5HRHA

The crystal structure of asfvpolx(h115f/r127a mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
b'MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIAAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrhA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrhA01
4WC5A 1BPBA 3MDAA 4GXIA 3WFQE 4KLTA 4P4PA 4RT3A 8ICNA 4PHAA 4EP7A 3AQLA 1JQRA 9ICUA 4X4UA 3C5GA 4DOCA 2PFPA 4KLFA 5D4BA 1ZQJA 5IIKA 4IQVA 5DB8A 2O1PA 1ZQSA 9ICNA 5J0YA 9ICXA 2BCVA 7ICQA 5DDYA 3OUYB 4KLMA 4X4SA 4YD1A 4X4TA 4FHPA 2FMPA 3PMNA 2BPFA 4WC0A 3V7LA 3C5FA 7ICHA 4I29A 4NY8A 4FH5A 4IG8A 3OUYA 4YCXA 2BPGA 4RQ3A 4RQ7A 3MGHA 8ICOA 4E80A 4PGQA 1RZTA 3H37A 4UAYA 4PPXA 1MQ2A 4KLGA 3MDCA 4NM1A 5DBCA 5IIIA 5BOMA 3OV7A 4I2JA 4X4RA 8ICPA 5HREA 1R89A 1BPYA 4RPZA 2M2WA 8ICTA 3C2LA 7ICJA 4YN4A 4R63A 4F5QA 2VANA 1ZQNA 4MF8A 2ZH5A 4PHDA 4XQ8A 1VFGA 5HR9A 4EBKA 4PGYA 4DOAA 4M9NA 9ICMA 1ZQZA 2M2TA 4X4OA 1TFYA 3JPSA 3JPTA 1R8AA 4M5DA 1KEJA 3JPRA 1Q79A 4KLHA 4WC7A 2DR8A 1FA0A 4KLDA 9ICOA 3HX0A 5D46A 5IIOA 4X5VA 4PGXA 1ZQTA 5HRFA 2FMSA 4YMOA 2PFOA 2ISPA 4IQWA 2HHPA 8ICXA 3B0YA 4UB4A 4JWNA 5J2DA 4AT7B 4UB1A 9ICBA 1XSPA 2ZH2A 4O5EA 4F5RA 4RQ6A 5DBBA 3AQKA 4UB2A 4AT7A 3B0XA 9ICTA 3WFSC 2DRBA 3RH5A 4WC1A 2P66A 4K4HA 4F5NA 5DEDA 4NM2A 5J0QA 7ICRA 4PH5A 1RPLA 3TFRA 1ZQFA 4R64A 4AT8B 4QZIA 1BPDA 4Z6EA 8ICCA 4QZDA 8ICBA 1ZQRA 2DVIA 8ICWA 4M2YA 5J0UA 5CB1A 2I9GA 1BPZA 4X4VA 4XRHA 5DB6A 8ICQA 4WC6A 4TUQA 4E7XA 4FHXA 4QZHA 4WCWA 1NOMA 2PXIA 4LZGA 2DR7A 4UAZA 5HRLA 5HRIA 1F5AA 4QZ9A 4RQ2A 3JZ0A 3UQ2A 9ICQA 1ZQUA 4M47A 3NYBA 2IHMA 2FMQA 3AQNA 3V72A 2ZH6A 1MIVA 4I28A 5J2GA 3RJGA 4QZBA 5BOLA 5IILA 1TVAA 2ZH1A 4WBYA 3C2MA 4M04A 4FO6A 9ICPA 4K4IA 1WOTA 1ZQVA 5DB7A 8ICYA 4O9MA 1XSNA 4I2HA 1MIYA 4I2EA 4XQ7A 5F2VO 3WFPA 4QZCA 7ICFA 2BCQA 2PFNA 1PX5A 2BCSA 4WBZA 5BPCA 5CP2A 4YMNA 4AT9B 3ISDA 4LZDA 9ICAA 3C66A 4ATBB 4WC2A 4P2HA 4S3NA 2GWSA 2PFQA 1UETA 4JWMA 5HRBA 4ATBA 4I2IA 1ZJNA 1R8CA 2ZH4A 2M2UA 1ZQAA 4LVSA 4LT6A 4RWPA 5EOZA 7ICSA 2O5AA 3GDXA 2DR5A 4NLZA 5J2KA 5CJ7A 5CA7A 4UBBA 3JPNA 3MBYA 3HJ4A 3OGUA 5DBAA 4Z6FA 4MFFA 8ICZA 4UAWA 4M9HA 5CWRA 3HW8A 1VJ7A 3OVSA 4NKUA 9ICCA 9ICGA 2PBEA 4I2DA 1OU5A 5HHIA 3JPPA 1HUZA 1BPEA 4GXKA 2RFFA 5J2HA 2BCUA 3L9DA 3ISBA 3RJKA 4FHWA 5TZVA 3UXOA 4M9LA 1R8BA 4X4PA 3JPOA 4QZEA 5J2EA 2ZHAA 4I2BA 4RPXA 1HUOA 4RQ1A 8ICSA 5J2JA 3AU6A 5HHHA 4I2FA 9ICHA 4XA5A 3HIYA 4R66A 1TV9A 3RJFA 4O5CA 9ICEA 4MF2A 4I2AA 5J0SA 8ICFA 4QZFA 4KLEA 4KLJA 4UD4A 7ICGA 4PHPA 5IIMA 8ICRA 7ICLA 1KNYA 1XSLA 2ZH3A 7ICTA 5J0RA 4R65A 1ZQYA 9ICJA 7ICOA 3UQ0A 3AUOA 3UXPA 4AT8A 3V7KA 2DRAA 7ICUA 5DKWA 4XUSA 4I27A 4RWQA 1BPXA 4KLLA 1JMSA 4PHEA 4FHYA 8ICJA 4X0AA 1ZQMA 4Z6DA 7ICKA 1ZQWA 7ICNA 3PNCA 1ZQIA 1ZQOA 4NLKA 3RJJA 1KDHA 4RT2A 4M9JA 7ICEA 4FH3A 4NXZA 3RH4A 3PMLA 9ICRA 4YD2A 3JPQA 2DR9A 3UXNA 4TUSA 8ICEA 3TFSA 1JN3A 9ICKA 3WFOA 4RPYA 4P4OA 4RQ0A 4M0AA 4KLOA 3C2KA 4KLIA 5D49A 5J0WA 4I2GA 5HRDA 5HRKA 4TUPA 4TURA 1ZJMA 1MQ3A 5DECA 8ICVA 1ZQPA 1Q78A 3K75D 1ZQHA 3LK9A 5J0OA 9ICSA 1ZQQA 9ICVA 3JYYA 3RH6A 1V4AA 4WC4A 3C18A 4AT9A 4X4QA 4MFAA 4M9GA 4X4NA 2ID1A 4DO9A 1ZQXA 9ICWA 4UBCA 3RJIA 3AQMA 2Q66A 3V7JA 3UPQA 8ICKA 4RQ4A 4RWOA 2ZH9A 5J0TA 4P4MA 1UEUA 8ICHA 4O5KA 4RQ5A 4GXJA 5CHGA 4K4GA 5CR0A 4UB5A 3OVBA 2BE3A 4MFCA 2ZH7A 5DB9A 3H39A 4KLQA 3LQCB 4QZAA 4E8FA 5HRGA 4DOBA 1ZQEA 3AU2A 3HWTA 8ICLA 9ICLA 5J2IA 4FHVA 1JAJA 3OVAA 4RWNA 4WC3A 1ZQGA 1ZQCA 1UEVA 3ISCA 3RJHA 2M2VA 3UPSA 4KLSA 4RQ8A 7ICIA 1YLQA 5DDMA 2BPCA 5J29A 9ICIA 4QZ8A 2W9MA 7ICVA 8ICUA 5IINA 4Z6CA 5HRHA 3MGIA 4EBJA 2ZH8A 3WFRE 4NKTA 9ICFA 5IIJA 4UB3A 3HJ1A 8ICIA 1ZQLA 7ICPA 2ISOA 5J2AA 5J2BA 4KLUA 7ICMA 4IQUA 3H3AA 1MIWA 8ICAA 4QZGA 1TFWA 1ZQKA 2NRKA 4IQTA 4F5PA 1ZQBA 4I2CA 8ICGA 5J2FA 4F5OA 5J0PA 1ZQDA 5J2CA 4YMMA 8ICMA 4X0BA 2ZHBA 3RJEA 3H38A 4UD5A 5HC9A 5J0XA 4NLNA 1NO5A 2BCRA
