5HRHA

The crystal structure of asfvpolx(h115f/r127a mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIAAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrhA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrhA01
2FMSA 4NKUA 4MF8A 1Q78A 7ICGA 1R8AA 4R63A 2DR7A 4YD2A 5J2JA 4WC0A 3JPNA 2DR8A 3B0XA 2DVIA 8ICFA 4WC1A 7ICLA 3H37A 4JWMA 5DDMA 3AU6A 4DOCA 1ZQKA 4AT8B 7ICJA 2ZH7A 2NRKA 4KLTA 4RQ3A 4ATBA 4FO6A 3MDAA 9ICWA 1BPZA 4NY8A 4WC2A 5DDYA 4QZFA 3HW8A 5J2BA 2I9GA 4K4HA 5HRFA 5HRBA 1XSPA 4NLZA 8ICIA 2PBEA 1ZQBA 4GXJA 9ICOA 5HC9A 4PHPA 9ICPA 7ICRA 3RH4A 4KLGA 2O1PA 9ICGA 3UQ0A 4RQ7A 4FHVA 4QZEA 5IIMA 5CP2A 4MFFA 3HWTA 3RJGA 8ICYA 1UEUA 4WC5A 4E7XA 4KLIA 2ZH1A 4F5QA 1TVAA 8ICBA 9ICFA 2ZH3A 4UAZA 8ICUA 3WFOA 2PFPA 3GDXA 5J29A 5CB1A 4I2IA 4XUSA 3RJIA 5DB6A 4JWNA 7ICOA 4EBJA 4NLNA 3WFSC 4WBZA 4O5KA 3RJJA 4KLEA 4FH5A 4YMMA 2DR9A 1ZQMA 5J0SA 4M9HA 8ICZA 2BPGA 5J0YA 1ZQXA 1FA0A 5D46A 5TZVA 9ICHA 4DOAA 5BOLA 4RQ5A 3AQMA 3OUYB 1ZQQA 5J0UA 7ICTA 4RT2A 3HX0A 4R65A 1MIYA 1OU5A 3JPSA 4IQVA 4NXZA 5J0XA 4UB3A 4KLOA 2HHPA 4E8FA 1UETA 3HJ4A 4UBCA 3HIYA 4RWQA 9ICIA 4MFAA 9ICRA 4PH5A 5DBBA 7ICVA 4S3NA 4YMNA 2PXIA 4P2HA 4KLUA 7ICHA 4WCWA 1ZQSA 3OVAA 1ZQWA 9ICJA 3H39A 3AU2A 4KLLA 4NKTA 4AT7B 3MGIA 3WFQE 2ISPA 9ICXA 4XRHA 1JQRA 4DO9A 1KDHA 4X4OA 4RQ8A 1BPDA 4RWPA 2BE3A 4LZGA 3RH5A 2ZH6A 1ZQAA 4RWNA 5DBAA 5J0RA 4Z6EA 2Q66A 5DECA 4QZIA 4UAWA 4Z6CA 2BCSA 4F5RA 4QZ8A 4QZHA 4F5PA 4PPXA 8ICGA 1ZQGA 3JYYA 5J2GA 3V7KA 2ZH9A 7ICEA 3JPPA 1WOTA 9ICTA 4PHDA 9ICKA 2PFQA 4I2GA 4NM2A 7ICNA 5HRDA 4WC4A 5J2HA 1TV9A 2FMQA 4LT6A 5J2DA 3MDCA 4MF2A 1NOMA 1ZQLA 2ISOA 4M47A 4I2BA 2ZH5A 4O9MA 2O5AA 4E80A 1BPEA 4XQ8A 5J2CA 2VANA 4WBYA 4KLSA 2BCQA 3RH6A 4KLJA 4QZGA 1ZQYA 1MIVA 3JPQA 4FHXA 1JMSA 8ICHA 5HRHA 3AQNA 4UB5A 4UB2A 4I2DA 3OV7A 4KLFA 4F5OA 4P4OA 3ISDA 4X4PA 4ATBB 2FMPA 1ZQNA 4X4VA 3UXOA 1ZQZA 5HRLA 3H38A 5IINA 4M9LA 4I2JA 4I29A 7ICKA 4UAYA 8ICPA 5DB8A 3TFSA 4Z6DA 4AT9B 4IG8A 3H3AA 9ICSA 9ICNA 4X0BA 4IQUA 5BPCA 8ICRA 9ICQA 3OGUA 3MBYA 1HUOA 4NLKA 4O5CA 8ICLA 4UBBA 4FHYA 4FHPA 5CWRA 7ICPA 2DRBA 2DRAA 4RQ2A 2ZH8A 1MQ2A 1ZQPA 1XSNA 5HRIA 1YLQA 1TFWA 4YMOA 7ICIA 4MFCA 4R66A 1ZQDA 3MGHA 4K4IA 5IIKA 3C18A 1R89A 3UXPA 3L9DA 1UEVA 2ZHBA 1ZQJA 4UB4A 8ICSA 7ICQA 2M2TA 3JZ0A 3PNCA 3UQ2A 9ICCA 4X4RA 3NYBA 4RWOA 3WFRE 3UXNA 8ICCA 3JPTA 4R64A 3TFRA 4IQTA 1JN3A 2BPCA 1ZJNA 4I2HA 3RJFA 4WC6A 2M2WA 4Z6FA 4QZDA 4I2EA 4M9NA 4I2CA 4KLQA 4KLDA 4EBKA 1V4AA 1ZQOA 4GXKA 1HUZA 4NM1A 8ICVA 5CHGA 1ZQVA 4EP7A 3RJHA 4AT9A 5HREA 4PHEA 1ZJMA 3OVBA 8ICNA 2ZH4A 4M0AA 4RPZA 3UPSA 4IQWA 2DR5A 3JPRA 3LQCB 3ISCA 5DB9A 9ICLA 3LK9A 4LZDA 3C5GA 1MIWA 2ID1A 5J0OA 4I2FA 3OUYA 4RT3A 3C2KA 1RPLA 4PHAA 3V7LA 5J0WA 4AT7A 3RJKA 1ZQUA 4QZAA 4RPYA 5J0QA 3V72A 1BPXA 4M5DA 1VJ7A 1ZQEA 5DBCA 8ICTA 3AUOA 8ICJA 4RQ0A 3PMLA 4F5NA 1VFGA 4RPXA 5J0TA 5HRGA 5HRKA 4KLMA 5HR9A 9ICAA 9ICMA 4LVSA 3JPOA 4RQ6A 2W9MA 1ZQTA 4X0AA 1ZQRA 7ICSA 2ZH2A 5D49A 8ICMA 4YN4A 4M04A 5DB7A 4YCXA 1PX5A 3C2MA 5CJ7A 4PGYA 5IILA 4X4NA 2M2UA 8ICEA 3OVSA 4P4PA 4I2AA 5CA7A 7ICFA 8ICAA 1ZQFA 4PGXA 4XA5A 4QZCA 5J2EA 9ICEA 4RQ4A 4XQ7A 4X5VA 3C5FA 7ICUA 5D4BA 5J2FA 5IIIA 4AT8A 2ZHAA 1R8CA 3AQLA 5HHHA 7ICMA 3K75D 4UD5A 4FH3A 4X4TA 5BOMA 1F5AA 2BPFA 3RJEA 8ICWA 4O5EA 2PFOA 3UPQA 4X4UA 8ICOA 8ICKA 3AQKA 8ICQA 5DKWA 1MQ3A 4RQ1A 4TUSA 9ICBA 2BCRA 5CR0A 4TURA 5J2AA 1TFYA 3C66A 5HHIA 4FHWA 2BCUA 1BPBA 5IIJA 9ICVA 2P66A 4M9GA 9ICUA 2RFFA 4WC3A 4GXIA 5EOZA 1NO5A 1ZQHA 1Q79A 1RZTA 4M9JA 4TUQA 4WC7A 3C2LA 4P4MA 4PGQA 1ZQCA 3B0YA 1BPYA 4I28A 4YD1A 4K4GA 1KNYA 3WFPA 3HJ1A 4QZBA 5J0PA 1ZQIA 1R8BA 5DEDA 3PMNA 5J2IA 2PFNA 4I27A 2BCVA 3ISBA 4UD4A 2M2VA 4QZ9A 4TUPA 1KEJA 5F2VO 2IHMA 1JAJA 2GWSA 4X4QA 5IIOA 4DOBA 4UB1A 8ICXA 1XSLA 4KLHA 4X4SA 4M2YA 5J2KA 3V7JA
