M2WA 3AUOA 4PPXA 5J2GA 2ZH3A 7ICHA 1ZQJA 5J2AA 4AT9B 4IQTA 8ICHA 4P4OA 4TUSA 9ICKA 1ZQSA 2IHMA 2NRKA 4DOBA 1RZTA 3OUYB 1Q79A 4I2HA 4LT6A 5BOMA 4X0BA 5J0WA 3C2LA 3LK9A 1F5AA 9ICIA 4AT7B 8ICLA 4X5VA 4YCXA 2RFFA 3C5GA 1UEUA 4X4VA 4I2IA 4PHPA 4F5RA 2DRBA 1NO5A 2BPFA 5CJ7A 1BPYA 4X4OA 4M9HA 4I2GA 3UXPA 4DOAA 1UETA 4Z6EA 3V7LA 4RWQA 3WFSC 2BCVA 3B0YA 4XUSA 4UAYA 4R66A 4QZGA 4RQ8A 3ISDA 3AU2A 5HRLA 1XSPA 4QZHA 4UB1A 4QZIA 1WOTA 3MBYA 9ICQA 2ISOA 4NLZA 5J0QA 1BPEA 4PH5A 7ICEA 4QZCA 2PBEA 4RQ6A 5DDMA 4IG8A 3PNCA 4UD4A 8ICUA 4QZFA 5J2HA 4QZ8A 5HRKA 3HJ4A 3MGHA 1ZQKA 1MQ2A 7ICOA 3C2KA 3V72A 1R8AA 3C5FA 9ICMA 4NKUA 2DR7A 4KLLA 1ZQLA 4X4SA 4I27A 4I2AA 5J2FA 3GDXA 3RJIA 5DB7A 1BPZA 4AT7A 4RQ0A 1OU5A 2FMPA 2DRAA 4WCWA 1ZQXA 1ZQZA 2ZHBA 4UB3A 4QZ9A 5BOLA 1TVAA 5CHGA 2P66A 4QZEA 8ICPA 4NM2A 1FA0A 5HRHA 4R63A 5J2JA 3WFOA 4I2FA 5CA7A 2M2TA 8ICJA 3AQNA 4QZDA 4M04A 3AU6A 3JPQA 8ICNA 5DKWA 3H37A 4FH5A 2ID1A 2M2VA 3OVSA 2O5AA 4XQ8A 3LQCB 3RJFA 3PMLA 2PFOA 4NY8A 4M9LA 5BPCA 1ZQMA 9ICOA 3TFRA 2GWSA 1XSNA 7ICQA 3K75D 4X4RA 1TFYA 5HHHA 1ZQEA 3HWTA 2DR5A 1ZJNA 2DR8A 2ZH7A 3JPPA 5J0OA 4F5PA 4KLOA 2ZH8A 4X4QA 3ISBA 4DO9A 5IIIA 7ICSA 4P4MA 2Q66A 3RH4A 1KDHA 5DEDA 5D49A 1NOMA 3UXOA 1V4AA 3RJGA 2O1PA 3H3AA 5F2VO 4JWMA 4M0AA 4RQ7A 4IQUA 4UB5A 4O5CA 2BPGA 1Q78A 4K4HA 5HR9A 4TUPA 3RH5A 5J2BA 4WC3A 3RJHA 3UPSA 9ICEA 4I2DA 9ICNA 5DBBA 4PHAA 5IIOA 5CB1A 3AQKA 4E8FA 4UD5A 5IIMA 4K4GA 8ICMA 1JAJA 1ZQOA 4O9MA 4XQ7A 1ZQVA 3JPRA 4YD1A 8ICQA 4FHYA 4WC6A 9ICFA 3JPSA 2HHPA 9ICWA 3HW8A 3MDCA 4MFAA 1ZQDA 8ICTA 5HRBA 4PGXA 4Z6DA 4KLTA 4UAZA 5HRIA 5CR0A 4TURA 4PGYA 5J0SA 7ICKA 9ICGA 2BE3A 8ICXA 2VANA 4KLDA 5J0UA 7ICUA 4FHPA 8ICBA 4X4TA 4KLEA 5HC9A 4RPXA 4EP7A 4O5EA 1BPDA 7ICMA 4X0AA 2PFNA 4IQVA 5J2DA 9ICCA 9ICHA 2ZH5A 4I2JA 4MF2A 8ICZA 4XRHA 1BPBA 4I2BA 4IQWA 4WC7A 4E7XA 3B0XA 4RQ1A 4M47A 8ICAA 8ICSA 3RJJA 3ISCA 7ICVA 4WC1A 2BPCA 4WC5A 5IINA 3AQLA 4KLSA 5HRDA 2FMQA 4K4IA 4PHDA 1ZQPA 4QZAA 4WC0A 4KLQA 1ZQYA 3JYYA 4PHEA 9ICXA 5IIJA 4KLFA 3HJ1A 1VFGA 8ICFA 9ICRA 4FHXA 8ICRA 4NKTA 4RWNA 4XA5A 4KLMA 4YD2A 3HIYA 4LVSA 4KLHA 2M2UA 1UEVA 2BCSA 9ICTA 3H38A 7ICRA 4I2EA 7ICJA 1MIWA 1JMSA 5D46A 4DOCA 1ZQWA 4R64A 4MF8A 2ZHAA 4RT3A 1RPLA 5DECA 4QZBA 3OV7A 8ICYA 3RJKA 4M2YA 3UPQA 3NYBA 1ZQAA 4I29A 4KLIA 8ICVA 1ZQQA 4O5KA 7ICTA 2ZH6A 2W9MA 2I9GA 4MFFA 3UXNA 4KLUA 5DBAA 3C2MA 7ICIA 3JZ0A 5DBCA 5J2CA 4WC2A 9ICPA 8ICCA 2BCQA 2PXIA 