5HRHA

The crystal structure of asfvpolx(h115f/r127a mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIAAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrhA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrhA01
4UD5A 4I2HA 2BCQA 3JPQA 4QZ9A 4RWOA 8ICBA 3HJ4A 1ZQAA 4M9NA 5DB6A 4UAYA 3RJKA 4Z6EA 1Q78A 5HREA 4M2YA 5HRFA 2PFPA 3V7LA 3C5GA 9ICBA 1BPDA 4EBJA 8ICRA 8ICYA 1ZQBA 4I2IA 1ZJMA 2PFQA 3UXPA 3OGUA 3PMLA 3ISBA 5IIIA 4WC4A 4P4PA 3MDAA 4XA5A 9ICJA 5J2DA 5DDYA 1ZQOA 4X4NA 3TFRA 4AT7A 3V7KA 3B0YA 8ICOA 1TFWA 3MGHA 3JPPA 1MIWA 4QZIA 1ZQFA 4UB5A 4YCXA 2ZH4A 7ICUA 1NO5A 9ICLA 3C2LA 2PFOA 4YMOA 4X0BA 3JPNA 1PX5A 1HUOA 1TV9A 2M2TA 8ICIA 4KLLA 4RWQA 4KLGA 4KLDA 8ICZA 4F5QA 2DVIA 4GXJA 4KLMA 3V7JA 5J2BA 3V72A 3OVAA 8ICGA 4PGQA 4M9HA 4Z6CA 4X4PA 4WC0A 1BPXA 1ZQWA 4I2CA 1F5AA 5J0OA 4DOAA 4I2JA 4R65A 5HHHA 7ICSA 8ICNA 5J2FA 3GDXA 4RQ2A 4PPXA 7ICGA 2DR7A 4F5NA 4E8FA 9ICMA 4WBZA 1ZQXA 5HRIA 4RQ3A 7ICNA 1ZQGA 5TZVA 4PH5A 1VJ7A 5HC9A 3AQMA 8ICEA 2DR8A 3H39A 9ICXA 5EOZA 4IQWA 2ZH1A 1ZQEA 4RT2A 9ICRA 4RPXA 4O5KA 7ICHA 1ZQJA 3UQ0A 4X4UA 4RQ5A 3ISCA 5CWRA 4QZDA 1ZJNA 3WFQE 1R8BA 2M2UA 5J0PA 4RQ6A 3PNCA 1HUZA 4AT8A 3OV7A 4RQ4A 2BCRA 4R64A 5J2IA 5HRBA 1ZQDA 4LVSA 4X4VA 7ICIA 4F5PA 5DBBA 3AU6A 4IQUA 7ICKA 5J2KA 4X4RA 3UXNA 3WFPA 9ICWA 4I2DA 1KDHA 4AT9A 4P4OA 5IIMA 1ZQTA 3HIYA 5IINA 4WC6A 4UD4A 4I2AA 2BPFA 4MF2A 1JMSA 4E7XA 2VANA 1WOTA 4UB2A 3AQNA 5DDMA 5J2JA 4GXKA 2ZH3A 5J2HA 3RJGA 3HJ1A 7ICOA 4RQ0A 1OU5A 4M47A 4NLZA 4TUPA 4QZAA 4M04A 1TFYA 4O9MA 4WCWA 1FA0A 5CHGA 4QZ8A 4LZGA 5J2AA 3OUYA 4M0AA 4PHPA 4ATBA 4XUSA 4QZEA 4YMNA 5BOMA 4LT6A 4XQ7A 4TURA 1MIYA 5CR0A 1JN3A 1Q79A 3JPOA 4QZFA 4UB3A 3H37A 2BCUA 4QZCA 4O5EA 1ZQCA 3RJEA 3LQCB 3H38A 5J0SA 2ZH6A 2O1PA 5D46A 3JPTA 3JPRA 5J0RA 4P4MA 4IQVA 1ZQYA 2BPCA 4RT3A 5J0UA 8ICFA 3RH6A 1R8CA 1ZQUA 2ISOA 2Q66A 8ICKA 2HHPA 1BPYA 2DRBA 4AT7B 2ZH9A 4TUSA 1ZQNA 3OUYB 9ICAA 2ID1A 3JPSA 