chains in the Genus database with same CATH superfamily
4WC5A 1BPBA 4HX0A 3MDAA 4GXIA 3WFQE 4KLTA 4JLXA 4P4PA 4RT3A 3EF2A 8ICNA 4PHAA 4EP7A 3AQLA 1JQRA 9ICUA 4X4UA 3C5GA 4DOCA 2PFPA 4KLFA 5D4BA 4OAIZ 1ZQJA 5IIKA 4IQVA 5DB8A 2O1PA 1ZQSA 9ICNA 5J0YA 9ICXA 2BCVA 7ICQA 5DDYA 3OUYB 2BBJA 4KLMA 4X4SA 4YD1A 4X4TA 4FHPA 2FMPA 2HN1A 3PMNA 2BPFA 4WC0A 3V7LA 3C5FA 2IHOA 7ICHA 4I29A 4NY8A 4FH5A 4IG8A 3OUYA 4YCXA 2BPGA 4RQ3A 4RQ7A 3ER9B 3MGHA 8ICOA 4E80A 4PGQA 1RZTA 3H37A 4UAYA 4PPXA 1MQ2A 4KLGA 3MDCA 4NM1A 5DBCA 5IIIA 4NXVA 5BOMA 3OV7A 4LEWA 4I2JA 4X4RA 8ICPA 5HREA 1R89A 1BPYA 3ER8C 4RPZA 2M2WA 8ICTA 4LEVA 3C2LA 7ICJA 4YN4A 4R63A 4F5QA 2VANA 1ZQNA 4MF8A 2ZH5A 4PHDA 2B56A 4XQ8A 1VFGA 5HR9A 4EBKA 4PGYA 4DOAA 4M9NA 9ICMA 1ZQZA 2M2TA 4X4OA 3NKUA 1TFYA 3JPSA 3JPTA 1R8AA 4M5DA 1KEJA 3JPRA 1Q79A 4KLHA 4WC7A 4K98A 1FA0A 4KLDA 2DR8A 9ICOA 5CHEA 3HX0A 5D46A 5IIOA 4X5VA 4EV6A 4NXXA 4PGXA 1ZQTA 5HRFA 2FMSA 4YMOA 2PFOA 2ISPA 4IQWA 2HHPA 8ICXA 4K96A 3B0YA 4UB4A 4JWNA 5J2DA 4AT7B 4UB1A 9ICBA 1XSPA 2ZH2A 4O5EA 4F5RA 4RQ6A 5DBBA 3AQKA 4UB2A 4AT7A 3B0XA 9ICTA 3WFSC 2DRBA 3RH5A 4WC1A 2P66A 4K4HA 4F5NA 5DEDA 4NM2A 5J0QA 7ICRA 4PH5A 4WQKA 1RPLA 3TFRA 5CFSA 1ZQFA 4R64A 4K9AA 4WH5A 4MKPA 4AT8B 4QZIA 1BPDA 4Z6EA 8ICCA 4QZDA 8ICBA 1ZQRA 4EEBA 2DVIA 8ICWA 4M2YA 5J0UA 5CB1A 2I9GA 1BPZA 4X4VA 4OAGA 4XRHA 5DB6A 8ICQA 4WC6A 4TUQA 4E7XA 4FHXA 4QZHA 4WCWA 1NOMA 2PXIA 4LZGA 2DR7A 4UAZA 5HRLA 1GPJA 5HRIA 1F5AA 5CFUA 4QZ9A 4RQ2A 3JZ0A 3UQ2A 9ICQA 1ZQUA 4M47A 3NYBA 2IHMA 2FMQA 3AQNA 3V72A 2ZH6A 1MIVA 4K8VA 4I28A 5J2GA 3RJGA 3MCRA 4QZBA 5BOLA 5IILA 1TVAA 2ZH1A 4WBYA 3C2MA 4M04A 4FO6A 9ICPA 4K4IA 1WOTA 5JTGA 4OAHA 1ZQVA 5DB7A 8ICYA 4O9MA 3NVOA 1XSNA 4I2HA 1MIYA 4I2EA 4XQ7A 5F2VO 3WFPA 4QZCA 7ICFA 2BCQA 2PFNA 1PX5A 4K9BA 2BCSA 4WBZA 5BPCA 5CP2A 4YMNA 4AT9B 3ISDA 4LZDA 9ICAA 3C66A 4ATBB 4WC2A 2EWRA 4P2HA 4S3NA 2GWSA 2PFQA 2FCLA 1UETA 3K7DA 4N7RA 4JWMA 5HRBA 4ATBA 4I2IA 1ZJNA 4NXUA 1R8CA 2ZH4A 2M2UA 1ZQAA 4LVSA 4LT6A 4RWPA 5EOZA 7ICSA 2BBHA 3GDXA 2O5AA 2DR5A 4NLZA 5J2KA 5CJ7A 5CA7A 4UBBA 3JPNA 3MBYA 3HJ4A 3OGUA 4XJEA 5DBAA 4Z6FA 4MFFA 8ICZA 4UAWA 4M9HA 2GA9D 5CWRA 3HW8A 1VJ7A 3OVSA 4NKUA 9ICCA 9ICGA 2PBEA 3JCFA 5B3PA 4I2DA 1OU5A 5HHIA 3JPPA 1HUZA 1BPEA 4GXKA 2RFFA 5J2HA 2BCUA 3L9DA 3ISBA 3RJKA 4FHWA 5TZVA 3UXOA 4M9LA 1R8BA 4X4PA 3JPOA 4LEYA 4QZEA 5J2EA 2ZHAA 4I2BA 4RPXA 3ERCC 1HUOA 4RQ1A 8ICSA 5J2JA 3AU6A 5HHHA 4I2FA 9ICHA 2GAFD 4XA5A 3HIYA 4R66A 1TV9A 3RJFA 4O5CA 9ICEA 4MF2A 4I2AA 5J0SA 8ICFA 4QZFA 4KLEA 4KLJA 4UD4A 7ICGA 4PHPA 5IIMA 8ICRA 7ICLA 1KNYA 1XSLA 2ZH3A 7ICTA 5J0RA 4R65A 1ZQYA 9ICJA 4JLZA 7ICOA 3UQ0A 3AUOA 3UXPA 4AT8A 3V7KA 2DRAA 7ICUA 5DKWA 2B4VA 4XUSA 4I27A 4RWQA 1BPXA 4KLLA 1JMSA 4PHEA 4FHYA 8ICJA 4X0AA 1ZQMA 4K97A 4Z6DA 7ICKA 1ZQWA 7ICNA 3PNCA 1ZQIA 1ZQOA 4NLKA 3RJJA 1KDHA 4RT2A 3NWIA 4M9JA 7ICEA 4FH3A 4OAFA 4NXZA 3RH4A 3PMLA 9ICRA 4YD2A 3JPQA 2DR9A 3UXNA 4TUSA 8ICEA 3TFSA 1JN3A 9ICKA 5CFTA 3WFOA 4RPYA 4P4OA 4RQ0A 4FO1A 4M0AA 4KLOA 3C2KA 4KLIA 5D49A 5J0WA 4I2GA 5HRDA 5HRKA 4TUPA 4TURA 1ZJMA 1MQ3A 5DECA 8ICVA 1ZQPA 1Q78A 3K75D 3OWGA 1ZQHA 3LK9A 5J0OA 9ICSA 4EEDA 1ZQQA 9ICVA 4O69A 3JYYA 3RH6A 1V4AA 4WC4A 3C18A 4AT9A 4X4QA 4MFAA 4M9GA 4LEZA 4X4NA 2ID1A 4DO9A 1ZQXA 9ICWA 4UBCA 3RJIA 3AQMA 