4JWNA 4M5DA 4WC4A 1ZQIA 8ICGA 1MIYA 5J0PA 1ZQCA 1ZQUA 5DDYA 5EOZA 9ICLA 1KNYA 3OUYA 4P2HA 4RQ5A 9ICUA 5HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZD A;  4RQ3 A;  2DVI A;  9ICV A;  1MQ3 A;  3AQM A;  3PMN A;  3UQ0 A;  5CP2 A;  4PGQ A;  4X4U A;  3HX0 A;  4RPZ A;  8ICW A;  4RPY A;  1TFW A;  4AT9 A;  2FMS A;  7ICN A;  3WFR E;  5J0R A;  4AT8 B;  4LZG A;  4GXK A;  1JQR A;  4F5O A;  4TUQ A;  4FO6 A;  3OVB A;  4RQ4 A;  4UBC A;  3JPT A;  4Z6F A;  5J2K A;  3TFS A;  4X4N A;  1R8B A;  4WBY A;  4S3N A;  5J0X A;  4UB4 A;  2ISP A;  3C66 A;  1R8C A;  4M9J A;  5J0Y A;  4RWP A;  3L9D A;  4YMO A;  4I28 A;  1HUZ A;  4X4P A;  2BCR A;  1TV9 A;  4NXZ A;  1ZQH A;  4RQ2 A;  4YN4 A;  3UQ2 A;  4Z6C A;  3RJE A;  5CWR A;  7ICF A;  5HRE A;  1ZQF A;  1BPX A;  4MFC A;  1HUO A;  5HRF A;  1ZQR A;  3V7K A;  4YMM A;  3WFQ E;  5J2I A;  9ICA A;  4FHW A;  4RT2 A;  4EBJ A;  4ATB B;  4GXJ A;  1ZJM A;  5HRG A;  2PFP A;  4NLN A;  3H39 A;  4ATB A;  5J0T A;  3MDA A;  1MIV A;  5J29 A;  8ICO A;  2PFQ A;  8ICI A;  1ZQT A;  2BCU A;  5DB6 A;  5IIK A;  4NM1 A;  1JN3 A;  4P4P A;  8ICK A;  4EBK A;  3OGU A;  7ICP A;  9ICJ A;  4GXI A;  4RWO A;  2DR9 A;  1ZQN A;  5IIL A;  5DB8 A;  2ZH1 A;  1VJ7 A;  1YLQ A;  9ICB A;  4KLG A;  2ZH4 A;  7ICL A;  4UAW A;  3V7J A;  5D4B A;  5J2E A;  1XSL A;  3C18 A;  1ZQB A;  2ZH2 A;  4F5N A;  4F5Q A;  4WBZ A;  4I2C A;  3OVA A;  1R89 A;  4YMN A;  4FH3 A;  1KEJ A;  8ICE A;  4NLK A;  4M9G A;  4E80 A;  4AT8 A;  1ZQG A;  5TZV A;  3WFP A;  4UB2 A;  5DB9 A;  4FHV A;  3JPN A;  2ZH9 A;  3RH6 A;  4UBB A;  3MGI A;  7ICG A;  4R65 A;  4KLJ A;  9ICS A;  1PX5 A;  3JPO A;  4M9N A;  2M2W A;  3AUO A;  4PPX A;  5J2G A;  2ZH3 A;  7ICH A;  1ZQJ A;  5J2A A;  4AT9 B;  4IQT A;  8ICH A;  4P4O A;  4TUS A;  9ICK A;  1ZQS A;  2IHM A;  2NRK A;  4DOB A;  1RZT A;  3OUY B;  1Q79 A;  4I2H A;  4LT6 A;  5BOM A;  4X0B A;  5J0W A;  3C2L A;  3LK9 A;  1F5A A;  9ICI A;  4AT7 B;  8ICL A;  4X5V A;  4YCX A;  2RFF A;  3C5G A;  1UEU A;  4X4V A;  4I2I A;  4PHP A;  4F5R A;  2DRB A;  1NO5 A;  2BPF A;  5CJ7 A;  1BPY A;  4X4O A;  4M9H A;  4I2G A;  3UXP A;  4DOA A;  1UET A;  4Z6E A;  3V7L A;  4RWQ A;  3WFS C;  2BCV A;  3B0Y A;  4XUS A;  4UAY A;  4R66 A;  4QZG A;  4RQ8 A;  3ISD A;  3AU2 A;  5HRL A;  1XSP A;  4QZH A;  4UB1 A;  4QZI A;  1WOT A;  3MBY A;  9ICQ A;  2ISO A;  4NLZ A;  5J0Q A;  1BPE A;  4PH5 A;  7ICE A;  4QZC A;  2PBE A;  4RQ6 