1R8AA 4KLUA 2ZHAA 4KLEA 4X4OA 8ICTA 4NM2A 8ICPA 5DKWA 4PGXA 2BPGA 2GWSA 1ZQPA 3WFOA 9ICTA 1JAJA 2O5AA 9ICNA 9ICFA 2PFNA 2ZH7A 5D49A 4KLQA 1UEUA 4M5DA 4S3NA 3C2KA 4FH3A 4XRHA 7ICRA 4UAWA 4MFFA 4E80A 3HW8A 3AU2A 4LZDA 5IIJA 4MFCA 2P66A 4I28A 9ICHA 7ICVA 4M9JA 5HHIA 5DBAA 5HRLA 1BPBA 4DOBA 1BPZA 2M2VA 4WC3A 4YD2A 5J0QA 4QZBA 2ZH5A 3L9DA 4NKUA 4RQ8A 8ICAA 2BCSA 2M2WA 4R63A 4KLJA 9ICKA 5CJ7A 8ICQA 5BPCA 1MQ3A 3UQ2A 4F5OA 5IILA 2BE3A 5IIKA 2PXIA 5DECA 4I2EA 4FH5A 3RJIA 5J0TA 3LK9A 9ICGA 7ICMA 1R89A 3RJJA 4K4IA 3AUOA 5CP2A 5HRGA 4JWNA 1ZQHA 3B0XA 5DB8A 4WBYA 8ICWA 4FHWA 5DEDA 3HWTA 5DB7A 9ICCA 1MIVA 4EP7A 7ICLA 9ICEA 4I2FA 3C18A 4X5VA 4I27A 4KLHA 4YMMA 4UBCA 1YLQA 2ZHBA 3WFSC 3MBYA 4X4TA 5CA7A 1ZQVA 2NRKA 4NLNA 4I2GA 4AT8B 2BCVA 4O5CA 4WC1A 7ICFA 4UB1A 3OVBA 7ICEA 5J2EA 3UXOA 2I9GA 8ICVA 2ISPA 4UB4A 2ZH2A 1ZQKA 4R66A 3WFRE 4AT9B 4KLTA 3K75D 9ICIA 1TVAA 2DR9A 5DB9A 4M9GA 2DRAA 2FMSA 4YN4A 4UBBA 4M9LA 2RFFA 4X0AA 2IHMA 2ZH8A 5HR9A 1ZQIA 4KLFA 4NKTA 4Z6DA 8ICSA 9ICPA 2PBEA 4GXIA 4FHVA 4NLKA 4RPZA 2W9MA 1VFGA 4PHAA 9ICSA 7ICPA 4NXZA 3PMNA 4F5RA 3ISDA 7ICJA 4QZHA 3NYBA 4ATBB 7ICQA 1ZQZA 8ICXA 1UEVA 5HRKA 3C66A 1ZQLA 4X4QA 2FMQA 5F2VO 9ICVA 8ICHA 4K4GA 4FHPA 4I2BA 3AQLA 3JYYA 4X4SA 4PHEA 1RPLA 5J2GA 3RH4A 4RQ7A 4IG8A 1BPEA 4WC5A 5BOLA 3JZ0A 4XQ8A 1ZQMA 8ICLA 8ICMA 8ICJA 4MF8A 2DR5A 3UPQA 4KLSA 5HRDA 4TUQA 4RQ1A 1ZQQA 4MFAA 3H3AA 4UAZA 1RZTA 4FHXA 1V4AA 1XSPA 4YD1A 3MDCA 3C5FA 1KNYA 3UPSA 1XSNA 8ICUA 1ZQSA 9ICOA 5J29A 4Z6FA 5HRHA 1NOMA 3OVSA 4KLIA 4WC7A 1MQ2A 4QZGA 3RJFA 4PGYA 3HX0A 5J2CA 3AQKA 4WC2A 5D4BA 5J0XA 4K4HA 4RWNA 9ICUA 4JWMA 4P2HA 7ICTA 3RH5A 4DO9A 1XSLA 1ZQRA 4IQTA 9ICQA 4NY8A 3RJHA 4I29A 8ICCA 4RPYA 2FMPA 4KLOA 5CB1A 5IIOA 1UETA 4FHYA 4RWPA 4NM1A 3TFSA 5J0YA 4PHDA 4FO6A 4DOCA 5DBCA 3MGIA 4EBKA 5J0WA 3C2MA 1JQRA 1KEJA
chains in the Genus database with same CATH superfamily