chains in the Genus database with same CATH superfamily
2FMSA 4NKUA 4MF8A 1Q78A 7ICGA 1R8AA 4R63A 2DR7A 4YD2A 5J2JA 4WC0A 3JPNA 2DR8A 3B0XA 2DVIA 8ICFA 4WC1A 7ICLA 3K7DA 3H37A 4JWMA 5DDMA 3AU6A 4DOCA 4O6AA 1ZQKA 4AT8B 7ICJA 2ZH7A 2NRKA 4KLTA 4RQ3A 4ATBA 4FO6A 3MDAA 9ICWA 4I0UA 1BPZA 4NY8A 4WC2A 5DDYA 4QZFA 3HW8A 5J2BA 2I9GA 4K4HA 5HRFA 5HRBA 1XSPA 4NLZA 8ICIA 2PBEA 1ZQBA 3MCRA 4GXJA 9ICOA 5HC9A 4PHPA 9ICPA 7ICRA 3RH4A 4OAIZ 4KLGA 2O1PA 9ICGA 3UQ0A 4RQ7A 4FHVA 4QZEA 5IIMA 5CP2A 4MFFA 3HWTA 3RJGA 8ICYA 1UEUA 4WC5A 4E7XA 4KLIA 2ZH1A 4F5QA 1TVAA 8ICBA 9ICFA 2ZH3A 4UAZA 4FO1A 8ICUA 3WFOA 2PFPA 3GDXA 5J29A 5CB1A 4I2IA 4XUSA 4LEZA 3RJIA 5DB6A 4JWNA 7ICOA 4EBJA 4NLNA 3WFSC 4WBZA 4N7RA 4O5KA 3RJJA 4KLEA 4FH5A 4YMMA 2DR9A 1ZQMA 4NXXA 5J0SA 4M9HA 8ICZA 2BPGA 5J0YA 1ZQXA 1FA0A 5D46A 5TZVA 4EEDA 9ICHA 4DOAA 5BOLA 4RQ5A 3AQMA 3OUYB 1ZQQA 5J0UA 7ICTA 4RT2A 3HX0A 4R65A 4WH5A 1MIYA 1OU5A 3JPSA 4IQVA 4NXZA 5J0XA 4UB3A 4KLOA 2HHPA 4E8FA 1UETA 3HJ4A 4UBCA 3HIYA 4RWQA 9ICIA 4MFAA 9ICRA 4PH5A 5DBBA 7ICVA 4S3NA 4YMNA 2PXIA 4P2HA 4KLUA 7ICHA 4WCWA 1ZQSA 3OVAA 1ZQWA 9ICJA 3H39A 4K8VA 3AU2A 4KLLA 4NKTA 4AT7B 3MGIA 3WFQE 2ISPA 9ICXA 4XRHA 1JQRA 4DO9A 1KDHA 4X4OA 4RQ8A 1BPDA 4RWPA 2BE3A 4LZGA 3RH5A 2ZH6A 1ZQAA 4WOYA 4RWNA 5DBAA 5J0RA 4Z6EA 2Q66A 5DECA 4QZIA 4UAWA 4LEVA 4Z6CA 2BCSA 5CFTA 4F5RA 4QZ8A 5CHEA 4QZHA 4F5PA 4PPXA 8ICGA 1ZQGA 3JYYA 5J2GA 3V7KA 2ZH9A 7ICEA 3JPPA 4MKPA 1WOTA 5D61A 9ICTA 4PHDA 2HN1A 3CK6A 9ICKA 2PFQA 2FCLA 4I2GA 4NM2A 7ICNA 5HRDA 4WC4A 5J2HA 2IHOA 1TV9A 2FMQA 4LT6A 5J2DA 3MDCA 4MF2A 1NOMA 1ZQLA 2ISOA 3NKUA 4JLXA 4M47A 4K96A 3EF2A 4I2BA 2ZH5A 4O9MA 2O5AA 4E80A 1BPEA 4XQ8A 5J2CA 2VANA 4WBYA 4KLSA 2BCQA 3RH6A 4KLJA 4QZGA 1ZQYA 1MIVA 3JPQA 4FHXA 1JMSA 8ICHA 5HRHA 3AQNA 4UB5A 4UB2A 4I2DA 3OV7A 4KLFA 4F5OA 4P4OA 3ISDA 4X4PA 4ATBB 2FMPA 4NXUA 1ZQNA 4X4VA 3UXOA 4NXVA 1ZQZA 5HRLA 3H38A 5IINA 4M9LA 4I2JA 4I29A 7ICKA 3JCFA 3ERCC 4UAYA 8ICPA 5DB8A 3TFSA 4Z6DA 4AT9B 4IG8A 3H3AA 9ICSA 9ICNA 4X0BA 4IQUA 5BPCA 8ICRA 9ICQA 3OGUA 3MBYA 1HUOA 4NLKA 3ER8C 4O5CA 8ICLA 4UBBA 4FHYA 4FHPA 4WQKA 5CWRA 7ICPA 2DRBA 2DRAA 4RQ2A 2ZH8A 5JTGA 1MQ2A 1ZQPA 1XSNA 5HRIA 1YLQA 1TFWA 4YMOA 7ICIA 4MFCA 4R66A 1ZQDA 4O69A 3MGHA 2BBHA 4K4IA 3OWGA 3ER9B 5IIKA 4K98A 3C18A 3PHZA 1R89A 3UXPA 3L9DA 5D62A 1UEVA 2ZHBA 1ZQJA 4K9AA 4UB4A 8ICSA 7ICQA 2M2TA 3JZ0A 3PNCA 4O67A 3UQ2A 9ICCA 4X4RA 3NYBA 4RWOA 3WFRE 3UXNA 8ICCA 4K99A 3JPTA 4R64A 3TFRA 4IQTA 1JN3A 2BPCA 1ZJNA 4I2HA 4OAFA 3RJFA 4WC6A 2M2WA 4Z6FA 4QZDA 4I2EA 4EGWA 4M9NA 4I2CA 4KLQA 4KLDA 4EBKA 1V4AA 1ZQOA 4GXKA 1HUZA 4NM1A 2B51A 8ICVA 5CHGA 1ZQVA 4EP7A 4OAGA 3RJHA 4AT9A 5HREA 4PHEA 1ZJMA 3OVBA 8ICNA 4HX0A 2ZH4A 4M0AA 4OAHA 4EV6A 4RPZA 3UPSA 4IQWA 4LEYA 2DR5A 3JPRA 3NVOA 4KM5A 3LQCB 3ISCA 5DB9A 9ICLA 3LK9A 4LZDA 3C5GA 1MIWA 4K97A 2ID1A 5J0OA 4I2FA 3OUYA 4RT3A 3C2KA 1RPLA 4PHAA 3V7LA 5J0WA 2HN2A 4AT7A 3RJKA 1ZQUA 4QZAA 4RPYA 5J0QA 3V72A 1BPXA 4M5DA 1VJ7A 1ZQEA 5DBCA 3NWIA 8ICTA 3AUOA 8ICJA 4RQ0A 3PMLA 4F5NA 1VFGA 4RPXA 4JLZA 5J0TA 5HRGA 5HRKA 4KLMA 5HR9A 9ICAA 9ICMA 4LVSA 3JPOA 4XJEA 4RQ6A 2W9MA 1ZQTA 4X0AA 1ZQRA 7ICSA 2ZH2A 5D49A 8ICMA 4LEWA 4YN4A 4M04A 5DB7A 4YCXA 1PX5A 3C2MA 5CJ7A 4PGYA 5IILA 4X4NA 2M2UA 8ICEA 3OVSA 5B3QA 4P4PA 4I2AA 5CA7A 7ICFA 8ICAA 1ZQFA 4PGXA 2B56A 4XA5A 4QZCA 5J2EA 