A;  5DDM A;  4IG8 A;  3PNC A;  4UD4 A;  8ICU A;  4QZF A;  5J2H A;  4QZ8 A;  5HRK A;  3HJ4 A;  3MGH A;  1ZQK A;  1MQ2 A;  7ICO A;  3C2K A;  3V72 A;  1R8A A;  3C5F A;  9ICM A;  4NKU A;  2DR7 A;  4KLL A;  1ZQL A;  4X4S A;  4I27 A;  4I2A A;  5J2F A;  3GDX A;  3RJI A;  5DB7 A;  1BPZ A;  4AT7 A;  4RQ0 A;  1OU5 A;  2FMP A;  2DRA A;  4WCW A;  1ZQX A;  1ZQZ A;  2ZHB A;  4UB3 A;  4QZ9 A;  5BOL A;  1TVA A;  5CHG A;  2P66 A;  4QZE A;  8ICP A;  4NM2 A;  1FA0 A;  5HRH A;  4R63 A;  5J2J A;  3WFO A;  4I2F A;  5CA7 A;  2M2T A;  8ICJ A;  3AQN A;  4QZD A;  4M04 A;  3AU6 A;  3JPQ A;  8ICN A;  5DKW A;  3H37 A;  4FH5 A;  2ID1 A;  2M2V A;  3OVS A;  2O5A A;  4XQ8 A;  3LQC B;  3RJF A;  3PML A;  2PFO A;  4NY8 A;  4M9L A;  5BPC A;  1ZQM A;  9ICO A;  3TFR A;  2GWS A;  1XSN A;  7ICQ A;  3K75 D;  4X4R A;  1TFY A;  5HHH A;  1ZQE A;  3HWT A;  2DR5 A;  1ZJN A;  2DR8 A;  2ZH7 A;  3JPP A;  5J0O A;  4F5P A;  4KLO A;  2ZH8 A;  4X4Q A;  3ISB A;  4DO9 A;  5III A;  7ICS A;  4P4M A;  2Q66 A;  3RH4 A;  1KDH A;  5DED A;  5D49 A;  1NOM A;  3UXO A;  1V4A A;  3RJG A;  2O1P A;  3H3A A;  5F2V O;  4JWM A;  4M0A A;  4RQ7 A;  4IQU A;  4UB5 A;  4O5C A;  2BPG A;  1Q78 A;  4K4H A;  5HR9 A;  4TUP A;  3RH5 A;  5J2B A;  4WC3 A;  3RJH A;  3UPS A;  9ICE A;  4I2D A;  9ICN A;  5DBB A;  4PHA A;  5IIO A;  5CB1 A;  3AQK A;  4E8F A;  4UD5 A;  5IIM A;  4K4G A;  8ICM A;  1JAJ A;  1ZQO A;  4O9M A;  4XQ7 A;  1ZQV A;  3JPR A;  4YD1 A;  8ICQ A;  4FHY A;  4WC6 A;  9ICF A;  3JPS A;  2HHP A;  9ICW A;  3HW8 A;  3MDC A;  4MFA A;  1ZQD A;  8ICT A;  5HRB A;  4PGX A;  4Z6D A;  4KLT A;  4UAZ A;  5HRI A;  5CR0 A;  4TUR A;  4PGY A;  5J0S A;  7ICK A;  9ICG A;  2BE3 A;  8ICX A;  2VAN A;  4KLD A;  5J0U A;  7ICU A;  4FHP A;  8ICB A;  4X4T A;  4KLE A;  5HC9 A;  4RPX A;  4EP7 A;  4O5E A;  1BPD A;  7ICM A;  4X0A A;  2PFN A;  4IQV A;  5J2D A;  9ICC A;  9ICH A;  2ZH5 A;  4I2J A;  4MF2 A;  8ICZ A;  4XRH A;  1BPB A;  4I2B A;  4IQW A;  4WC7 A;  4E7X A;  3B0X A;  4RQ1 A;  4M47 A;  8ICA A;  8ICS A;  3RJJ A;  3ISC A;  7ICV A;  4WC1 A;  2BPC A;  4WC5 A;  5IIN A;  3AQL A;  4KLS A;  5HRD A;  2FMQ A;  4K4I A;  4PHD A;  1ZQP A;  4QZA A;  4WC0 A;  4KLQ A;  1ZQY A;  3JYY A;  4PHE A;  9ICX A;  5IIJ A;  4KLF A;  3HJ1 A;  1VFG A;  8ICF A;  9ICR A;  4FHX A;  8ICR A;  4NKT A;  4RWN A;  4XA5 A;  4KLM A;  4YD2 A;  3HIY A;  4LVS A;  4KLH A;  2M2U A;  1UEV A;  2BCS A;  9ICT