4UD5A 4I2HA 2BCQA 4NXVA 3JPQA 4QZ9A 2HN1A 8ICBA 4RWOA 3HJ4A 1ZQAA 4M9NA 5DB6A 4UAYA 3RJKA 4Z6EA 1Q78A 5HREA 4M2YA 5HRFA 2PFPA 3V7LA 3C5GA 9ICBA 1BPDA 4EBJA 4WQKA 8ICRA 8ICYA 1ZQBA 4I2IA 1ZJMA 2PFQA 3UXPA 3OGUA 3PMLA 3ISBA 5JTGA 5IIIA 4WC4A 4P4PA 3MDAA 4NXTA 4XA5A 9ICJA 4K8VA 5J2DA 5DDYA 1ZQOA 4X4NA 3TFRA 4AT7A 3V7KA 4K9AA 3B0YA 2GA9D 8ICOA 1TFWA 3MGHA 4LEVA 3JPPA 1MIWA 4QZIA 1ZQFA 4UB5A 4YCXA 2ZH4A 7ICUA 1NO5A 9ICLA 2B51A 3C2LA 2PFOA 4YMOA 4O6AA 4X0BA 3JPNA 1PX5A 1HUOA 1TV9A 5D61A 2M2TA 8ICIA 4KLLA 4RWQA 4KLGA 4KLDA 8ICZA 4F5QA 2DVIA 4GXJA 4KLMA 4K98A 4OAFA 3V7JA 5J2BA 3V72A 3OVAA 8ICGA 4PGQA 4O68A 4M9HA 5CFSA 4Z6CA 4X4PA 3EF2A 4WC0A 1BPXA 1ZQWA 4I2CA 1F5AA 5CFTA 5J0OA 4DOAA 4I2JA 4R65A 5HHHA 7ICSA 8ICNA 5J2FA 3GDXA 4RQ2A 4PPXA 7ICGA 2DR7A 4F5NA 4E8FA 9ICMA 4WBZA 1ZQXA 5HRIA 4RQ3A 4I0UA 7ICNA 1ZQGA 5TZVA 4PH5A 1VJ7A 5HC9A 3AQMA 8ICEA 2DR8A 3H39A 9ICXA 5EOZA 4IQWA 2ZH1A 1ZQEA 4RT2A 9ICRA 4RPXA 4O5KA 7ICHA 1ZQJA 3UQ0A 4WOYA 4X4UA 4RQ5A 3ISCA 4O67A 5CWRA 4O69A 4QZDA 1ZJNA 4K96A 3WFQE 1R8BA 2M2UA 5J0PA 4FO1A 4JLXA 4RQ6A 3PNCA 1HUZA 4AT8A 3OV7A 4RQ4A 2BCRA 4R64A 5J2IA 5HRBA 1ZQDA 4LVSA 4X4VA 7ICIA 4F5PA 5DBBA 3AU6A 4IQUA 7ICKA 5J2KA 4LEYA 4X4RA 3UXNA 3WFPA 9ICWA 4I2DA 1KDHA 4AT9A 4P4OA 5IIMA 1ZQTA 3HIYA 5IINA 4WC6A 5B3QA 4UD4A 4I2AA 2BPFA 4MF2A 4HX0A 2IUBA 1JMSA 4E7XA 2VANA 1WOTA 4LEZA 4UB2A 3AQNA 3NWIA 5DDMA 5J2JA 4GXKA 2ZH3A 5B3PA 5J2HA 3RJGA 3HJ1A 7ICOA 4RQ0A 1OU5A 4M47A 4NLZA 4TUPA 4QZAA 4M04A 1TFYA 4O9MA 4WCWA 1FA0A 5CHGA 4QZ8A 4LZGA 5J2AA 2FCLA 3OUYA 3ER8C 4M0AA 4PHPA 4ATBA 4XUSA 4WH5A 4QZEA 4YMNA 5BOMA 4NXWA 4LT6A 4XQ7A 4TURA 1MIYA 5CR0A 1JN3A 1Q79A 3JPOA 4QZFA 2BBJA 4UB3A 3H37A 3JCFA 2BCUA 4QZCA 2BBHA 4O5EA 1ZQCA 3RJEA 3LQCB 3H38A 3CK6A 5J0SA 3K7DA 2ZH6A 4NXUA 2O1PA 5D46A 3JPTA 3JPRA 5J0RA 4P4MA 4IQVA 1ZQYA 2BPCA 4RT3A 5J0UA 8ICFA 3RH6A 1R8CA 1ZQUA 2ISOA 2IHOA 2Q66A 8ICKA 2HHPA 1BPYA 2DRBA 4AT7B 2ZH9A 4TUSA 1ZQNA 3OUYB 9ICAA 2ID1A 3JPSA 