9ICEA 4RQ4A 2EWRA 4XQ7A 5CFSA 4X5VA 3C5FA 5D63A 7ICUA 2B4VA 5D4BA 5J2FA 5IIIA 2GA9D 4AT8A 2ZHAA 1R8CA 3AQLA 5HHHA 7ICMA 3K75D 4UD5A 4FH3A 4X4TA 5BOMA 1F5AA 2BPFA 3RJEA 8ICWA 4O5EA 4NXTA 2PFOA 3UPQA 4X4UA 4WQLA 8ICOA 8ICKA 3AQKA 8ICQA 5DKWA 1MQ3A 4RQ1A 4TUSA 9ICBA 2BCRA 5CR0A 4TURA 1GPJA 5J2AA 1TFYA 4K9BA 2GAFD 5HHIA 2BBJA 3C66A 4FHWA 2BCUA 1BPBA 2IUBA 5IIJA 5CFUA 9ICVA 2P66A 4M9GA 9ICUA 2RFFA 4WC3A 4GXIA 5EOZA 1NO5A 1ZQHA 1Q79A 1RZTA 4M9JA 4TUQA 4WC7A 3C2LA 4P4MA 4PGQA 1ZQCA 4NXWA 3B0YA 1BPYA 4I28A 4YD1A 4K4GA 1KNYA 3WFPA 3HJ1A 4QZBA 5J0PA 1ZQIA 4O68A 1R8BA 5DEDA 3PMNA 5J2IA 2PFNA 4I27A 2BCVA 3ISBA 4UD4A 2M2VA 4QZ9A 4TUPA 1KEJA 4EEBA 5F2VO 4KB6A 5B3PA 2IHMA 1JAJA 2GWSA 4X4QA 5IIOA 4DOBA 4UB1A 8ICXA 1XSLA 4KLHA 4X4SA 4M2YA 5J2KA 3V7JA
chains in the Genus database with same CATH topology
2FMSA 4NKUA 4MF8A 1Q78A 7ICGA 1R8AA 4R63A 2DR7A 4YD2A 5J2JA 4WC0A 3JPNA 2DR8A 3B0XA 2DVIA 8ICFA 4WC1A 7ICLA 3H37A 4JWMA 5DDMA 3AU6A 4DOCA 1ZQKA 4AT8B 7ICJA 2ZH7A 2NRKA 4KLTA 4RQ3A 4ATBA 4FO6A 3MDAA 9ICWA 1BPZA 4NY8A 4WC2A 5DDYA 4QZFA 3HW8A 5J2BA 2I9GA 4K4HA 5HRFA 5HRBA 1XSPA 4NLZA 8ICIA 2PBEA 1ZQBA 4GXJA 9ICOA 5HC9A 4PHPA 9ICPA 7ICRA 3RH4A 4KLGA 2O1PA 9ICGA 3UQ0A 4RQ7A 4FHVA 4QZEA 5IIMA 5CP2A 4MFFA 3HWTA 3RJGA 8ICYA 1UEUA 4WC5A 4E7XA 4KLIA 2ZH1A 4F5QA 1TVAA 8ICBA 9ICFA 2ZH3A 4UAZA 8ICUA 3WFOA 2PFPA 3GDXA 5J29A 5CB1A 4I2IA 4XUSA 3RJIA 5DB6A 4JWNA 7ICOA 4EBJA 4NLNA 3WFSC 4WBZA 4O5KA 3RJJA 4KLEA 4FH5A 4YMMA 2DR9A 1ZQMA 5J0SA 4M9HA 8ICZA 2BPGA 5J0YA 1ZQXA 1FA0A 5D46A 5TZVA 9ICHA 4DOAA 5BOLA 4RQ5A 3AQMA 3OUYB 1ZQQA 5J0UA 7ICTA 4RT2A 3HX0A 4R65A 1MIYA 1OU5A 3JPSA 4IQVA 4NXZA 5J0XA 4UB3A 4KLOA 2HHPA 4E8FA 1UETA 3HJ4A 4UBCA 3HIYA 4RWQA 9ICIA 4MFAA 9ICRA 4PH5A 5DBBA 7ICVA 4S3NA 4YMNA 2PXIA 4P2HA 4KLUA 7ICHA 4WCWA 1ZQSA 3OVAA 1ZQWA 9ICJA 3H39A 3AU2A 4KLLA 4NKTA 4AT7B 3MGIA 3WFQE 2ISPA 9ICXA 4XRHA 1JQRA 4DO9A 1KDHA 4X4OA 4RQ8A 1BPDA 4RWPA 2BE3A 4LZGA 3RH5A 2ZH6A 1ZQAA 4RWNA 5DBAA 5J0RA 4Z6EA 2Q66A 5DECA 4QZIA 4UAWA 4Z6CA 2BCSA 4F5RA 4QZ8A 4QZHA 4F5PA 4PPXA 8ICGA 1ZQGA 3JYYA 5J2GA 3V7KA 2ZH9A 7ICEA 3JPPA 1WOTA 9ICTA 4PHDA 9ICKA 2PFQA 4I2GA 4NM2A 7ICNA 5HRDA 4WC4A 5J2HA 1TV9A 2FMQA 4LT6A 5J2DA 3MDCA 4MF2A 1NOMA 1ZQLA 2ISOA 4M47A 4I2BA 2ZH5A 4O9MA 2O5AA 4E80A 1BPEA 4XQ8A 5J2CA 2VANA 4WBYA 4KLSA 2BCQA 3RH6A 4KLJA 4QZGA 1ZQYA 1MIVA 3JPQA 4FHXA 1JMSA 8ICHA 5HRHA 3AQNA 4UB5A 4UB2A 4I2DA 3OV7A 4KLFA 4F5OA 4P4OA 3ISDA 4X4PA 4ATBB 2FMPA 1ZQNA 4X4VA 3UXOA 1ZQZA 5HRLA 3H38A 5IINA 4M9LA 4I2JA 4I29A 7ICKA 4UAYA 8ICPA 5DB8A 3TFSA 4Z6DA 4AT9B 4IG8A 3H3AA 9ICSA 9ICNA 4X0BA 4IQUA 5BPCA 8ICRA 9ICQA 3OGUA 3MBYA 1HUOA 4NLKA 4O5CA 8ICLA 4UBBA 4FHYA 4FHPA 5CWRA 7ICPA 2DRBA 2DRAA 4RQ2A 2ZH8A 1MQ2A 1ZQPA 1XSNA 5HRIA 1YLQA 1TFWA 4YMOA 7ICIA 4MFCA 4R66A 1ZQDA 3MGHA 4K4IA 5IIKA 3C18A 1R89A 3UXPA 3L9DA 1UEVA 2ZHBA 1ZQJA 4UB4A 8ICSA 7ICQA 2M2TA 3JZ0A 3PNCA 3UQ2A 9ICCA 4X4RA 3NYBA 4RWOA 3WFRE 3UXNA 8ICCA 3JPTA 4R64A 3TFRA 4IQTA 1JN3A 2BPCA 1ZJNA 4I2HA 3RJFA 4WC6A 2M2WA 4Z6FA 4QZDA 4I2EA 4M9NA 4I2CA 4KLQA 4KLDA 4EBKA 1V4AA 1ZQOA 4GXKA 1HUZA 4NM1A 8ICVA 5CHGA 1ZQVA 4EP7A 3RJHA 4AT9A 5HREA 4PHEA 1ZJMA 3OVBA 8ICNA 2ZH4A 4M0AA 4RPZA 3UPSA 4IQWA 2DR5A 3JPRA 3LQCB 3ISCA 5DB9A 9ICLA 3LK9A 4LZDA 3C5GA 1MIWA 2ID1A 5J0OA 4I2FA 3OUYA 4RT3A 3C2KA 1RPLA 4PHAA 3V7LA 5J0WA 4AT7A 3RJKA 1ZQUA 4QZAA 4RPYA 5J0QA 3V72A 1BPXA 4M5DA 1VJ7A 1ZQEA 5DBCA 8ICTA 3AUOA 8ICJA 4RQ0A 3PMLA 4F5NA 1VFGA 4RPXA 5J0TA 5HRGA 5HRKA 4KLMA 5HR9A 9ICAA 9ICMA 4LVSA 3JPOA 4RQ6A 2W9MA 1ZQTA 4X0AA 1ZQRA 7ICSA 