2Q66A 3V7JA 3UPQA 8ICKA 4RQ4A 4O67A 4O6AA 4RWOA 2ZH9A 5J0TA 4P4MA 1UEUA 4O68A 8ICHA 4O5KA 4RQ5A 2HN2A 4GXJA 5CHGA 4K4GA 4NXWA 5CR0A 4UB5A 3OVBA 2BE3A 4MFCA 2ZH7A 5DB9A 2B51A 3H39A 4KLQA 3LQCB 4QZAA 4E8FA 5HRGA 4DOBA 1ZQEA 3AU2A 3HWTA 8ICLA 9ICLA 5J2IA 4FHVA 1JAJA 3OVAA 4RWNA 4WC3A 1ZQGA 1ZQCA 1UEVA 3ISCA 3RJHA 2M2VA 2IUBA 3UPSA 4KLSA 4RQ8A 7ICIA 1YLQA 5DDMA 2BPCA 3PHZA 5J29A 9ICIA 4QZ8A 2W9MA 7ICVA 8ICUA 5IINA 4NXTA 4Z6CA 5HRHA 3MGIA 4EBJA 2ZH8A 4EGWA 3WFRE 4NKTA 4K99A 9ICFA 5IIJA 5D62A 4UB3A 3HJ1A 8ICIA 1ZQLA 3CK6A 7ICPA 4WQLA 2ISOA 5J2AA 5J2BA 4KLUA 7ICMA 4IQUA 3H3AA 1MIWA 8ICAA 4QZGA 1TFWA 1ZQKA 4KB6A 2NRKA 4IQTA 4F5PA 5B3QA 4WOYA 1ZQBA 5D61A 4I2CA 8ICGA 5J2FA 4F5OA 5J0PA 1ZQDA 5J2CA 4YMMA 8ICMA 4KM5A 4X0BA 2ZHBA 3RJEA 4I0UA 3H38A 4UD5A 5HC9A 5J0XA 5D63A 4NLNA 1NO5A 2BCRA
chains in the Genus database with same CATH topology
4WC5A 1BPBA 3MDAA 4GXIA 3WFQE 4KLTA 4P4PA 4RT3A 8ICNA 4PHAA 4EP7A 3AQLA 1JQRA 9ICUA 4X4UA 3C5GA 4DOCA 2PFPA 4KLFA 5D4BA 1ZQJA 5IIKA 4IQVA 5DB8A 2O1PA 1ZQSA 9ICNA 5J0YA 9ICXA 2BCVA 7ICQA 5DDYA 3OUYB 4KLMA 4X4SA 4YD1A 4X4TA 4FHPA 2FMPA 3PMNA 2BPFA 4WC0A 3V7LA 3C5FA 7ICHA 4I29A 4NY8A 4FH5A 4IG8A 3OUYA 4YCXA 2BPGA 4RQ3A 4RQ7A 3MGHA 8ICOA 4E80A 4PGQA 1RZTA 3H37A 4UAYA 4PPXA 1MQ2A 4KLGA 3MDCA 4NM1A 5DBCA 5IIIA 5BOMA 3OV7A 4I2JA 4X4RA 8ICPA 5HREA 1R89A 1BPYA 4RPZA 2M2WA 8ICTA 3C2LA 7ICJA 4YN4A 4R63A 4F5QA 2VANA 1ZQNA 4MF8A 2ZH5A 4PHDA 4XQ8A 1VFGA 5HR9A 4EBKA 4PGYA 4DOAA 4M9NA 9ICMA 1ZQZA 2M2TA 4X4OA 1TFYA 3JPSA 3JPTA 1R8AA 4M5DA 1KEJA 3JPRA 1Q79A 4KLHA 4WC7A 2DR8A 1FA0A 4KLDA 9ICOA 3HX0A 5D46A 5IIOA 4X5VA 4PGXA 1ZQTA 5HRFA 2FMSA 4YMOA 2PFOA 2ISPA 4IQWA 2HHPA 8ICXA 3B0YA 4UB4A 4JWNA 5J2DA 4AT7B 4UB1A 9ICBA 1XSPA 2ZH2A 4O5EA 4F5RA 4RQ6A 5DBBA 3AQKA 4UB2A 4AT7A 3B0XA 9ICTA 3WFSC 2DRBA 3RH5A 4WC1A 2P66A 4K4HA 4F5NA 5DEDA 4NM2A 5J0QA 7ICRA 4PH5A 1RPLA 3TFRA 1ZQFA 4R64A 4AT8B 4QZIA 1BPDA 4Z6EA 8ICCA 4QZDA 8ICBA 1ZQRA 2DVIA 8ICWA 4M2YA 5J0UA 5CB1A 2I9GA 1BPZA 4X4VA 4XRHA 5DB6A 8ICQA 4WC6A 4TUQA 4E7XA 4FHXA 4QZHA 4WCWA 1NOMA 2PXIA 4LZGA 2DR7A 4UAZA 5HRLA 5HRIA 1F5AA 4QZ9A 4RQ2A 3JZ0A 3UQ2A 9ICQA 1ZQUA 4M47A 3NYBA 2IHMA 2FMQA 3AQNA 3V72A 2ZH6A 1MIVA 4I28A 5J2GA 3RJGA 4QZBA 5BOLA 5IILA 1TVAA 2ZH1A 4WBYA 3C2MA 4M04A 4FO6A 9ICPA 4K4IA 1WOTA 1ZQVA 5DB7A 8ICYA 4O9MA 1XSNA 4I2HA 1MIYA 4I2EA 4XQ7A 5F2VO 3WFPA 4QZCA 7ICFA 2BCQA 2PFNA 1PX5A 2BCSA 4WBZA 5BPCA 5CP2A 4YMNA 4AT9B 3ISDA 4LZDA 9ICAA 3C66A 4ATBB 4WC2A 4P2HA 4S3NA 2GWSA 2PFQA 1UETA 4JWMA 5HRBA 4ATBA 4I2IA 1ZJNA 1R8CA 2ZH4A 2M2UA 1ZQAA 4LVSA 4LT6A 4RWPA 5EOZA 7ICSA 2O5AA 3GDXA 2DR5A 4NLZA 5J2KA 5CJ7A 5CA7A 4UBBA 3JPNA 3MBYA 3HJ4A 3OGUA 5DBAA 4Z6FA 4MFFA 8ICZA 4UAWA 4M9HA 5CWRA 3HW8A 1VJ7A 3OVSA 4NKUA 9ICCA 9ICGA 2PBEA 4I2DA 1OU5A 5HHIA 3JPPA 1HUZA 1BPEA 4GXKA 2RFFA 5J2HA 2BCUA 3L9DA 3ISBA 3RJKA 4FHWA 5TZVA 3UXOA 4M9LA 1R8BA 4X4PA 3JPOA 4QZEA 5J2EA 2ZHAA 4I2BA 4RPXA 1HUOA 4RQ1A 8ICSA 5J2JA 3AU6A 5HHHA 4I2FA 9ICHA 4XA5A 3HIYA 4R66A 1TV9A 3RJFA 4O5CA 9ICEA 4MF2A 4I2AA 5J0SA 8ICFA 4QZFA 4KLEA 4KLJA 4UD4A 7ICGA 4PHPA 5IIMA 8ICRA 7ICLA 1KNYA 1XSLA 2ZH3A 7ICTA 5J0RA 4R65A 1ZQYA 9ICJA 7ICOA 3UQ0A 3AUOA 3UXPA 4AT8A 3V7KA 2DRAA 7ICUA 5DKWA 4XUSA 4I27A 4RWQA 1BPXA 4KLLA 1JMSA 4PHEA 4FHYA 8ICJA 4X0AA 1ZQMA 4Z6DA 7ICKA 1ZQWA 7ICNA 3PNCA 1ZQIA 1ZQOA 4NLKA 3RJJA 1KDHA 4RT2A 4M9JA 7ICEA 4FH3A 4NXZA 3RH4A 3PMLA 9ICRA 4YD2A 3JPQA 2DR9A 3UXNA 4TUSA 8ICEA 3TFSA 1JN3A 9ICKA 3WFOA 4RPYA 4P4OA 4RQ0A 4M0AA 4KLOA 3C2KA 4KLIA 5D49A 5J0WA 4I2GA 5HRDA 5HRKA 4TUPA 4TURA 1ZJMA 1MQ3A 