1R8AA 4OAHA 4KLUA 4OAIZ 2ZHAA 4KLEA 4X4OA 8ICTA 4NM2A 8ICPA 5DKWA 4PGXA 2BPGA 2GWSA 1ZQPA 3WFOA 9ICTA 4EV6A 1JAJA 2O5AA 9ICNA 9ICFA 2PFNA 2ZH7A 5D49A 4KLQA 1UEUA 4M5DA 4S3NA 3C2KA 4FH3A 4XRHA 7ICRA 4NXXA 4UAWA 4MFFA 4E80A 3HW8A 3AU2A 4LZDA 5IIJA 4K99A 4MFCA 3NKUA 2P66A 4I28A 9ICHA 7ICVA 4M9JA 5HHIA 5DBAA 5HRLA 1BPBA 4DOBA 4KM5A 1BPZA 2M2VA 4WC3A 4MKPA 4YD2A 5J0QA 4QZBA 2ZH5A 3L9DA 4NKUA 4RQ8A 8ICAA 2BCSA 5CHEA 2M2WA 4R63A 4KLJA 9ICKA 5CJ7A 8ICQA 4XJEA 5BPCA 1MQ3A 3NVOA 3UQ2A 4F5OA 5IILA 2BE3A 5CFUA 5IIKA 2PXIA 5DECA 4I2EA 4FH5A 3RJIA 5J0TA 3LK9A 9ICGA 7ICMA 1R89A 3RJJA 4K4IA 3AUOA 5CP2A 5HRGA 4JWNA 1ZQHA 3B0XA 5DB8A 4WBYA 8ICWA 4FHWA 5DEDA 3HWTA 5DB7A 9ICCA 1MIVA 4EP7A 7ICLA 9ICEA 4I2FA 3C18A 4X5VA 4I27A 4KLHA 4YMMA 4UBCA 1YLQA 2ZHBA 3WFSC 3MBYA 4X4TA 5CA7A 1ZQVA 2NRKA 4NLNA 4I2GA 2B4VA 4AT8B 3OWGA 2BCVA 4O5CA 4WC1A 7ICFA 4UB1A 3OVBA 7ICEA 4JLZA 5J2EA 3UXOA 2I9GA 8ICVA 2ISPA 4UB4A 2ZH2A 1ZQKA 4R66A 3WFRE 4AT9B 4KLTA 4WQLA 3K75D 9ICIA 1TVAA 2DR9A 5DB9A 4M9GA 2DRAA 3PHZA 2FMSA 4YN4A 4UBBA 4M9LA 2RFFA 4X0AA 2IHMA 2ZH8A 5HR9A 1ZQIA 4KLFA 4NKTA 4Z6DA 8ICSA 9ICPA 2PBEA 4GXIA 4FHVA 4NLKA 4RPZA 2W9MA 2B56A 1VFGA 4PHAA 9ICSA 7ICPA 4NXZA 3PMNA 4F5RA 3ISDA 7ICJA 4QZHA 3NYBA 5D63A 4ATBB 7ICQA 1ZQZA 8ICXA 1UEVA 5HRKA 3C66A 1ZQLA 4X4QA 2FMQA 5F2VO 9ICVA 8ICHA 4EEBA 4K4GA 4FHPA 4I2BA 3AQLA 3JYYA 4X4SA 4PHEA 1RPLA 5J2GA 3RH4A 4RQ7A 4IG8A 1BPEA 4KB6A 4WC5A 2EWRA 4OAGA 5BOLA 3JZ0A 4XQ8A 1ZQMA 8ICLA 8ICMA 8ICJA 4MF8A 2DR5A 5D62A 3UPQA 4KLSA 4N7RA 5HRDA 4TUQA 4RQ1A 1ZQQA 4MFAA 3H3AA 4UAZA 1RZTA 4FHXA 1V4AA 1XSPA 4YD1A 3MDCA 3C5FA 1KNYA 3UPSA 1XSNA 8ICUA 1ZQSA 9ICOA 5J29A 4Z6FA 3MCRA 5HRHA 4K97A 3ERCC 1NOMA 3OVSA 4KLIA 4WC7A 1MQ2A 4QZGA 3RJFA 4PGYA 3HX0A 5J2CA 2HN2A 3AQKA 4WC2A 5D4BA 5J0XA 4K4HA 4RWNA 9ICUA 4JWMA 4P2HA 7ICTA 4EGWA 3RH5A 4DO9A 1XSLA 1ZQRA 4LEWA 4IQTA 9ICQA 4NY8A 4EEDA 3RJHA 4I29A 8ICCA 4RPYA 2FMPA 4KLOA 5CB1A 5IIOA 1UETA 4FHYA 3ER9B 4RWPA 4NM1A 3TFSA 5J0YA 4PHDA 4FO6A 1GPJA 4K9BA 4DOCA 5DBCA 3MGIA 4EBKA 5J0WA 3C2MA 1JQRA 1KEJA 2GAFD