2ZH2A 5D49A 8ICMA 4YN4A 4M04A 5DB7A 4YCXA 1PX5A 3C2MA 5CJ7A 4PGYA 5IILA 4X4NA 2M2UA 8ICEA 3OVSA 4P4PA 4I2AA 5CA7A 7ICFA 8ICAA 1ZQFA 4PGXA 4XA5A 4QZCA 5J2EA 9ICEA 4RQ4A 4XQ7A 4X5VA 3C5FA 7ICUA 5D4BA 5J2FA 5IIIA 4AT8A 2ZHAA 1R8CA 3AQLA 5HHHA 7ICMA 3K75D 4UD5A 4FH3A 4X4TA 5BOMA 1F5AA 2BPFA 3RJEA 8ICWA 4O5EA 2PFOA 3UPQA 4X4UA 8ICOA 8ICKA 3AQKA 8ICQA 5DKWA 1MQ3A 4RQ1A 4TUSA 9ICBA 2BCRA 5CR0A 4TURA 5J2AA 1TFYA 3C66A 5HHIA 4FHWA 2BCUA 1BPBA 5IIJA 9ICVA 2P66A 4M9GA 9ICUA 2RFFA 4WC3A 4GXIA 5EOZA 1NO5A 1ZQHA 1Q79A 1RZTA 4M9JA 4TUQA 4WC7A 3C2LA 4P4MA 4PGQA 1ZQCA 3B0YA 1BPYA 4I28A 4YD1A 4K4GA 1KNYA 3WFPA 3HJ1A 4QZBA 5J0PA 1ZQIA 1R8BA 5DEDA 3PMNA 5J2IA 2PFNA 4I27A 2BCVA 3ISBA 4UD4A 2M2VA 4QZ9A 4TUPA 1KEJA 5F2VO 2IHMA 1JAJA 2GWSA 4X4QA 5IIOA 4DOBA 4UB1A 8ICXA 1XSLA 4KLHA 4X4SA 4M2YA 5J2KA 3V7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMS A;  4NKU A;  4MF8 A;  1Q78 A;  7ICG A;  1R8A A;  4R63 A;  2DR7 A;  4YD2 A;  5J2J A;  4WC0 A;  3JPN A;  2DR8 A;  3B0X A;  2DVI A;  8ICF A;  4WC1 A;  7ICL A;  3H37 A;  4JWM A;  5DDM A;  3AU6 A;  4DOC A;  1ZQK A;  4AT8 B;  7ICJ A;  2ZH7 A;  2NRK A;  4KLT A;  4RQ3 A;  4ATB A;  4FO6 A;  3MDA A;  9ICW A;  1BPZ A;  4NY8 A;  4WC2 A;  5DDY A;  4QZF A;  3HW8 A;  5J2B A;  2I9G A;  4K4H A;  5HRF A;  5HRB A;  1XSP A;  4NLZ A;  8ICI A;  2PBE A;  1ZQB A;  4GXJ A;  9ICO A;  5HC9 A;  4PHP A;  9ICP A;  7ICR A;  3RH4 A;  4KLG A;  2O1P A;  9ICG A;  3UQ0 A;  4RQ7 A;  4FHV A;  4QZE A;  5IIM A;  5CP2 A;  4MFF A;  3HWT A;  3RJG A;  8ICY A;  1UEU A;  4WC5 A;  4E7X A;  4KLI A;  2ZH1 A;  4F5Q A;  1TVA A;  8ICB A;  9ICF A;  2ZH3 A;  4UAZ A;  8ICU A;  3WFO A;  2PFP A;  3GDX A;  5J29 A;  5CB1 A;  4I2I A;  4XUS A;  3RJI A;  5DB6 A;  4JWN A;  7ICO A;  4EBJ A;  4NLN A;  3WFS C;  4WBZ A;  4O5K A;  3RJJ A;  4KLE A;  4FH5 A;  4YMM A;  2DR9 A;  1ZQM A;  5J0S A;  4M9H A;  8ICZ A;  2BPG A;  5J0Y A;  1ZQX A;  1FA0 A;  5D46 A;  5TZV A;  9ICH A;  4DOA A;  5BOL A;  4RQ5 A;  3AQM A;  3OUY B;  1ZQQ A;  5J0U A;  7ICT A;  4RT2 A;  3HX0 A;  4R65 A;  1MIY A;  1OU5 A;  3JPS A;  4IQV A;  4NXZ A;  5J0X A;  4UB3 A;  4KLO A;  2HHP A;  4E8F A;  1UET A;  3HJ4 A;  4UBC A;  3HIY A;  4RWQ A;  9ICI A;  4MFA A;  9ICR A;  4PH5 A;  5DBB A;  7ICV A;  4S3N A;  4YMN A;  2PXI A;  4P2H A;  4KLU A;  7ICH A;  4WCW A;  1ZQS A;  3OVA A;  1ZQW A;  9ICJ A;  3H39 A;  3AU2 A;  4KLL A;  4NKT A;  4AT7 B;  3MGI A;  3WFQ E;  2ISP A;  9ICX A;  4XRH A;  1JQR A;  4DO9 A;  1KDH A;  4X4O A;  4RQ8 A;  1BPD A;  4RWP A;  2BE3 A;  4LZG A;  3RH5 A;  2ZH6 A;  1ZQA A;  4RWN A;  5DBA A;  5J0R A;  4Z6E A;  2Q66 A;  5DEC A;  4QZI A;  4UAW A;  4Z6C A;  2BCS A;  4F5R A;  4QZ8 A;  4QZH A;  4F5P A;  4PPX A;  8ICG A;  1ZQG A;  3JYY A;  5J2G A;  3V7K A;  2ZH9 A;  7ICE A;  3JPP A;  1WOT A;  9ICT A;  4PHD A;  9ICK A;  2PFQ A;  4I2G A;  4NM2 A;  7ICN A;  5HRD A;  4WC4 A;  5J2H A;  1TV9 A;  2FMQ A;  4LT6 A;  5J2D A;  3MDC A;  4MF2 A;  1NOM A;  1ZQL A;  2ISO A;  4M47 A;  4I2B A;  2ZH5 A;  4O9M A;  2O5A A;  4E80 A;  1BPE A;  4XQ8 A;  5J2C A;  2VAN A;  4WBY A;  4KLS A;  2BCQ A;  3RH6 A;  4KLJ A;  4QZG A;  1ZQY A;  1MIV A;  3JPQ A;  4FHX A;  1JMS A;  8ICH A;  5HRH A;  3AQN A;  4UB5 A;  4UB2 A;  4I2D A;  3OV7 A;  4KLF A;  4F5O A;  4P4O A;  3ISD A;  4X4P A;  4ATB B;  2FMP A;  1ZQN A;  4X4V A;  3UXO A;  1ZQZ A;  5HRL A;  3H38 A;  5IIN A;  4M9L A;  4I2J A;  4I29 A;  7ICK A;  4UAY A;  8ICP A;  5DB8 A;  3TFS A;  4Z6D A;  4AT9 B;  4IG8 A;  3H3A A;  9ICS A;  9ICN A;  4X0B A;  4IQU A;  5BPC A;  