5DECA 8ICVA 1ZQPA 1Q78A 3K75D 1ZQHA 3LK9A 5J0OA 9ICSA 1ZQQA 9ICVA 3JYYA 3RH6A 1V4AA 4WC4A 3C18A 4AT9A 4X4QA 4MFAA 4M9GA 4X4NA 2ID1A 4DO9A 1ZQXA 9ICWA 4UBCA 3RJIA 3AQMA 2Q66A 3V7JA 3UPQA 8ICKA 4RQ4A 4RWOA 2ZH9A 5J0TA 4P4MA 1UEUA 8ICHA 4O5KA 4RQ5A 4GXJA 5CHGA 4K4GA 5CR0A 4UB5A 3OVBA 2BE3A 4MFCA 2ZH7A 5DB9A 3H39A 4KLQA 3LQCB 4QZAA 4E8FA 5HRGA 4DOBA 1ZQEA 3AU2A 3HWTA 8ICLA 9ICLA 5J2IA 4FHVA 1JAJA 3OVAA 4RWNA 4WC3A 1ZQGA 1ZQCA 1UEVA 3ISCA 3RJHA 2M2VA 3UPSA 4KLSA 4RQ8A 7ICIA 1YLQA 5DDMA 2BPCA 5J29A 9ICIA 4QZ8A 2W9MA 7ICVA 8ICUA 5IINA 4Z6CA 5HRHA 3MGIA 4EBJA 2ZH8A 3WFRE 4NKTA 9ICFA 5IIJA 4UB3A 3HJ1A 8ICIA 1ZQLA 7ICPA 2ISOA 5J2AA 5J2BA 4KLUA 7ICMA 4IQUA 3H3AA 1MIWA 8ICAA 4QZGA 1TFWA 1ZQKA 2NRKA 4IQTA 4F5PA 1ZQBA 4I2CA 8ICGA 5J2FA 4F5OA 5J0PA 1ZQDA 5J2CA 4YMMA 8ICMA 4X0BA 2ZHBA 3RJEA 3H38A 4UD5A 5HC9A 5J0XA 4NLNA 1NO5A 2BCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC5 A;  1BPB A;  3MDA A;  4GXI A;  3WFQ E;  4KLT A;  4P4P A;  4RT3 A;  8ICN A;  4PHA A;  4EP7 A;  3AQL A;  1JQR A;  9ICU A;  4X4U A;  3C5G A;  4DOC A;  2PFP A;  4KLF A;  5D4B A;  1ZQJ A;  5IIK A;  4IQV A;  5DB8 A;  2O1P A;  1ZQS A;  9ICN A;  5J0Y A;  9ICX A;  2BCV A;  7ICQ A;  5DDY A;  3OUY B;  4KLM A;  4X4S A;  4YD1 A;  4X4T A;  4FHP A;  2FMP A;  3PMN A;  2BPF A;  4WC0 A;  3V7L A;  3C5F A;  7ICH A;  4I29 A;  4NY8 A;  4FH5 A;  4IG8 A;  3OUY A;  4YCX A;  2BPG A;  4RQ3 A;  4RQ7 A;  3MGH A;  8ICO A;  4E80 A;  4PGQ A;  1RZT A;  3H37 A;  4UAY A;  4PPX A;  1MQ2 A;  4KLG A;  3MDC A;  4NM1 A;  5DBC A;  5III A;  5BOM A;  3OV7 A;  4I2J A;  4X4R A;  8ICP A;  5HRE A;  1R89 A;  1BPY A;  4RPZ A;  2M2W A;  8ICT A;  3C2L A;  7ICJ A;  4YN4 A;  4R63 A;  4F5Q A;  2VAN A;  1ZQN A;  4MF8 A;  2ZH5 A;  4PHD A;  4XQ8 A;  1VFG A;  5HR9 A;  4EBK A;  4PGY A;  4DOA A;  4M9N A;  9ICM A;  1ZQZ A;  2M2T A;  4X4O A;  1TFY A;  3JPS A;  3JPT A;  1R8A A;  4M5D A;  1KEJ A;  3JPR A;  1Q79 A;  4KLH A;  4WC7 A;  2DR8 A;  1FA0 A;  4KLD A;  9ICO A;  3HX0 A;  5D46 A;  5IIO A;  4X5V A;  4PGX A;  1ZQT A;  5HRF A;  2FMS A;  4YMO A;  2PFO A;  2ISP A;  4IQW A;  2HHP A;  8ICX A;  3B0Y A;  4UB4 A;  4JWN A;  5J2D A;  4AT7 B;  4UB1 A;  9ICB A;  1XSP A;  2ZH2 A;  4O5E A;  4F5R A;  4RQ6 A;  5DBB A;  3AQK A;  4UB2 A;  4AT7 A;  3B0X A;  9ICT A;  3WFS C;  2DRB A;  3RH5 A;  4WC1 A;  2P66 A;  4K4H A;  4F5N A;  5DED A;  4NM2 A;  5J0Q A;  7ICR A;  4PH5 A;  1RPL A;  3TFR A;  1ZQF A;  4R64 A;  4AT8 B;  4QZI A;  1BPD A;  4Z6E A;  8ICC A;  4QZD A;  8ICB A;  1ZQR A;  2DVI A;  8ICW A;  4M2Y A;  5J0U A;  5CB1 A;  2I9G A;  1BPZ A;  4X4V A;  4XRH A;  5DB6 A;  8ICQ A;  4WC6 A;  4TUQ A;  4E7X A;  4FHX A;  4QZH A;  4WCW A;  1NOM A;  2PXI A;  4LZG A;  2DR7 A;  4UAZ A;  5HRL A;  5HRI A;  1F5A A;  4QZ9 A;  4RQ2 A;  3JZ0 A;  3UQ2 A;  9ICQ A;  1ZQU A;  4M47 A;  3NYB A;  2IHM A;  2FMQ A;  3AQN A;  3V72 A;  2ZH6 A;  1MIV A;  4I28 A;  5J2G A;  3RJG A;  4QZB A;  5BOL A;  5IIL A;  1TVA A;  2ZH1 A;  4WBY A;  3C2M A;  4M04 A;  4FO6 A;  9ICP A;  4K4I A;  1WOT A;  1ZQV A;  5DB7 A;  8ICY A;  4O9M A;  1XSN A;  4I2H A;  1MIY A;  4I2E A;  4XQ7 A;  5F2V O;  3WFP A;  4QZC A;  7ICF A;  2BCQ A;  2PFN A;  1PX5 A;  2BCS A;  4WBZ A;  5BPC A;  5CP2 A;  4YMN A;  4AT9 B;  3ISD A;  4LZD A;  9ICA A;  3C66 A;  4ATB B;  4WC2 A;  4P2H A;  4S3N A;  2GWS A;  2PFQ A;  1UET A;  4JWM A;  5HRB A;  4ATB A;  4I2I A;  1ZJN A;  1R8C A;  2ZH4 A;  2M2U A;  1ZQA A;  4LVS A;  4LT6 A;  4RWP A;  5EOZ A;  7ICS A;  2O5A A;  3GDX A;  2DR5 A;  4NLZ A;  5J2K A;  5CJ7 A;  5CA7 