chains in the Genus database with same CATH topology
4UD5A 4I2HA 2BCQA 3JPQA 4QZ9A 4RWOA 8ICBA 3HJ4A 1ZQAA 4M9NA 5DB6A 4UAYA 3RJKA 4Z6EA 1Q78A 5HREA 4M2YA 5HRFA 2PFPA 3V7LA 3C5GA 9ICBA 1BPDA 4EBJA 8ICRA 8ICYA 1ZQBA 4I2IA 1ZJMA 2PFQA 3UXPA 3OGUA 3PMLA 3ISBA 5IIIA 4WC4A 4P4PA 3MDAA 4XA5A 9ICJA 5J2DA 5DDYA 1ZQOA 4X4NA 3TFRA 4AT7A 3V7KA 3B0YA 8ICOA 1TFWA 3MGHA 3JPPA 1MIWA 4QZIA 1ZQFA 4UB5A 4YCXA 2ZH4A 7ICUA 1NO5A 9ICLA 3C2LA 2PFOA 4YMOA 4X0BA 3JPNA 1PX5A 1HUOA 1TV9A 2M2TA 8ICIA 4KLLA 4RWQA 4KLGA 4KLDA 8ICZA 4F5QA 2DVIA 4GXJA 4KLMA 3V7JA 5J2BA 3V72A 3OVAA 8ICGA 4PGQA 4M9HA 4Z6CA 4X4PA 4WC0A 1BPXA 1ZQWA 4I2CA 1F5AA 5J0OA 4DOAA 4I2JA 4R65A 5HHHA 7ICSA 8ICNA 5J2FA 3GDXA 4RQ2A 4PPXA 7ICGA 2DR7A 4F5NA 4E8FA 9ICMA 4WBZA 1ZQXA 5HRIA 4RQ3A 7ICNA 1ZQGA 5TZVA 4PH5A 1VJ7A 5HC9A 3AQMA 8ICEA 2DR8A 3H39A 9ICXA 5EOZA 4IQWA 2ZH1A 1ZQEA 4RT2A 9ICRA 4RPXA 4O5KA 7ICHA 1ZQJA 3UQ0A 4X4UA 4RQ5A 3ISCA 5CWRA 4QZDA 1ZJNA 3WFQE 1R8BA 2M2UA 5J0PA 4RQ6A 3PNCA 1HUZA 4AT8A 3OV7A 4RQ4A 2BCRA 4R64A 5J2IA 5HRBA 1ZQDA 4LVSA 4X4VA 7ICIA 4F5PA 5DBBA 3AU6A 4IQUA 7ICKA 5J2KA 4X4RA 3UXNA 3WFPA 9ICWA 4I2DA 1KDHA 4AT9A 4P4OA 5IIMA 1ZQTA 3HIYA 5IINA 4WC6A 4UD4A 4I2AA 2BPFA 4MF2A 1JMSA 4E7XA 2VANA 1WOTA 4UB2A 3AQNA 5DDMA 5J2JA 4GXKA 2ZH3A 5J2HA 3RJGA 3HJ1A 7ICOA 4RQ0A 1OU5A 4M47A 4NLZA 4TUPA 4QZAA 4M04A 1TFYA 4O9MA 4WCWA 1FA0A 5CHGA 4QZ8A 4LZGA 5J2AA 3OUYA 4M0AA 4PHPA 4ATBA 4XUSA 4QZEA 4YMNA 5BOMA 4LT6A 4XQ7A 4TURA 1MIYA 5CR0A 1JN3A 1Q79A 3JPOA 4QZFA 4UB3A 3H37A 2BCUA 4QZCA 4O5EA 1ZQCA 3RJEA 3LQCB 3H38A 5J0SA 2ZH6A 2O1PA 5D46A 3JPTA 3JPRA 5J0RA 4P4MA 4IQVA 1ZQYA 2BPCA 4RT3A 5J0UA 8ICFA 3RH6A 1R8CA 1ZQUA 2ISOA 2Q66A 8ICKA 2HHPA 1BPYA 2DRBA 4AT7B 2ZH9A 4TUSA 1ZQNA 3OUYB 9ICAA 2ID1A 3JPSA 1R8AA 4KLUA 2ZHAA 4KLEA 4X4OA 8ICTA 4NM2A 8ICPA 