A;  3H38 A;  7ICR A;  4I2E A;  7ICJ A;  1MIW A;  1JMS A;  5D46 A;  4DOC A;  1ZQW A;  4R64 A;  4MF8 A;  2ZHA A;  4RT3 A;  1RPL A;  5DEC A;  4QZB A;  3OV7 A;  8ICY A;  3RJK A;  4M2Y A;  3UPQ A;  3NYB A;  1ZQA A;  4I29 A;  4KLI A;  8ICV A;  1ZQQ A;  4O5K A;  7ICT A;  2ZH6 A;  2W9M A;  2I9G A;  4MFF A;  3UXN A;  4KLU A;  5DBA A;  3C2M A;  7ICI A;  3JZ0 A;  5DBC A;  5J2C A;  4WC2 A;  9ICP A;  8ICC A;  2BCQ A;  2PXI A;  4JWN A;  4M5D A;  4WC4 A;  1ZQI A;  8ICG A;  1MIY A;  5J0P A;  1ZQC A;  1ZQU A;  5DDY A;  5EOZ A;  9ICL A;  1KNY A;  3OUY A;  4P2H A;  4RQ5 A;  9ICU A;  5HHI A; 
#chains in the Genus database with same CATH topology
 4LZD A;  4RQ3 A;  2DVI A;  9ICV A;  1MQ3 A;  3AQM A;  3PMN A;  3UQ0 A;  5CP2 A;  4PGQ A;  4X4U A;  3HX0 A;  4RPZ A;  8ICW A;  4RPY A;  1TFW A;  4AT9 A;  2FMS A;  4K8V A;  7ICN A;  4WOY A;  3WFR E;  5J0R A;  4AT8 B;  4LZG A;  4GXK A;  1JQR A;  4N7R A;  4F5O A;  4TUQ A;  4FO6 A;  3OVB A;  4RQ4 A;  3EF2 A;  4UBC A;  4EGW A;  2BBH A;  3JPT A;  4Z6F A;  5J2K A;  3TFS A;  4X4N A;  1R8B A;  4WBY A;  4S3N A;  5J0X A;  4UB4 A;  2ISP A;  3C66 A;  1R8C A;  4M9J A;  5J0Y A;  4RWP A;  3L9D A;  4YMO A;  4I28 A;  4MKP A;  1HUZ A;  4X4P A;  2BCR A;  4K96 A;  4WQK A;  1TV9 A;  4NXZ A;  4I0U A;  1ZQH A;  4RQ2 A;  4YN4 A;  3UQ2 A;  4Z6C A;  3RJE A;  5CWR A;  7ICF A;  5HRE A;  1ZQF A;  1BPX A;  4MFC A;  1HUO A;  5HRF A;  1ZQR A;  3CK6 A;  2GA9 D;  4K99 A;  3V7K A;  4YMM A;  3WFQ E;  5J2I A;  9ICA A;  3ER9 B;  4FHW A;  4RT2 A;  4EBJ A;  4ATB B;  2B4V A;  4GXJ A;  1ZJM A;  5HRG A;  4LEW A;  2PFP A;  4NLN A;  3H39 A;  4ATB A;  3NKU A;  5J0T A;  3MDA A;  1MIV A;  5J29 A;  8ICO A;  2PFQ A;  4KM5 A;  8ICI A;  1ZQT A;  2BCU A;  5DB6 A;  5IIK A;  4NM1 A;  1JN3 A;  4P4P A;  8ICK A;  4EBK A;  3OGU A;  7ICP A;  9ICJ A;  4GXI A;  4RWO A;  2DR9 A;  1ZQN A;  5IIL A;  5DB8 A;  2ZH1 A;  4JLZ A;  4LEV A;  4K97 A;  1VJ7 A;  1YLQ A;  9ICB A;  4KLG A;  2BBJ A;  2ZH4 A;  7ICL A;  4UAW A;  3V7J A;  4O69 A;  5D4B A;  5J2E A;  1XSL A;  3C18 A;  5CFS A;  1ZQB A;  2ZH2 A;  4F5N A;  4F5Q A;  4NXX A;  4WBZ A;  4I2C A;  3OVA A;  1R89 A;  4YMN A;  4FH3 A;  1KEJ A;  8ICE A;  4EED A;  4NLK A;  4M9G A;  4E80 A;  4AT8 A;  1ZQG A;  5TZV A;  3WFP A;  4UB2 A;  4LEY A;  5DB9 A;  4FHV A;  3JPN A;  2ZH9 A;  3RH6 A;  4UBB A;  3MGI A;  7ICG A;  4R65 A;  4OAF A;  4KLJ A;  9ICS A;  1PX5 A;  3JPO A;  4M9N