A;  4UBB A;  3JPN A;  3MBY A;  3HJ4 A;  3OGU A;  5DBA A;  4Z6F A;  4MFF A;  8ICZ A;  4UAW A;  4M9H A;  5CWR A;  3HW8 A;  1VJ7 A;  3OVS A;  4NKU A;  9ICC A;  9ICG A;  2PBE A;  4I2D A;  1OU5 A;  5HHI A;  3JPP A;  1HUZ A;  1BPE A;  4GXK A;  2RFF A;  5J2H A;  2BCU A;  3L9D A;  3ISB A;  3RJK A;  4FHW A;  5TZV A;  3UXO A;  4M9L A;  1R8B A;  4X4P A;  3JPO A;  4QZE A;  5J2E A;  2ZHA A;  4I2B A;  4RPX A;  1HUO A;  4RQ1 A;  8ICS A;  5J2J A;  3AU6 A;  5HHH A;  4I2F A;  9ICH A;  4XA5 A;  3HIY A;  4R66 A;  1TV9 A;  3RJF A;  4O5C A;  9ICE A;  4MF2 A;  4I2A A;  5J0S A;  8ICF A;  4QZF A;  4KLE A;  4KLJ A;  4UD4 A;  7ICG A;  4PHP A;  5IIM A;  8ICR A;  7ICL A;  1KNY A;  1XSL A;  2ZH3 A;  7ICT A;  5J0R A;  4R65 A;  1ZQY A;  9ICJ A;  7ICO A;  3UQ0 A;  3AUO A;  3UXP A;  4AT8 A;  3V7K A;  2DRA A;  7ICU A;  5DKW A;  4XUS A;  4I27 A;  4RWQ A;  1BPX A;  4KLL A;  1JMS A;  4PHE A;  4FHY A;  8ICJ A;  4X0A A;  1ZQM A;  4Z6D A;  7ICK A;  1ZQW A;  7ICN A;  3PNC A;  1ZQI A;  1ZQO A;  4NLK A;  3RJJ A;  1KDH A;  4RT2 A;  4M9J A;  7ICE A;  4FH3 A;  4NXZ A;  3RH4 A;  3PML A;  9ICR A;  4YD2 A;  3JPQ A;  2DR9 A;  3UXN A;  4TUS A;  8ICE A;  3TFS A;  1JN3 A;  9ICK A;  3WFO A;  4RPY A;  4P4O A;  4RQ0 A;  4M0A A;  4KLO A;  3C2K A;  4KLI A;  5D49 A;  5J0W A;  4I2G A;  5HRD A;  5HRK A;  4TUP A;  4TUR A;  1ZJM A;  1MQ3 A;  5DEC A;  8ICV A;  1ZQP A;  1Q78 A;  3K75 D;  1ZQH A;  3LK9 A;  5J0O A;  9ICS A;  1ZQQ A;  9ICV A;  3JYY A;  3RH6 A;  1V4A A;  4WC4 A;  3C18 A;  4AT9 A;  4X4Q A;  4MFA A;  4M9G A;  4X4N A;  2ID1 A;  4DO9 A;  1ZQX A;  9ICW A;  4UBC A;  3RJI A;  3AQM A;  2Q66 A;  3V7J A;  3UPQ A;  8ICK A;  4RQ4 A;  4RWO A;  2ZH9 A;  5J0T A;  4P4M A;  1UEU A;  8ICH A;  4O5K A;  4RQ5 A;  4GXJ A;  5CHG A;  4K4G A;  5CR0 A;  4UB5 A;  3OVB A;  2BE3 A;  4MFC A;  2ZH7 A;  5DB9 A;  3H39 A;  4KLQ A;  3LQC B;  4QZA A;  4E8F A;  5HRG A;  4DOB A;  1ZQE A;  3AU2 A;  3HWT A;  8ICL A;  9ICL A;  5J2I A;  4FHV A;  1JAJ A;  3OVA A;  4RWN A;  4WC3 A;  1ZQG A;  1ZQC A;  1UEV A;  3ISC A;  3RJH A;  2M2V A;  3UPS A;  4KLS A;  4RQ8 A;  7ICI A;  1YLQ A;  5DDM A;  2BPC A;  5J29 A;  9ICI A;  4QZ8 A;  2W9M A;  7ICV A;  8ICU A;  5IIN A;  4Z6C A;  5HRH A;  3MGI A;  4EBJ A;  2ZH8 A;  3WFR E;  4NKT A;  9ICF A;  5IIJ A;  4UB3 A;  3HJ1 A;  8ICI A;  1ZQL A;  7ICP A;  2ISO A;  5J2A A;  5J2B A;  4KLU A;  7ICM A;  4IQU A;  3H3A A;  1MIW A;  8ICA A;  4QZG A;  1TFW A;  1ZQK A;  2NRK A;  4IQT A;  4F5P A;  1ZQB A;  4I2C A;  8ICG A;  5J2F A;  4F5O A;  5J0P A;  1ZQD A;  5J2C A;  4YMM A;  8ICM A;  4X0B A;  2ZHB A;  3RJE A;  3H38 A;  4UD5 A;  5HC9 A;  5J0X A;  4NLN A;  1NO5 A;  2BCR A; 
#chains in the Genus database with same CATH topology
 4WC5 A;  1BPB A;  4HX0 A;  3MDA A;  4GXI A;  3WFQ E;  4KLT A;  4JLX A;  4P4P A;  4RT3 A;  3EF2 A;  8ICN A;  4PHA A;  4EP7 A;  3AQL A;  1JQR A;  9ICU A;  4X4U A;  3C5G A;  4DOC A;  2PFP A;  4KLF A;  5D4B A;  4OAI Z;  1ZQJ A;  5IIK A;  4IQV A;  5DB8 A;  2O1P A;  1ZQS A;  9ICN A;  5J0Y A;  9ICX A;  2BCV A;  7ICQ A;  5DDY A;  3OUY B;  2BBJ A;  4KLM A;  4X4S A;  4YD1 A;  4X4T A;  4FHP A;  2FMP A;  2HN1 A;  3PMN A;  2BPF A;  4WC0 A;  3V7L A;  3C5F A;  2IHO A;  7ICH A;  4I29 A;  4NY8 A;  4FH5 A;  4IG8 A;  3OUY A;  4YCX A;  2BPG A;  4RQ3 A;  4RQ7 A;  3ER9 B;  3MGH A;  8ICO A;  4E80 A;  4PGQ A;  1RZT A;  3H37 A;  4UAY A;  4PPX A;  1MQ2 A;  4KLG A;  3MDC A;  4NM1 A;  5DBC A;  5III A;  4NXV A;  5BOM A;  3OV7 A;  4LEW A;  4I2J A;  4X4R A;  8ICP A;  5HRE A;  1R89 A;  1BPY A;  3ER8 