5DKWA 4PGXA 2BPGA 2GWSA 1ZQPA 3WFOA 9ICTA 1JAJA 2O5AA 9ICNA 9ICFA 2PFNA 2ZH7A 5D49A 4KLQA 1UEUA 4M5DA 4S3NA 3C2KA 4FH3A 4XRHA 7ICRA 4UAWA 4MFFA 4E80A 3HW8A 3AU2A 4LZDA 5IIJA 4MFCA 2P66A 4I28A 9ICHA 7ICVA 4M9JA 5HHIA 5DBAA 5HRLA 1BPBA 4DOBA 1BPZA 2M2VA 4WC3A 4YD2A 5J0QA 4QZBA 2ZH5A 3L9DA 4NKUA 4RQ8A 8ICAA 2BCSA 2M2WA 4R63A 4KLJA 9ICKA 5CJ7A 8ICQA 5BPCA 1MQ3A 3UQ2A 4F5OA 5IILA 2BE3A 5IIKA 2PXIA 5DECA 4I2EA 4FH5A 3RJIA 5J0TA 3LK9A 9ICGA 7ICMA 1R89A 3RJJA 4K4IA 3AUOA 5CP2A 5HRGA 4JWNA 1ZQHA 3B0XA 5DB8A 4WBYA 8ICWA 4FHWA 5DEDA 3HWTA 5DB7A 9ICCA 1MIVA 4EP7A 7ICLA 9ICEA 4I2FA 3C18A 4X5VA 4I27A 4KLHA 4YMMA 4UBCA 1YLQA 2ZHBA 3WFSC 3MBYA 4X4TA 5CA7A 1ZQVA 2NRKA 4NLNA 4I2GA 4AT8B 2BCVA 4O5CA 4WC1A 7ICFA 4UB1A 3OVBA 7ICEA 5J2EA 3UXOA 2I9GA 8ICVA 2ISPA 4UB4A 2ZH2A 1ZQKA 4R66A 3WFRE 4AT9B 4KLTA 3K75D 9ICIA 1TVAA 2DR9A 5DB9A 4M9GA 2DRAA 2FMSA 4YN4A 4UBBA 4M9LA 2RFFA 4X0AA 2IHMA 2ZH8A 5HR9A 1ZQIA 4KLFA 4NKTA 4Z6DA 8ICSA 9ICPA 2PBEA 4GXIA 4FHVA 4NLKA 4RPZA 2W9MA 1VFGA 4PHAA 9ICSA 7ICPA 4NXZA 3PMNA 4F5RA 3ISDA 7ICJA 4QZHA 3NYBA 4ATBB 7ICQA 1ZQZA 8ICXA 1UEVA 5HRKA 3C66A 1ZQLA 4X4QA 2FMQA 5F2VO 9ICVA 8ICHA 4K4GA 4FHPA 4I2BA 3AQLA 3JYYA 4X4SA 4PHEA 1RPLA 5J2GA 3RH4A 4RQ7A 4IG8A 1BPEA 4WC5A 5BOLA 3JZ0A 4XQ8A 1ZQMA 8ICLA 8ICMA 8ICJA 4MF8A 2DR5A 3UPQA 4KLSA 5HRDA 4TUQA 4RQ1A 1ZQQA 4MFAA 3H3AA 4UAZA 1RZTA 4FHXA 1V4AA 1XSPA 4YD1A 3MDCA 3C5FA 1KNYA 3UPSA 1XSNA 8ICUA 1ZQSA 9ICOA 5J29A 4Z6FA 5HRHA 1NOMA 3OVSA 4KLIA 4WC7A 1MQ2A 4QZGA 3RJFA 4PGYA 3HX0A 5J2CA 3AQKA 4WC2A 5D4BA 5J0XA 4K4HA 4RWNA 9ICUA 4JWMA 4P2HA 7ICTA 3RH5A 4DO9A 1XSLA 1ZQRA 4IQTA 9ICQA 4NY8A 3RJHA 4I29A 8ICCA 4RPYA 2FMPA 4KLOA 5CB1A 5IIOA 1UETA 4FHYA 4RWPA 4NM1A 3TFSA 5J0YA 4PHDA 4FO6A 4DOCA 5DBCA 3MGIA 4EBKA 5J0WA 3C2MA 1JQRA 1KEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UD5 A;  4I2H A;  2BCQ A;  3JPQ A;  4QZ9 A;  4RWO A;  8ICB A;  3HJ4 A;  1ZQA A;  4M9N