A;  3PHZ A;  2M2W A;  3AUO A;  4PPX A;  4OAH A;  5J2G A;  2ZH3 A;  7ICH A;  1ZQJ A;  5J2A A;  4AT9 B;  4IQT A;  8ICH A;  4P4O A;  4TUS A;  9ICK A;  1ZQS A;  2IHM A;  2NRK A;  4EEB A;  4DOB A;  1RZT A;  3OUY B;  1Q79 A;  1GPJ A;  4I2H A;  4LT6 A;  5BOM A;  4X0B A;  5J0W A;  3C2L A;  3LK9 A;  2HN1 A;  1F5A A;  9ICI A;  3OWG A;  4AT7 B;  8ICL A;  4X5V A;  4YCX A;  2RFF A;  3C5G A;  1UEU A;  4X4V A;  4I2I A;  4PHP A;  5D61 A;  4F5R A;  2DRB A;  1NO5 A;  2BPF A;  2IHO A;  5CJ7 A;  1BPY A;  4X4O A;  4M9H A;  4I2G A;  3UXP A;  4DOA A;  1UET A;  4Z6E A;  3V7L A;  4RWQ A;  3WFS C;  3JCF A;  2BCV A;  3B0Y A;  4XUS A;  4UAY A;  4R66 A;  4QZG A;  4RQ8 A;  3ISD A;  3AU2 A;  5HRL A;  1XSP A;  4QZH A;  4UB1 A;  4QZI A;  1WOT A;  3MBY A;  9ICQ A;  2ISO A;  4NLZ A;  5J0Q A;  1BPE A;  4PH5 A;  7ICE A;  4QZC A;  2PBE A;  4RQ6 A;  5DDM A;  4IG8 A;  3PNC A;  4UD4 A;  8ICU A;  4QZF A;  5J2H A;  4QZ8 A;  5HRK A;  3HJ4 A;  3MGH A;  4OAI Z;  1ZQK A;  1MQ2 A;  7ICO A;  5CFU A;  3C2K A;  2HN2 A;  3V72 A;  1R8A A;  3C5F A;  9ICM A;  4LEZ A;  4NKU A;  2DR7 A;  4KLL A;  1ZQL A;  4X4S A;  4I27 A;  4I2A A;  5J2F A;  3GDX A;  4NXW A;  3RJI A;  5JTG A;  5DB7 A;  1BPZ A;  4O6A A;  4AT7 A;  5B3P A;  4RQ0 A;  1OU5 A;  2FMP A;  2DRA A;  4WCW A;  1ZQX A;  1ZQZ A;  2ZHB A;  4UB3 A;  4QZ9 A;  5BOL A;  1TVA A;  5CHG A;  2P66 A;  4QZE A;  8ICP A;  4NM2 A;  1FA0 A;  5HRH A;  4R63 A;  5J2J A;  3WFO A;  4I2F A;  5CA7 A;  2M2T A;  8ICJ A;  3AQN A;  4QZD A;  4M04 A;  3AU6 A;  3JPQ A;  8ICN A;  5DKW A;  3H37 A;  4FH5 A;  2ID1 A;  2M2V A;  3OVS A;  2O5A A;  4XQ8 A;  3LQC B;  3RJF A;  3PML A;  2PFO A;  4NY8 A;  4M9L A;  5BPC A;  1ZQM A;  9ICO A;  3TFR A;  2GWS A;  2B51 A;  4WQL A;  1XSN A;  7ICQ A;  3K75 D;  4X4R A;  1TFY A;  5HHH A;  1ZQE A;  3HWT A;  5B3Q A;  1ZJN A;  4XJE A;  2DR5 A;  2DR8 A;  2ZH7 A;  3JPP A;  5J0O A;  4F5P A;  4KLO A;  2ZH8 A;  4X4Q A;  3ISB A;  4DO9 A;  5III A;  7ICS A;  4P4M A;  2Q66 A;  3RH4 A;  1KDH A;  5DED A;  5D49 A;  1NOM A;  3UXO A;  1V4A A;  3RJG A;  2O1P A;  3H3A A;  5F2V O;  4JWM A;  4M0A A;  4RQ7 A;  4IQU A;  4UB5 A;  4O5C A;  2GAF D;  2BPG A;  1Q78 A;  4JLX A;  4K4H A;  5HR9 A;  4TUP A;  3RH5 A;  5J2B A;  2IUB A;  4WC3 A;  3RJH A;  3UPS A;  9ICE A;  4I2D A;  9ICN A;  5DBB A;  4PHA A;  5IIO A;  5CB1 A;  3AQK A;  4E8F A;  3NWI A;  4UD5 A;  5IIM A;  4K4G A;  8ICM A;  1JAJ A;  1ZQO A;  