8ICR A;  9ICQ A;  3OGU A;  3MBY A;  1HUO A;  4NLK A;  4O5C A;  8ICL A;  4UBB A;  4FHY A;  4FHP A;  5CWR A;  7ICP A;  2DRB A;  2DRA A;  4RQ2 A;  2ZH8 A;  1MQ2 A;  1ZQP A;  1XSN A;  5HRI A;  1YLQ A;  1TFW A;  4YMO A;  7ICI A;  4MFC A;  4R66 A;  1ZQD A;  3MGH A;  4K4I A;  5IIK A;  3C18 A;  1R89 A;  3UXP A;  3L9D A;  1UEV A;  2ZHB A;  1ZQJ A;  4UB4 A;  8ICS A;  7ICQ A;  2M2T A;  3JZ0 A;  3PNC A;  3UQ2 A;  9ICC A;  4X4R A;  3NYB A;  4RWO A;  3WFR E;  3UXN A;  8ICC A;  3JPT A;  4R64 A;  3TFR A;  4IQT A;  1JN3 A;  2BPC A;  1ZJN A;  4I2H A;  3RJF A;  4WC6 A;  2M2W A;  4Z6F A;  4QZD A;  4I2E A;  4M9N A;  4I2C A;  4KLQ A;  4KLD A;  4EBK A;  1V4A A;  1ZQO A;  4GXK A;  1HUZ A;  4NM1 A;  8ICV A;  5CHG A;  1ZQV A;  4EP7 A;  3RJH A;  4AT9 A;  5HRE A;  4PHE A;  1ZJM A;  3OVB A;  8ICN A;  2ZH4 A;  4M0A A;  4RPZ A;  3UPS A;  4IQW A;  2DR5 A;  3JPR A;  3LQC B;  3ISC A;  5DB9 A;  9ICL A;  3LK9 A;  4LZD A;  3C5G A;  1MIW A;  2ID1 A;  5J0O A;  4I2F A;  3OUY A;  4RT3 A;  3C2K A;  1RPL A;  4PHA A;  3V7L A;  5J0W A;  4AT7 A;  3RJK A;  1ZQU A;  4QZA A;  4RPY A;  5J0Q A;  3V72 A;  1BPX A;  4M5D A;  1VJ7 A;  1ZQE A;  5DBC A;  8ICT A;  3AUO A;  8ICJ A;  4RQ0 A;  3PML A;  4F5N A;  1VFG A;  4RPX A;  5J0T A;  5HRG A;  5HRK A;  4KLM A;  5HR9 A;  9ICA A;  9ICM A;  4LVS A;  3JPO A;  4RQ6 A;  2W9M A;  1ZQT A;  4X0A A;  1ZQR A;  7ICS A;  2ZH2 A;  5D49 A;  8ICM A;  4YN4 A;  4M04 A;  5DB7 A;  4YCX A;  1PX5 A;  3C2M A;  5CJ7 A;  4PGY A;  5IIL A;  4X4N A;  2M2U A;  8ICE A;  3OVS A;  4P4P A;  4I2A A;  5CA7 A;  7ICF A;  8ICA A;  1ZQF A;  4PGX A;  4XA5 A;  4QZC A;  5J2E A;  9ICE A;  4RQ4 A;  4XQ7 A;  4X5V A;  3C5F A;  7ICU A;  5D4B A;  5J2F A;  5III A;  4AT8 A;  2ZHA A;  1R8C A;  3AQL A;  5HHH A;  7ICM A;  3K75 D;  4UD5 A;  4FH3 A;  4X4T A;  5BOM A;  1F5A A;  2BPF A;  3RJE A;  8ICW A;  4O5E A;  2PFO A;  3UPQ A;  4X4U A;  8ICO A;  8ICK A;  3AQK A;  8ICQ A;  5DKW A;  1MQ3 A;  4RQ1 A;  4TUS A;  9ICB A;  2BCR A;  5CR0 A;  4TUR A;  5J2A A;  1TFY A;  3C66 A;  5HHI A;  4FHW A;  2BCU A;  1BPB A;  5IIJ A;  9ICV A;  2P66 A;  4M9G A;  9ICU A;  2RFF A;  4WC3 A;  4GXI A;  5EOZ A;  1NO5 A;  1ZQH A;  1Q79 A;  1RZT A;  4M9J A;  4TUQ A;  4WC7 A;  3C2L A;  4P4M A;  4PGQ A;  1ZQC A;  3B0Y A;  1BPY A;  4I28 A;  4YD1 A;  4K4G A;  1KNY A;  3WFP A;  3HJ1 A;  4QZB A;  5J0P A;  1ZQI A;  1R8B A;  5DED A;  3PMN A;  5J2I A;  2PFN A;  4I27 A;  2BCV A;  3ISB A;  4UD4 A;  2M2V A;  4QZ9 A;  4TUP A;  1KEJ A;  5F2V O;  2IHM A;  1JAJ A;  2GWS A;  4X4Q A;  5IIO A;  4DOB A;  4UB1 A;  8ICX A;  1XSL A;  4KLH A;  4X4S A;  4M2Y A;  5J2K A;  3V7J A; 
#chains in the Genus database with same CATH topology
 2FMS A;  4NKU A;  4MF8 A;  1Q78 A;  7ICG A;  1R8A A;  4R63 A;  2DR7 A;  4YD2 A;  5J2J A;  4WC0 A;  3JPN A;  2DR8 A;  3B0X A;  2DVI A;  8ICF A;  4WC1 A;  7ICL A;  3K7D A;  3H37 A;  4JWM A;  5DDM A;  3AU6 A;  4DOC A;  4O6A A;  1ZQK A;  4AT8 B;  7ICJ A;  2ZH7 A;  2NRK A;  4KLT A;  4RQ3 A;  4ATB A;  4FO6 A;  3MDA A;  9ICW A;  4I0U A;  1BPZ A;  4NY8 A;  4WC2 A;  5DDY A;  4QZF A;  3HW8 A;  5J2B A;  2I9G A;  4K4H A;  5HRF A;  5HRB A;  1XSP A;  4NLZ A;  8ICI A;  2PBE A;  1ZQB A;  3MCR A;  4GXJ A;  9ICO A;  5HC9 A;  4PHP A;  9ICP A;  7ICR A;  3RH4 A;  4OAI Z;  4KLG A;  2O1P A;  9ICG A;  3UQ0 A;  4RQ7 A;  4FHV A;  4QZE A;  5IIM A;  5CP2 A;  4MFF A;  3HWT A;  3RJG A;  8ICY A;  1UEU A;  4WC5 A;  4E7X A;  4KLI A;  2ZH1 A;  4F5Q A;  1TVA A;  8ICB A;  9ICF A;  2ZH3 A;  4UAZ A;  4FO1 A;  8ICU A;  3WFO