C;  4RPZ A;  2M2W A;  8ICT A;  4LEV A;  3C2L A;  7ICJ A;  4YN4 A;  4R63 A;  4F5Q A;  2VAN A;  1ZQN A;  4MF8 A;  2ZH5 A;  4PHD A;  2B56 A;  4XQ8 A;  1VFG A;  5HR9 A;  4EBK A;  4PGY A;  4DOA A;  4M9N A;  9ICM A;  1ZQZ A;  2M2T A;  4X4O A;  3NKU A;  1TFY A;  3JPS A;  3JPT A;  1R8A A;  4M5D A;  1KEJ A;  3JPR A;  1Q79 A;  4KLH A;  4WC7 A;  4K98 A;  1FA0 A;  4KLD A;  2DR8 A;  9ICO A;  5CHE A;  3HX0 A;  5D46 A;  5IIO A;  4X5V A;  4EV6 A;  4NXX A;  4PGX A;  1ZQT A;  5HRF A;  2FMS A;  4YMO A;  2PFO A;  2ISP A;  4IQW A;  2HHP A;  8ICX A;  4K96 A;  3B0Y A;  4UB4 A;  4JWN A;  5J2D A;  4AT7 B;  4UB1 A;  9ICB A;  1XSP A;  2ZH2 A;  4O5E A;  4F5R A;  4RQ6 A;  5DBB A;  3AQK A;  4UB2 A;  4AT7 A;  3B0X A;  9ICT A;  3WFS C;  2DRB A;  3RH5 A;  4WC1 A;  2P66 A;  4K4H A;  4F5N A;  5DED A;  4NM2 A;  5J0Q A;  7ICR A;  4PH5 A;  4WQK A;  1RPL A;  3TFR A;  5CFS A;  1ZQF A;  4R64 A;  4K9A A;  4WH5 A;  4MKP A;  4AT8 B;  4QZI A;  1BPD A;  4Z6E A;  8ICC A;  4QZD A;  8ICB A;  1ZQR A;  4EEB A;  2DVI A;  8ICW A;  4M2Y A;  5J0U A;  5CB1 A;  2I9G A;  1BPZ A;  4X4V A;  4OAG A;  4XRH A;  5DB6 A;  8ICQ A;  4WC6 A;  4TUQ A;  4E7X A;  4FHX A;  4QZH A;  4WCW A;  1NOM A;  2PXI A;  4LZG A;  2DR7 A;  4UAZ A;  5HRL A;  1GPJ A;  5HRI A;  1F5A A;  5CFU A;  4QZ9 A;  4RQ2 A;  3JZ0 A;  3UQ2 A;  9ICQ A;  1ZQU A;  4M47 A;  3NYB A;  2IHM A;  2FMQ A;  3AQN A;  3V72 A;  2ZH6 A;  1MIV A;  4K8V A;  4I28 A;  5J2G A;  3RJG A;  3MCR A;  4QZB A;  5BOL A;  5IIL A;  1TVA A;  2ZH1 A;  4WBY A;  3C2M A;  4M04 A;  4FO6 A;  9ICP A;  4K4I A;  1WOT A;  5JTG A;  4OAH A;  1ZQV A;  5DB7 A;  8ICY A;  4O9M A;  3NVO A;  1XSN A;  4I2H A;  1MIY A;  4I2E A;  4XQ7 A;  5F2V O;  3WFP A;  4QZC A;  7ICF A;  2BCQ A;  2PFN A;  1PX5 A;  4K9B A;  2BCS A;  4WBZ A;  5BPC A;  5CP2 A;  4YMN A;  4AT9 B;  3ISD A;  4LZD A;  9ICA A;  3C66 A;  4ATB B;  4WC2 A;  2EWR A;  4P2H A;  4S3N A;  2GWS A;  2PFQ A;  2FCL A;  1UET A;  3K7D A;  4N7R A;  4JWM A;  5HRB A;  4ATB A;  4I2I A;  1ZJN A;  4NXU A;  1R8C A;  2ZH4 A;  2M2U A;  1ZQA A;  4LVS A;  4LT6 A;  4RWP A;  5EOZ A;  7ICS A;  2BBH A;  3GDX A;  2O5A A;  2DR5 A;  4NLZ A;  5J2K A;  5CJ7 A;  5CA7 A;  4UBB A;  3JPN A;  3MBY A;  3HJ4 A;  3OGU A;  4XJE A;  5DBA A;  4Z6F A;  4MFF A;  8ICZ A;  4UAW A;  4M9H A;  2GA9 D;  5CWR A;  3HW8 A;  1VJ7 A;  3OVS A;  4NKU A;  9ICC A;  9ICG A;  2PBE A;  3JCF A;  5B3P A;  4I2D A;  1OU5 A;  5HHI A;  3JPP A;  1HUZ A;  1BPE A;  4GXK A;  2RFF A;  5J2H A;  2BCU A;  3L9D A;  3ISB A;  3RJK A;  4FHW A;  5TZV A;  3UXO A;  4M9L A;  1R8B A;  4X4P A;  3JPO A;  4LEY A;  4QZE A;  5J2E A;  2ZHA A;  4I2B A;  4RPX A;  3ERC C;  1HUO A;  4RQ1 A;  8ICS A;  5J2J A;  3AU6 A;  5HHH A;  4I2F A;  9ICH A;  2GAF D;  4XA5 A;  3HIY A;  4R66 A;  1TV9 A;  3RJF A;  4O5C A;  9ICE A;  4MF2 A;  4I2A A;  5J0S A;  8ICF A;  4QZF A;  4KLE A;  4KLJ A;  4UD4 A;  7ICG A;  4PHP A;  5IIM A;  8ICR A;  7ICL A;  1KNY A;  1XSL A;  2ZH3 A;  7ICT A;  5J0R A;  4R65 A;  1ZQY A;  9ICJ A;  4JLZ A;  7ICO A;  3UQ0 A;  3AUO A;  3UXP A;  4AT8 A;  3V7K A;  2DRA A;  7ICU A;  5DKW A;  2B4V A;  4XUS A;  4I27 A;  4RWQ A;  1BPX A;  4KLL A;  1JMS A;  4PHE A;  4FHY A;  8ICJ A;  4X0A A;  1ZQM A;  4K97 A;  4Z6D A;  7ICK A;  1ZQW A;  7ICN A;  3PNC A;  1ZQI A;  1ZQO A;  4NLK A;  3RJJ A;  1KDH A;  4RT2 A;  3NWI A;  4M9J A;  7ICE A;  4FH3 A;  4OAF A;  4NXZ A;  3RH4 A;  3PML A;  9ICR A;  4YD2 A;  3JPQ A;  2DR9 A;  3UXN A;  4TUS A;  8ICE A;  3TFS A;  1JN3 A;  9ICK A;  5CFT A;  3WFO A;  4RPY A;  4P4O A;  