2FCL A;  4O9M A;  4XQ7 A;  1ZQV A;  3JPR A;  4YD1 A;  8ICQ A;  4FHY A;  4WC6 A;  9ICF A;  3JPS A;  2HHP A;  9ICW A;  3HW8 A;  3MDC A;  4MFA A;  1ZQD A;  8ICT A;  5HRB A;  4PGX A;  4Z6D A;  4KLT A;  4HX0 A;  4KB6 A;  4UAZ A;  5HRI A;  5CR0 A;  5CHE A;  4TUR A;  4PGY A;  5J0S A;  7ICK A;  9ICG A;  4K9A A;  2BE3 A;  8ICX A;  2VAN A;  4KLD A;  4OAG A;  3MCR A;  5J0U A;  7ICU A;  4FHP A;  8ICB A;  4X4T A;  4KLE A;  5HC9 A;  4RPX A;  4EP7 A;  4O5E A;  1BPD A;  7ICM A;  4X0A A;  2PFN A;  4IQV A;  5J2D A;  9ICC A;  9ICH A;  2ZH5 A;  4I2J A;  4MF2 A;  8ICZ A;  4XRH A;  1BPB A;  4I2B A;  4IQW A;  4WC7 A;  4E7X A;  3B0X A;  4RQ1 A;  4M47 A;  8ICA A;  8ICS A;  3NVO A;  3RJJ A;  3ISC A;  7ICV A;  4WC1 A;  2BPC A;  4WC5 A;  5IIN A;  3AQL A;  4KLS A;  5HRD A;  2FMQ A;  4K4I A;  4PHD A;  1ZQP A;  4QZA A;  4WC0 A;  4KLQ A;  1ZQY A;  3JYY A;  4PHE A;  9ICX A;  5IIJ A;  4KLF A;  3HJ1 A;  1VFG A;  8ICF A;  9ICR A;  4FHX A;  8ICR A;  4NKT A;  2EWR A;  4RWN A;  4XA5 A;  4KLM A;  4YD2 A;  3HIY A;  4FO1 A;  4EV6 A;  4LVS A;  4KLH A;  2M2U A;  1UEV A;  4WH5 A;  2BCS A;  9ICT A;  3H38 A;  7ICR A;  5CFT A;  4K9B A;  4I2E A;  7ICJ A;  1MIW A;  1JMS A;  5D46 A;  4DOC A;  3ER8 C;  1ZQW A;  4R64 A;  4MF8 A;  2ZHA A;  3ERC C;  4RT3 A;  1RPL A;  5DEC A;  4QZB A;  3OV7 A;  8ICY A;  3RJK A;  4M2Y A;  3UPQ A;  3NYB A;  1ZQA A;  4I29 A;  4KLI A;  8ICV A;  1ZQQ A;  5D62 A;  2B56 A;  4O5K A;  7ICT A;  2ZH6 A;  2W9M A;  2I9G A;  4MFF A;  3UXN A;  4KLU A;  5DBA A;  3C2M A;  7ICI A;  4NXV A;  3JZ0 A;  5DBC A;  5J2C A;  4K98 A;  5D63 A;  4WC2 A;  9ICP A;  8ICC A;  2BCQ A;  4O67 A;  2PXI A;  4JWN A;  4O68 A;  4M5D A;  4WC4 A;  1ZQI A;  8ICG A;  1MIY A;  5J0P A;  4NXT A;  1ZQC A;  3K7D A;  1ZQU A;  5DDY A;  5EOZ A;  9ICL A;  1KNY A;  4NXU A;  4P2H A;  3OUY A;  4RQ5 A;  9ICU A;  5HHI A; 
#chains in the Genus database with same CATH homology
 4LZD A;  4RQ3 A;  2DVI A;  9ICV A;  1MQ3 A;  3AQM A;  3PMN A;  3UQ0 A;  5CP2 A;  4PGQ A;  4X4U A;  3HX0 A;  4RPZ A;  8ICW A;  4RPY A;  1TFW A;  4AT9 A;  2FMS A;  7ICN A;  3WFR E;  5J0R A;  4AT8 B;  4LZG A;  4GXK A;  1JQR A;  4F5O A;  4TUQ A;  4FO6 A;  3OVB A;  4RQ4 A;  4UBC A;  3JPT A;  4Z6F A;  5J2K A;  3TFS A;  4X4N A;  1R8B A;  4WBY A;  4S3N A;  5J0X A;  4UB4 A;  2ISP A;  3C66 A;  1R8C A;  4M9J A;  5J0Y A;  4RWP A;  3L9D A;  4YMO A;  4I28 A;  1HUZ A;  4X4P A;  2BCR A;  