A;  2PFP A;  3GDX A;  5J29 A;  5CB1 A;  4I2I A;  4XUS A;  4LEZ A;  3RJI A;  5DB6 A;  4JWN A;  7ICO A;  4EBJ A;  4NLN A;  3WFS C;  4WBZ A;  4N7R A;  4O5K A;  3RJJ A;  4KLE A;  4FH5 A;  4YMM A;  2DR9 A;  1ZQM A;  4NXX A;  5J0S A;  4M9H A;  8ICZ A;  2BPG A;  5J0Y A;  1ZQX A;  1FA0 A;  5D46 A;  5TZV A;  4EED A;  9ICH A;  4DOA A;  5BOL A;  4RQ5 A;  3AQM A;  3OUY B;  1ZQQ A;  5J0U A;  7ICT A;  4RT2 A;  3HX0 A;  4R65 A;  4WH5 A;  1MIY A;  1OU5 A;  3JPS A;  4IQV A;  4NXZ A;  5J0X A;  4UB3 A;  4KLO A;  2HHP A;  4E8F A;  1UET A;  3HJ4 A;  4UBC A;  3HIY A;  4RWQ A;  9ICI A;  4MFA A;  9ICR A;  4PH5 A;  5DBB A;  7ICV A;  4S3N A;  4YMN A;  2PXI A;  4P2H A;  4KLU A;  7ICH A;  4WCW A;  1ZQS A;  3OVA A;  1ZQW A;  9ICJ A;  3H39 A;  4K8V A;  3AU2 A;  4KLL A;  4NKT A;  4AT7 B;  3MGI A;  3WFQ E;  2ISP A;  9ICX A;  4XRH A;  1JQR A;  4DO9 A;  1KDH A;  4X4O A;  4RQ8 A;  1BPD A;  4RWP A;  2BE3 A;  4LZG A;  3RH5 A;  2ZH6 A;  1ZQA A;  4WOY A;  4RWN A;  5DBA A;  5J0R A;  4Z6E A;  2Q66 A;  5DEC A;  4QZI A;  4UAW A;  4LEV A;  4Z6C A;  2BCS A;  5CFT A;  4F5R A;  4QZ8 A;  5CHE A;  4QZH A;  4F5P A;  4PPX A;  8ICG A;  1ZQG A;  3JYY A;  5J2G A;  3V7K A;  2ZH9 A;  7ICE A;  3JPP A;  4MKP A;  1WOT A;  5D61 A;  9ICT A;  4PHD A;  2HN1 A;  3CK6 A;  9ICK A;  2PFQ A;  2FCL A;  4I2G A;  4NM2 A;  7ICN A;  5HRD A;  4WC4 A;  5J2H A;  2IHO A;  1TV9 A;  2FMQ A;  4LT6 A;  5J2D A;  3MDC A;  4MF2 A;  1NOM A;  1ZQL A;  2ISO A;  3NKU A;  4JLX A;  4M47 A;  4K96 A;  3EF2 A;  4I2B A;  2ZH5 A;  4O9M A;  2O5A A;  4E80 A;  1BPE A;  4XQ8 A;  5J2C A;  2VAN A;  4WBY A;  4KLS A;  2BCQ A;  3RH6 A;  4KLJ A;  4QZG A;  1ZQY A;  1MIV A;  3JPQ A;  4FHX A;  1JMS A;  8ICH A;  5HRH A;  3AQN A;  4UB5 A;  4UB2 A;  4I2D A;  3OV7 A;  4KLF A;  4F5O A;  4P4O A;  3ISD A;  4X4P A;  4ATB B;  2FMP A;  4NXU A;  1ZQN A;  4X4V A;  3UXO A;  4NXV A;  1ZQZ A;  5HRL A;  3H38 A;  5IIN A;  4M9L A;  4I2J A;  4I29 A;  7ICK A;  3JCF A;  3ERC C;  4UAY A;  8ICP A;  5DB8 A;  3TFS A;  4Z6D A;  4AT9 B;  4IG8 A;  3H3A A;  9ICS A;  9ICN A;  4X0B A;  4IQU A;  5BPC A;  8ICR A;  9ICQ A;  3OGU A;  3MBY A;  1HUO A;  4NLK A;  3ER8 C;  4O5C A;  8ICL A;  4UBB A;  4FHY A;  4FHP A;  4WQK A;  5CWR A;  7ICP A;  2DRB A;  2DRA A;  4RQ2 A;  2ZH8 A;  5JTG A;  1MQ2 A;  1ZQP A;  1XSN A;  5HRI A;  1YLQ A;  1TFW A;  4YMO A;  7ICI A;  4MFC A;  4R66 A;  1ZQD A;  4O69 A;  3MGH A;  2BBH A;  4K4I A;  3OWG A;  3ER9 B;  5IIK A;  4K98 A;  3C18 A;  3PHZ A;  1R89 A;  3UXP A;  3L9D A;  5D62 A;  1UEV A;  2ZHB A;  1ZQJ A;  4K9A A;  4UB4 A;  8ICS A;  7ICQ A;  2M2T A;  3JZ0 A;  3PNC A;  4O67 A;  3UQ2 A;  9ICC A;  4X4R A;  3NYB A;  4RWO A;  3WFR E;  3UXN A;  8ICC A;  4K99 A;  3JPT A;  4R64 A;  3TFR A;  4IQT A;  1JN3 A;  2BPC A;  1ZJN A;  4I2H A;  4OAF A;  3RJF A;  4WC6 A;  2M2W A;  4Z6F A;  4QZD A;  4I2E A;  4EGW A;  4M9N A;  4I2C A;  4KLQ A;  4KLD A;  4EBK A;  1V4A A;  1ZQO A;  4GXK A;  1HUZ A;  4NM1 A;  2B51 A;  8ICV A;  5CHG A;  1ZQV A;  4EP7 A;  4OAG A;  3RJH A;  4AT9 A;  5HRE A;  4PHE A;  1ZJM A;  3OVB A;  8ICN A;  4HX0 A;  2ZH4 A;  4M0A A;  4OAH A;  4EV6 A;  4RPZ A;  3UPS A;  4IQW A;  4LEY A;  2DR5 A;  3JPR A;  3NVO A;  4KM5 A;  3LQC B;  3ISC A;  5DB9 A;  9ICL A;  3LK9 A;  4LZD A;  3C5G A;  1MIW A;  4K97 A;  2ID1 A;  5J0O A;  4I2F A;  3OUY A;  4RT3 A;  3C2K A;  1RPL A;  4PHA A;  3V7L A;  5J0W A;  2HN2 A;  4AT7 A;  3RJK A;  1ZQU A;  4QZA A;  4RPY A;  5J0Q A;  3V72 A;  1BPX A;  4M5D A;  1VJ7 A;  1ZQE A;  5DBC A;  3NWI A;  8ICT A;  3AUO