4RQ0 A;  4FO1 A;  4M0A A;  4KLO A;  3C2K A;  4KLI A;  5D49 A;  5J0W A;  4I2G A;  5HRD A;  5HRK A;  4TUP A;  4TUR A;  1ZJM A;  1MQ3 A;  5DEC A;  8ICV A;  1ZQP A;  1Q78 A;  3K75 D;  3OWG A;  1ZQH A;  3LK9 A;  5J0O A;  9ICS A;  4EED A;  1ZQQ A;  9ICV A;  4O69 A;  3JYY A;  3RH6 A;  1V4A A;  4WC4 A;  3C18 A;  4AT9 A;  4X4Q A;  4MFA A;  4M9G A;  4LEZ A;  4X4N A;  2ID1 A;  4DO9 A;  1ZQX A;  9ICW A;  4UBC A;  3RJI A;  3AQM A;  2Q66 A;  3V7J A;  3UPQ A;  8ICK A;  4RQ4 A;  4O67 A;  4O6A A;  4RWO A;  2ZH9 A;  5J0T A;  4P4M A;  1UEU A;  4O68 A;  8ICH A;  4O5K A;  4RQ5 A;  2HN2 A;  4GXJ A;  5CHG A;  4K4G A;  4NXW A;  5CR0 A;  4UB5 A;  3OVB A;  2BE3 A;  4MFC A;  2ZH7 A;  5DB9 A;  2B51 A;  3H39 A;  4KLQ A;  3LQC B;  4QZA A;  4E8F A;  5HRG A;  4DOB A;  1ZQE A;  3AU2 A;  3HWT A;  8ICL A;  9ICL A;  5J2I A;  4FHV A;  1JAJ A;  3OVA A;  4RWN A;  4WC3 A;  1ZQG A;  1ZQC A;  1UEV A;  3ISC A;  3RJH A;  2M2V A;  2IUB A;  3UPS A;  4KLS A;  4RQ8 A;  7ICI A;  1YLQ A;  5DDM A;  2BPC A;  3PHZ A;  5J29 A;  9ICI A;  4QZ8 A;  2W9M A;  7ICV A;  8ICU A;  5IIN A;  4NXT A;  4Z6C A;  5HRH A;  3MGI A;  4EBJ A;  2ZH8 A;  4EGW A;  3WFR E;  4NKT A;  4K99 A;  9ICF A;  5IIJ A;  5D62 A;  4UB3 A;  3HJ1 A;  8ICI A;  1ZQL A;  3CK6 A;  7ICP A;  4WQL A;  2ISO A;  5J2A A;  5J2B A;  4KLU A;  7ICM A;  4IQU A;  3H3A A;  1MIW A;  8ICA A;  4QZG A;  1TFW A;  1ZQK A;  4KB6 A;  2NRK A;  4IQT A;  4F5P A;  5B3Q A;  4WOY A;  1ZQB A;  5D61 A;  4I2C A;  8ICG A;  5J2F A;  4F5O A;  5J0P A;  1ZQD A;  5J2C A;  4YMM A;  8ICM A;  4KM5 A;  4X0B A;  2ZHB A;  3RJE A;  4I0U A;  3H38 A;  4UD5 A;  5HC9 A;  5J0X A;  5D63 A;  4NLN A;  1NO5 A;  2BCR A; 
#chains in the Genus database with same CATH homology
 4WC5 A;  1BPB A;  3MDA A;  4GXI A;  3WFQ E;  4KLT A;  4P4P A;  4RT3 A;  8ICN A;  4PHA A;  4EP7 A;  3AQL A;  1JQR A;  9ICU A;  4X4U A;  3C5G A;  4DOC A;  2PFP A;  4KLF A;  5D4B A;  1ZQJ A;  5IIK A;  4IQV A;  5DB8 A;  2O1P A;  1ZQS A;  9ICN A;  5J0Y A;  9ICX A;  2BCV A;  7ICQ A;  5DDY A;  3OUY B;  4KLM A;  4X4S A;  4YD1 A;  4X4T A;  4FHP A;  2FMP A;  3PMN A;  2BPF A;  4WC0 A;  3V7L A;  3C5F A;  7ICH A;  4I29 A;  4NY8 A;  4FH5 A;  4IG8 A;  3OUY A;  4YCX A;  2BPG A;  4RQ3 A;  4RQ7 A;  3MGH A;  8ICO A;  4E80 A;  4PGQ A;  1RZT A;  3H37 A;  4UAY A;  4PPX A;  1MQ2 A;  4KLG A;  3MDC A;  4NM1 A;  5DBC A;  5III A;  5BOM A;  3OV7 A;  4I2J A;  4X4R A;  8ICP A;  5HRE A;  1R89 A;  1BPY A;  4RPZ A;  2M2W A;  8ICT A;  3C2L A;  7ICJ A;  4YN4 A;  4R63 A;  4F5Q A;  2VAN A;  1ZQN A;  4MF8 A;  2ZH5 A;  4PHD A;  4XQ8 A;  1VFG A;  5HR9 A;  4EBK A;  4PGY A;  4DOA A;  4M9N A;  9ICM A;  1ZQZ A;  2M2T A;  4X4O A;  1TFY A;  3JPS A;  3JPT A;  1R8A A;  4M5D A;  1KEJ A;  3JPR A;  1Q79 A;  4KLH A;  4WC7 A;  2DR8 A;  1FA0 A;  4KLD A;  9ICO A;  3HX0 A;  5D46 A;  5IIO A;  4X5V A;  4PGX A;  1ZQT A;  5HRF A;  2FMS A;  4YMO A;  2PFO A;  2ISP A;  4IQW A;  2HHP A;  8ICX A;  3B0Y A;  4UB4 A;  4JWN A;  5J2D A;  4AT7 B;  4UB1 A;  9ICB A;  1XSP A;  2ZH2 A;  4O5E A;  4F5R A;  4RQ6 A;  5DBB A;  3AQK A;  4UB2 A;  4AT7 A;  3B0X A;  9ICT A;  3WFS C;  2DRB A;  3RH5 A;  4WC1 A;  2P66 A;  4K4H A;  4F5N A;  5DED A;  4NM2 A;  5J0Q A;  7ICR A;  4PH5 A;  1RPL A;  3TFR A;  1ZQF A;  4R64 A;  4AT8 B;  4QZI A;  1BPD A;  4Z6E A;  8ICC A;  4QZD A;  8ICB A;  1ZQR A;  2DVI A;  8ICW A;  4M2Y A;  5J0U A;  5CB1 A;  2I9G A;  1BPZ A;  4X4V A;  4XRH A;  5DB6 A;  8ICQ A;  4WC6 A;  4TUQ A;  4E7X A;  4FHX A;  4QZH A;  4WCW A;  1NOM A;  2PXI A;  4LZG A;  2DR7 