1TV9 A;  4NXZ A;  1ZQH A;  4RQ2 A;  4YN4 A;  3UQ2 A;  4Z6C A;  3RJE A;  5CWR A;  7ICF A;  5HRE A;  1ZQF A;  1BPX A;  4MFC A;  1HUO A;  5HRF A;  1ZQR A;  3V7K A;  4YMM A;  3WFQ E;  5J2I A;  9ICA A;  4FHW A;  4RT2 A;  4EBJ A;  4ATB B;  4GXJ A;  1ZJM A;  5HRG A;  2PFP A;  4NLN A;  3H39 A;  4ATB A;  5J0T A;  3MDA A;  1MIV A;  5J29 A;  8ICO A;  2PFQ A;  8ICI A;  1ZQT A;  2BCU A;  5DB6 A;  5IIK A;  4NM1 A;  1JN3 A;  4P4P A;  8ICK A;  4EBK A;  3OGU A;  7ICP A;  9ICJ A;  4GXI A;  4RWO A;  2DR9 A;  1ZQN A;  5IIL A;  5DB8 A;  2ZH1 A;  1VJ7 A;  1YLQ A;  9ICB A;  4KLG A;  2ZH4 A;  7ICL A;  4UAW A;  3V7J A;  5D4B A;  5J2E A;  1XSL A;  3C18 A;  1ZQB A;  2ZH2 A;  4F5N A;  4F5Q A;  4WBZ A;  4I2C A;  3OVA A;  1R89 A;  4YMN A;  4FH3 A;  1KEJ A;  8ICE A;  4NLK A;  4M9G A;  4E80 A;  4AT8 A;  1ZQG A;  5TZV A;  3WFP A;  4UB2 A;  5DB9 A;  4FHV A;  3JPN A;  2ZH9 A;  3RH6 A;  4UBB A;  3MGI A;  7ICG A;  4R65 A;  4KLJ A;  9ICS A;  1PX5 A;  3JPO A;  4M9N A;  2M2W A;  3AUO A;  4PPX A;  5J2G A;  2ZH3 A;  7ICH A;  1ZQJ A;  5J2A A;  4AT9 B;  4IQT A;  8ICH A;  4P4O A;  4TUS A;  9ICK A;  1ZQS A;  2IHM A;  2NRK A;  4DOB A;  1RZT A;  3OUY B;  1Q79 A;  4I2H A;  4LT6 A;  5BOM A;  4X0B A;  5J0W A;  3C2L A;  3LK9 A;  1F5A A;  9ICI A;  4AT7 B;  8ICL A;  4X5V A;  4YCX A;  2RFF A;  3C5G A;  1UEU A;  4X4V A;  4I2I A;  4PHP A;  4F5R A;  2DRB A;  1NO5 A;  2BPF A;  5CJ7 A;  1BPY A;  4X4O A;  4M9H A;  4I2G A;  3UXP A;  4DOA A;  1UET A;  4Z6E A;  3V7L A;  4RWQ A;  3WFS C;  2BCV A;  3B0Y A;  4XUS A;  4UAY A;  4R66 A;  4QZG A;  4RQ8 A;  3ISD A;  3AU2 A;  5HRL A;  1XSP A;  4QZH A;  4UB1 A;  4QZI A;  1WOT A;  3MBY A;  9ICQ A;  2ISO A;  4NLZ A;  5J0Q A;  1BPE A;  4PH5 A;  7ICE A;  4QZC A;  2PBE A;  4RQ6 A;  5DDM A;  4IG8 A;  3PNC A;  4UD4 A;  8ICU A;  4QZF A;  5J2H A;  4QZ8 A;  5HRK A;  3HJ4 A;  3MGH A;  1ZQK A;  1MQ2 A;  7ICO A;  3C2K A;  3V72 A;  1R8A A;  3C5F A;  9ICM A;  4NKU A;  2DR7 A;  4KLL A;  1ZQL A;  4X4S A;  4I27 A;  4I2A A;  5J2F A;  3GDX A;  3RJI A;  5DB7 A;  1BPZ A;  4AT7 A;  4RQ0 A;  1OU5 A;  2FMP A;  2DRA A;  4WCW A;  1ZQX A;  1ZQZ A;  2ZHB A;  4UB3 A;  4QZ9 A;  5BOL A;  1TVA A;  5CHG A;  2P66 A;  4QZE A;  8ICP A;  4NM2 A;  1FA0 A;  5HRH A;  4R63 A;  5J2J A;  3WFO A;  4I2F A;  5CA7 A;  2M2T A;  8ICJ A;  3AQN A;  4QZD A;  4M04 A;  3AU6 A;  3JPQ A;  8ICN A;  5DKW A;  3H37 A;  4FH5 A;  2ID1 A;  2M2V A;  