A;  8ICJ A;  4RQ0 A;  3PML A;  4F5N A;  1VFG A;  4RPX A;  4JLZ A;  5J0T A;  5HRG A;  5HRK A;  4KLM A;  5HR9 A;  9ICA A;  9ICM A;  4LVS A;  3JPO A;  4XJE A;  4RQ6 A;  2W9M A;  1ZQT A;  4X0A A;  1ZQR A;  7ICS A;  2ZH2 A;  5D49 A;  8ICM A;  4LEW A;  4YN4 A;  4M04 A;  5DB7 A;  4YCX A;  1PX5 A;  3C2M A;  5CJ7 A;  4PGY A;  5IIL A;  4X4N A;  2M2U A;  8ICE A;  3OVS A;  5B3Q A;  4P4P A;  4I2A A;  5CA7 A;  7ICF A;  8ICA A;  1ZQF A;  4PGX A;  2B56 A;  4XA5 A;  4QZC A;  5J2E A;  9ICE A;  4RQ4 A;  2EWR A;  4XQ7 A;  5CFS A;  4X5V A;  3C5F A;  5D63 A;  7ICU A;  2B4V A;  5D4B A;  5J2F A;  5III A;  2GA9 D;  4AT8 A;  2ZHA A;  1R8C A;  3AQL A;  5HHH A;  7ICM A;  3K75 D;  4UD5 A;  4FH3 A;  4X4T A;  5BOM A;  1F5A A;  2BPF A;  3RJE A;  8ICW A;  4O5E A;  4NXT A;  2PFO A;  3UPQ A;  4X4U A;  4WQL A;  8ICO A;  8ICK A;  3AQK A;  8ICQ A;  5DKW A;  1MQ3 A;  4RQ1 A;  4TUS A;  9ICB A;  2BCR A;  5CR0 A;  4TUR A;  1GPJ A;  5J2A A;  1TFY A;  4K9B A;  2GAF D;  5HHI A;  2BBJ A;  3C66 A;  4FHW A;  2BCU A;  1BPB A;  2IUB A;  5IIJ A;  5CFU A;  9ICV A;  2P66 A;  4M9G A;  9ICU A;  2RFF A;  4WC3 A;  4GXI A;  5EOZ A;  1NO5 A;  1ZQH A;  1Q79 A;  1RZT A;  4M9J A;  4TUQ A;  4WC7 A;  3C2L A;  4P4M A;  4PGQ A;  1ZQC A;  4NXW A;  3B0Y A;  1BPY A;  4I28 A;  4YD1 A;  4K4G A;  1KNY A;  3WFP A;  3HJ1 A;  4QZB A;  5J0P A;  1ZQI A;  4O68 A;  1R8B A;  5DED A;  3PMN A;  5J2I A;  2PFN A;  4I27 A;  2BCV A;  3ISB A;  4UD4 A;  2M2V A;  4QZ9 A;  4TUP A;  1KEJ A;  4EEB A;  5F2V O;  4KB6 A;  5B3P A;  2IHM A;  1JAJ A;  2GWS A;  4X4Q A;  5IIO A;  4DOB A;  4UB1 A;  8ICX A;  1XSL A;  4KLH A;  4X4S A;  4M2Y A;  5J2K A;  3V7J A; 
#chains in the Genus database with same CATH homology
 2FMS A;  4NKU A;  4MF8 A;  1Q78 A;  7ICG A;  1R8A A;  4R63 A;  2DR7 A;  4YD2 A;  5J2J A;  4WC0 A;  3JPN A;  2DR8 A;  3B0X A;  2DVI A;  8ICF A;  4WC1 A;  7ICL A;  3H37 A;  4JWM A;  5DDM A;  3AU6 A;  4DOC A;  1ZQK A;  4AT8 B;  7ICJ A;  2ZH7 A;  2NRK A;  4KLT A;  4RQ3 A;  4ATB A;  4FO6 A;  3MDA A;  9ICW A;  1BPZ A;  4NY8 A;  4WC2 A;  5DDY A;  4QZF A;  3HW8 A;  5J2B A;  2I9G A;  4K4H A;  5HRF A;  5HRB A;  1XSP A;  4NLZ A;  8ICI A;  2PBE A;  1ZQB A;  4GXJ A;  9ICO A;  5HC9 A;  4PHP A;  9ICP A;  7ICR A;  3RH4 A;  4KLG A;  2O1P A;  9ICG A;  3UQ0 A;  4RQ7 A;  4FHV A;  4QZE A;  5IIM A;  5CP2 A;  4MFF A;  3HWT A;  3RJG A;  8ICY A;  1UEU A;  4WC5 A;  4E7X A;  4KLI A;  2ZH1 A;  4F5Q A;  1TVA A;  8ICB A;  9ICF A;  2ZH3 A;  4UAZ A;  8ICU A;  3WFO A;  2PFP A;  3GDX A;  5J29 A;  5CB1 A;  4I2I A;  4XUS A;  3RJI A;  5DB6 A;  4JWN A;  7ICO A;  4EBJ A;  4NLN A;  3WFS C;  4WBZ A;  4O5K A;  3RJJ A;  4KLE A;  4FH5 A;  4YMM A;  2DR9 A;  1ZQM A;  5J0S A;  4M9H A;  8ICZ A;  2BPG A;  5J0Y A;  1ZQX A;  1FA0 A;  5D46 A;  5TZV A;  9ICH A;  4DOA A;  5BOL A;  4RQ5 A;  3AQM A;  3OUY B;  1ZQQ A;  5J0U A;  7ICT A;  4RT2 A;  3HX0 A;  4R65 A;  1MIY A;  1OU5 A;  3JPS A;  4IQV A;  4NXZ A;  5J0X A;  4UB3 A;  4KLO A;  2HHP A;  4E8F A;  1UET A;  3HJ4 A;  4UBC A;  3HIY A;  4RWQ A;  9ICI A;  4MFA A;  9ICR A;  4PH5 A;  5DBB A;  7ICV A;  4S3N A;  4YMN A;  2PXI A;  4P2H A;  4KLU A;  7ICH A;  4WCW A;  1ZQS A;  3OVA A;  1ZQW A;  9ICJ A;  3H39 A;  3AU2 A;  4KLL A;  4NKT A;  4AT7 B;  3MGI A;  3WFQ E;  2ISP A;  9ICX A;  4XRH A;  1JQR A;  4DO9 A;  1KDH A;  4X4O A;  4RQ8 A;  1BPD A;  4RWP A;  2BE3 A;  4LZG A;  3RH5 A;  2ZH6 A;  1ZQA A;  4RWN A;  5DBA A;  5J0R A;  4Z6E A;  2Q66 A;  5DEC A;  4QZI A;  4UAW A;  4Z6C A;  2BCS A;  4F5R A;  4QZ8 A;  4QZH