A;  5DB6 A;  4UAY A;  3RJK A;  4Z6E A;  1Q78 A;  5HRE A;  4M2Y A;  5HRF A;  2PFP A;  3V7L A;  3C5G A;  9ICB A;  1BPD A;  4EBJ A;  8ICR A;  8ICY A;  1ZQB A;  4I2I A;  1ZJM A;  2PFQ A;  3UXP A;  3OGU A;  3PML A;  3ISB A;  5III A;  4WC4 A;  4P4P A;  3MDA A;  4XA5 A;  9ICJ A;  5J2D A;  5DDY A;  1ZQO A;  4X4N A;  3TFR A;  4AT7 A;  3V7K A;  3B0Y A;  8ICO A;  1TFW A;  3MGH A;  3JPP A;  1MIW A;  4QZI A;  1ZQF A;  4UB5 A;  4YCX A;  2ZH4 A;  7ICU A;  1NO5 A;  9ICL A;  3C2L A;  2PFO A;  4YMO A;  4X0B A;  3JPN A;  1PX5 A;  1HUO A;  1TV9 A;  2M2T A;  8ICI A;  4KLL A;  4RWQ A;  4KLG A;  4KLD A;  8ICZ A;  4F5Q A;  2DVI A;  4GXJ A;  4KLM A;  3V7J A;  5J2B A;  3V72 A;  3OVA A;  8ICG A;  4PGQ A;  4M9H A;  4Z6C A;  4X4P A;  4WC0 A;  1BPX A;  1ZQW A;  4I2C A;  1F5A A;  5J0O A;  4DOA A;  4I2J A;  4R65 A;  5HHH A;  7ICS A;  8ICN A;  5J2F A;  3GDX A;  4RQ2 A;  4PPX A;  7ICG A;  2DR7 A;  4F5N A;  4E8F A;  9ICM A;  4WBZ A;  1ZQX A;  5HRI A;  4RQ3 A;  7ICN A;  1ZQG A;  5TZV A;  4PH5 A;  1VJ7 A;  5HC9 A;  3AQM A;  8ICE A;  2DR8 A;  3H39 A;  9ICX A;  5EOZ A;  4IQW A;  2ZH1 A;  1ZQE A;  4RT2 A;  9ICR A;  4RPX A;  4O5K A;  7ICH A;  1ZQJ A;  3UQ0 A;  4X4U A;  4RQ5 A;  3ISC A;  5CWR A;  4QZD A;  1ZJN A;  3WFQ E;  1R8B A;  2M2U A;  5J0P A;  4RQ6 A;  3PNC A;  1HUZ A;  4AT8 A;  3OV7 A;  4RQ4 A;  2BCR A;  4R64 A;  5J2I A;  5HRB A;  1ZQD A;  4LVS A;  4X4V A;  7ICI A;  4F5P A;  5DBB A;  3AU6 A;  4IQU A;  7ICK A;  5J2K A;  4X4R A;  3UXN A;  3WFP A;  9ICW A;  4I2D A;  1KDH A;  4AT9 A;  4P4O A;  5IIM A;  1ZQT A;  3HIY A;  5IIN A;  4WC6 A;  4UD4 A;  4I2A A;  2BPF A;  4MF2 A;  1JMS A;  4E7X A;  2VAN A;  1WOT A;  4UB2 A;  3AQN A;  5DDM A;  5J2J A;  4GXK A;  2ZH3 A;  5J2H A;  3RJG A;  3HJ1 A;  7ICO A;  4RQ0 A;  1OU5 A;  4M47 A;  4NLZ A;  4TUP A;  4QZA A;  4M04 A;  1TFY A;  4O9M A;  4WCW A;  1FA0 A;  5CHG A;  4QZ8 A;  4LZG A;  5J2A A;  3OUY A;  4M0A A;  