3OVS A;  2O5A A;  4XQ8 A;  3LQC B;  3RJF A;  3PML A;  2PFO A;  4NY8 A;  4M9L A;  5BPC A;  1ZQM A;  9ICO A;  3TFR A;  2GWS A;  1XSN A;  7ICQ A;  3K75 D;  4X4R A;  1TFY A;  5HHH A;  1ZQE A;  3HWT A;  2DR5 A;  1ZJN A;  2DR8 A;  2ZH7 A;  3JPP A;  5J0O A;  4F5P A;  4KLO A;  2ZH8 A;  4X4Q A;  3ISB A;  4DO9 A;  5III A;  7ICS A;  4P4M A;  2Q66 A;  3RH4 A;  1KDH A;  5DED A;  5D49 A;  1NOM A;  3UXO A;  1V4A A;  3RJG A;  2O1P A;  3H3A A;  5F2V O;  4JWM A;  4M0A A;  4RQ7 A;  4IQU A;  4UB5 A;  4O5C A;  2BPG A;  1Q78 A;  4K4H A;  5HR9 A;  4TUP A;  3RH5 A;  5J2B A;  4WC3 A;  3RJH A;  3UPS A;  9ICE A;  4I2D A;  9ICN A;  5DBB A;  4PHA A;  5IIO A;  5CB1 A;  3AQK A;  4E8F A;  4UD5 A;  5IIM A;  4K4G A;  8ICM A;  1JAJ A;  1ZQO A;  4O9M A;  4XQ7 A;  1ZQV A;  3JPR A;  4YD1 A;  8ICQ A;  4FHY A;  4WC6 A;  9ICF A;  3JPS A;  2HHP A;  9ICW A;  3HW8 A;  3MDC A;  4MFA A;  1ZQD A;  8ICT A;  5HRB A;  4PGX A;  4Z6D A;  4KLT A;  4UAZ A;  5HRI A;  5CR0 A;  4TUR A;  4PGY A;  5J0S A;  7ICK A;  9ICG A;  2BE3 A;  8ICX A;  2VAN A;  4KLD A;  5J0U A;  7ICU A;  4FHP A;  8ICB A;  4X4T A;  4KLE A;  5HC9 A;  4RPX A;  4EP7 A;  4O5E A;  1BPD A;  7ICM A;  4X0A A;  2PFN A;  4IQV A;  5J2D A;  9ICC A;  9ICH A;  2ZH5 A;  4I2J A;  4MF2 A;  8ICZ A;  4XRH A;  1BPB A;  4I2B A;  4IQW A;  4WC7 A;  4E7X A;  3B0X A;  4RQ1 A;  4M47 A;  8ICA A;  8ICS A;  3RJJ A;  3ISC A;  7ICV A;  4WC1 A;  2BPC A;  4WC5 A;  5IIN A;  3AQL A;  4KLS A;  5HRD A;  2FMQ A;  4K4I A;  4PHD A;  1ZQP A;  4QZA A;  4WC0 A;  4KLQ A;  1ZQY A;  3JYY A;  4PHE A;  9ICX A;  5IIJ A;  4KLF A;  3HJ1 A;  1VFG A;  8ICF A;  9ICR A;  4FHX A;  8ICR A;  4NKT A;  4RWN A;  4XA5 A;  4KLM A;  4YD2 A;  3HIY A;  4LVS A;  4KLH A;  2M2U A;  1UEV A;  2BCS A;  9ICT A;  3H38 A;  7ICR A;  4I2E A;  7ICJ A;  1MIW A;  1JMS A;  5D46 A;  4DOC A;  1ZQW A;  4R64 A;  4MF8 A;  2ZHA A;  4RT3 A;  1RPL A;  5DEC A;  4QZB A;  3OV7 A;  8ICY A;  3RJK A;  4M2Y A;  3UPQ A;  3NYB A;  1ZQA A;  4I29 A;  4KLI A;  8ICV A;  1ZQQ A;  4O5K A;  7ICT A;  2ZH6 A;  2W9M A;  2I9G A;  4MFF A;  3UXN A;  4KLU A;  5DBA A;  3C2M A;  7ICI A;  3JZ0 A;  5DBC A;  5J2C A;  4WC2 A;  9ICP A;  8ICC A;  2BCQ A;  2PXI A;  4JWN A;  4M5D A;  4WC4 A;  1ZQI A;  8ICG A;  1MIY A;  5J0P A;  1ZQC A;  1ZQU A;  5DDY A;  5EOZ A;  9ICL A;  1KNY A;  3OUY A;  4P2H A;  4RQ5 A;  9ICU A;  5HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...