A;  4F5P A;  4PPX A;  8ICG A;  1ZQG A;  3JYY A;  5J2G A;  3V7K A;  2ZH9 A;  7ICE A;  3JPP A;  1WOT A;  9ICT A;  4PHD A;  9ICK A;  2PFQ A;  4I2G A;  4NM2 A;  7ICN A;  5HRD A;  4WC4 A;  5J2H A;  1TV9 A;  2FMQ A;  4LT6 A;  5J2D A;  3MDC A;  4MF2 A;  1NOM A;  1ZQL A;  2ISO A;  4M47 A;  4I2B A;  2ZH5 A;  4O9M A;  2O5A A;  4E80 A;  1BPE A;  4XQ8 A;  5J2C A;  2VAN A;  4WBY A;  4KLS A;  2BCQ A;  3RH6 A;  4KLJ A;  4QZG A;  1ZQY A;  1MIV A;  3JPQ A;  4FHX A;  1JMS A;  8ICH A;  5HRH A;  3AQN A;  4UB5 A;  4UB2 A;  4I2D A;  3OV7 A;  4KLF A;  4F5O A;  4P4O A;  3ISD A;  4X4P A;  4ATB B;  2FMP A;  1ZQN A;  4X4V A;  3UXO A;  1ZQZ A;  5HRL A;  3H38 A;  5IIN A;  4M9L A;  4I2J A;  4I29 A;  7ICK A;  4UAY A;  8ICP A;  5DB8 A;  3TFS A;  4Z6D A;  4AT9 B;  4IG8 A;  3H3A A;  9ICS A;  9ICN A;  4X0B A;  4IQU A;  5BPC A;  8ICR A;  9ICQ A;  3OGU A;  3MBY A;  1HUO A;  4NLK A;  4O5C A;  8ICL A;  4UBB A;  4FHY A;  4FHP A;  5CWR A;  7ICP A;  2DRB A;  2DRA A;  4RQ2 A;  2ZH8 A;  1MQ2 A;  1ZQP A;  1XSN A;  5HRI A;  1YLQ A;  1TFW A;  4YMO A;  7ICI A;  4MFC A;  4R66 A;  1ZQD A;  3MGH A;  4K4I A;  5IIK A;  3C18 A;  1R89 A;  3UXP A;  3L9D A;  1UEV A;  2ZHB A;  1ZQJ A;  4UB4 A;  8ICS A;  7ICQ A;  2M2T A;  3JZ0 A;  3PNC A;  3UQ2 A;  9ICC A;  4X4R A;  3NYB A;  4RWO A;  3WFR E;  3UXN A;  8ICC A;  3JPT A;  4R64 A;  3TFR A;  4IQT A;  1JN3 A;  2BPC A;  1ZJN A;  4I2H A;  3RJF A;  4WC6 A;  2M2W A;  4Z6F A;  4QZD A;  4I2E A;  4M9N A;  4I2C A;  4KLQ A;  4KLD A;  4EBK A;  1V4A A;  1ZQO A;  4GXK A;  1HUZ A;  4NM1 A;  8ICV A;  5CHG A;  1ZQV A;  4EP7 A;  3RJH A;  4AT9 A;  5HRE A;  4PHE A;  1ZJM A;  3OVB A;  8ICN A;  2ZH4 A;  4M0A A;  4RPZ A;  3UPS A;  4IQW A;  2DR5 A;  3JPR A;  3LQC B;  3ISC A;  5DB9 A;  9ICL A;  3LK9 A;  4LZD A;  3C5G A;  1MIW A;  2ID1 A;  5J0O A;  4I2F A;  3OUY A;  4RT3 A;  3C2K A;  1RPL A;  4PHA A;  3V7L A;  5J0W A;  4AT7 A;  3RJK A;  1ZQU A;  4QZA A;  4RPY A;  5J0Q A;  3V72 A;  1BPX A;  4M5D A;  1VJ7 A;  1ZQE A;  5DBC A;  8ICT A;  3AUO A;  8ICJ A;  4RQ0 A;  3PML A;  4F5N A;  1VFG A;  4RPX A;  5J0T A;  5HRG A;  5HRK A;  4KLM A;  5HR9 A;  9ICA A;  9ICM A;  4LVS A;  3JPO A;  4RQ6 A;  2W9M A;  1ZQT A;  4X0A A;  1ZQR A;  7ICS A;  2ZH2 A;  5D49 A;  8ICM A;  4YN4 A;  4M04 A;  5DB7 A;  4YCX A;  1PX5 A;  3C2M A;  5CJ7 A;  4PGY A;  5IIL A;  4X4N A;  2M2U A;  8ICE A;  3OVS A;  4P4P A;  4I2A A;  5CA7 A;  7ICF A;  8ICA A;  1ZQF A;  4PGX A;  4XA5 A;  4QZC A;  5J2E A;  9ICE A;  4RQ4 A;  4XQ7 A;  4X5V A;  3C5F A;  7ICU A;  5D4B A;  5J2F A;  5III A;  4AT8 A;  2ZHA A;  1R8C A;  3AQL A;  5HHH A;  7ICM A;  3K75 D;  4UD5 A;  4FH3 A;  4X4T A;  5BOM A;  1F5A A;  2BPF A;  3RJE A;  8ICW A;  4O5E A;  2PFO A;  3UPQ A;  4X4U A;  8ICO A;  8ICK A;  3AQK A;  8ICQ A;  5DKW A;  1MQ3 A;  4RQ1 A;  4TUS A;  9ICB A;  2BCR A;  5CR0 A;  4TUR A;  5J2A A;  1TFY A;  3C66 A;  5HHI A;  4FHW A;  2BCU A;  1BPB A;  5IIJ A;  9ICV A;  2P66 A;  4M9G A;  9ICU A;  2RFF A;  4WC3 A;  4GXI A;  5EOZ A;  1NO5 A;  1ZQH A;  1Q79 A;  1RZT A;  4M9J A;  4TUQ A;  4WC7 A;  3C2L A;  4P4M A;  4PGQ A;  1ZQC A;  3B0Y A;  1BPY A;  4I28 A;  4YD1 A;  4K4G A;  1KNY A;  3WFP A;  3HJ1 A;  4QZB A;  5J0P A;  1ZQI A;  1R8B A;  5DED A;  3PMN A;  5J2I A;  2PFN A;  4I27 A;  2BCV A;  3ISB A;  4UD4 A;  2M2V A;  4QZ9 A;  4TUP A;  1KEJ A;  5F2V O;  2IHM A;  1JAJ A;  2GWS A;  4X4Q A;  5IIO A;  4DOB A;  4UB1 A;  8ICX A;  1XSL A;  4KLH A;  4X4S A;  4M2Y A;  5J2K A;  3V7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...