A;  4UAZ A;  5HRL A;  5HRI A;  1F5A A;  4QZ9 A;  4RQ2 A;  3JZ0 A;  3UQ2 A;  9ICQ A;  1ZQU A;  4M47 A;  3NYB A;  2IHM A;  2FMQ A;  3AQN A;  3V72 A;  2ZH6 A;  1MIV A;  4I28 A;  5J2G A;  3RJG A;  4QZB A;  5BOL A;  5IIL A;  1TVA A;  2ZH1 A;  4WBY A;  3C2M A;  4M04 A;  4FO6 A;  9ICP A;  4K4I A;  1WOT A;  1ZQV A;  5DB7 A;  8ICY A;  4O9M A;  1XSN A;  4I2H A;  1MIY A;  4I2E A;  4XQ7 A;  5F2V O;  3WFP A;  4QZC A;  7ICF A;  2BCQ A;  2PFN A;  1PX5 A;  2BCS A;  4WBZ A;  5BPC A;  5CP2 A;  4YMN A;  4AT9 B;  3ISD A;  4LZD A;  9ICA A;  3C66 A;  4ATB B;  4WC2 A;  4P2H A;  4S3N A;  2GWS A;  2PFQ A;  1UET A;  4JWM A;  5HRB A;  4ATB A;  4I2I A;  1ZJN A;  1R8C A;  2ZH4 A;  2M2U A;  1ZQA A;  4LVS A;  4LT6 A;  4RWP A;  5EOZ A;  7ICS A;  2O5A A;  3GDX A;  2DR5 A;  4NLZ A;  5J2K A;  5CJ7 A;  5CA7 A;  4UBB A;  3JPN A;  3MBY A;  3HJ4 A;  3OGU A;  5DBA A;  4Z6F A;  4MFF A;  8ICZ A;  4UAW A;  4M9H A;  5CWR A;  3HW8 A;  1VJ7 A;  3OVS A;  4NKU A;  9ICC A;  9ICG A;  2PBE A;  4I2D A;  1OU5 A;  5HHI A;  3JPP A;  1HUZ A;  1BPE A;  4GXK A;  2RFF A;  5J2H A;  2BCU A;  3L9D A;  3ISB A;  3RJK A;  4FHW A;  5TZV A;  3UXO A;  4M9L A;  1R8B A;  4X4P A;  3JPO A;  4QZE A;  5J2E A;  2ZHA A;  4I2B A;  4RPX A;  1HUO A;  4RQ1 A;  8ICS A;  5J2J A;  3AU6 A;  5HHH A;  4I2F A;  9ICH A;  4XA5 A;  3HIY A;  4R66 A;  1TV9 A;  3RJF A;  4O5C A;  9ICE A;  4MF2 A;  4I2A A;  5J0S A;  8ICF A;  4QZF A;  4KLE A;  4KLJ A;  4UD4 A;  7ICG A;  4PHP A;  5IIM A;  8ICR A;  7ICL A;  1KNY A;  1XSL A;  2ZH3 A;  7ICT A;  5J0R A;  4R65 A;  1ZQY A;  9ICJ A;  7ICO A;  3UQ0 A;  3AUO A;  3UXP A;  4AT8 A;  3V7K A;  2DRA A;  7ICU A;  5DKW A;  4XUS A;  4I27 A;  4RWQ A;  1BPX A;  4KLL A;  1JMS A;  4PHE A;  4FHY A;  8ICJ A;  4X0A A;  1ZQM A;  4Z6D A;  7ICK A;  1ZQW A;  7ICN A;  3PNC A;  1ZQI A;  1ZQO A;  4NLK A;  3RJJ A;  1KDH A;  4RT2 A;  4M9J A;  7ICE A;  4FH3 A;  4NXZ A;  3RH4 A;  3PML A;  9ICR A;  4YD2 A;  3JPQ A;  2DR9 A;  3UXN A;  4TUS A;  8ICE A;  3TFS A;  1JN3 A;  9ICK A;  3WFO A;  4RPY A;  4P4O A;  4RQ0 A;  4M0A A;  4KLO A;  3C2K A;  4KLI A;  5D49 A;  5J0W A;  4I2G A;  5HRD A;  5HRK A;  4TUP A;  4TUR A;  1ZJM A;  1MQ3 A;  5DEC A;  8ICV A;  1ZQP A;  1Q78 A;  3K75 D;  1ZQH A;  3LK9 A;  5J0O A;  9ICS A;  1ZQQ A;  9ICV A;  3JYY A;  3RH6 A;  1V4A A;  4WC4 A;  3C18 A;  4AT9 A;  4X4Q A;  4MFA A;  4M9G A;  4X4N A;  2ID1 A;  4DO9 A;  1ZQX A;  9ICW A;  4UBC A;  3RJI A;  3AQM A;  2Q66 A;  3V7J A;  3UPQ A;  8ICK A;  4RQ4 A;  4RWO A;  2ZH9 A;  5J0T A;  4P4M A;  1UEU A;  8ICH A;  4O5K A;  4RQ5 A;  4GXJ A;  5CHG A;  4K4G A;  5CR0 A;  4UB5 A;  3OVB A;  2BE3 A;  4MFC A;  2ZH7 A;  5DB9 A;  3H39 A;  4KLQ A;  3LQC B;  4QZA A;  4E8F A;  5HRG A;  4DOB A;  1ZQE A;  3AU2 A;  3HWT A;  8ICL A;  9ICL A;  5J2I A;  4FHV A;  1JAJ A;  3OVA A;  4RWN A;  4WC3 A;  1ZQG A;  1ZQC A;  1UEV A;  3ISC A;  3RJH A;  2M2V A;  3UPS A;  4KLS A;  4RQ8 A;  7ICI A;  1YLQ A;  5DDM A;  2BPC A;  5J29 A;  9ICI A;  4QZ8 A;  2W9M A;  7ICV A;  8ICU A;  5IIN A;  4Z6C A;  5HRH A;  3MGI A;  4EBJ A;  2ZH8 A;  3WFR E;  4NKT A;  9ICF A;  5IIJ A;  4UB3 A;  3HJ1 A;  8ICI A;  1ZQL A;  7ICP A;  2ISO A;  5J2A A;  5J2B A;  4KLU A;  7ICM A;  4IQU A;  3H3A A;  1MIW A;  8ICA A;  4QZG A;  1TFW A;  1ZQK A;  2NRK A;  4IQT A;  4F5P A;  1ZQB A;  4I2C A;  8ICG A;  5J2F A;  4F5O A;  5J0P A;  1ZQD A;  5J2C A;  4YMM A;  8ICM A;  4X0B A;  2ZHB A;  3RJE A;  3H38 A;  4UD5 A;  5HC9 A;  5J0X A;  4NLN A;  1NO5 A;  2BCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...