4PHP A;  4ATB A;  4XUS A;  4QZE A;  4YMN A;  5BOM A;  4LT6 A;  4XQ7 A;  4TUR A;  1MIY A;  5CR0 A;  1JN3 A;  1Q79 A;  3JPO A;  4QZF A;  4UB3 A;  3H37 A;  2BCU A;  4QZC A;  4O5E A;  1ZQC A;  3RJE A;  3LQC B;  3H38 A;  5J0S A;  2ZH6 A;  2O1P A;  5D46 A;  3JPT A;  3JPR A;  5J0R A;  4P4M A;  4IQV A;  1ZQY A;  2BPC A;  4RT3 A;  5J0U A;  8ICF A;  3RH6 A;  1R8C A;  1ZQU A;  2ISO A;  2Q66 A;  8ICK A;  2HHP A;  1BPY A;  2DRB A;  4AT7 B;  2ZH9 A;  4TUS A;  1ZQN A;  3OUY B;  9ICA A;  2ID1 A;  3JPS A;  1R8A A;  4KLU A;  2ZHA A;  4KLE A;  4X4O A;  8ICT A;  4NM2 A;  8ICP A;  5DKW A;  4PGX A;  2BPG A;  2GWS A;  1ZQP A;  3WFO A;  9ICT A;  1JAJ A;  2O5A A;  9ICN A;  9ICF A;  2PFN A;  2ZH7 A;  5D49 A;  4KLQ A;  1UEU A;  4M5D A;  4S3N A;  3C2K A;  4FH3 A;  4XRH A;  7ICR A;  4UAW A;  4MFF A;  4E80 A;  3HW8 A;  3AU2 A;  4LZD A;  5IIJ A;  4MFC A;  2P66 A;  4I28 A;  9ICH A;  7ICV A;  4M9J A;  5HHI A;  5DBA A;  5HRL A;  1BPB A;  4DOB A;  1BPZ A;  2M2V A;  4WC3 A;  4YD2 A;  5J0Q A;  4QZB A;  2ZH5 A;  3L9D A;  4NKU A;  4RQ8 A;  8ICA A;  2BCS A;  2M2W A;  4R63 A;  4KLJ A;  9ICK A;  5CJ7 A;  8ICQ A;  5BPC A;  1MQ3 A;  3UQ2 A;  4F5O A;  5IIL A;  2BE3 A;  5IIK A;  2PXI A;  5DEC A;  4I2E A;  4FH5 A;  3RJI A;  5J0T A;  3LK9 A;  9ICG A;  7ICM A;  1R89 A;  3RJJ A;  4K4I A;  3AUO A;  5CP2 A;  5HRG A;  4JWN A;  1ZQH A;  3B0X A;  5DB8 A;  4WBY A;  8ICW A;  4FHW A;  5DED A;  3HWT A;  5DB7 A;  9ICC A;  1MIV A;  4EP7 A;  7ICL A;  9ICE A;  4I2F A;  3C18 A;  4X5V A;  4I27 A;  4KLH A;  4YMM A;  4UBC A;  1YLQ A;  2ZHB A;  3WFS C;  3MBY A;  4X4T A;  5CA7 A;  1ZQV A;  2NRK A;  4NLN A;  4I2G A;  4AT8 B;  2BCV A;  4O5C A;  4WC1 A;  7ICF A;  4UB1 A;  3OVB A;  7ICE A;  5J2E A;  3UXO A;  2I9G A;  8ICV A;  2ISP A;  4UB4 A;  2ZH2 A;  1ZQK A;  4R66 A;  3WFR E;  4AT9 B;  4KLT A;  3K75 D;  9ICI A;  1TVA A;  2DR9 A;  5DB9 A;  4M9G A;  2DRA A;  2FMS A;  4YN4 A;  4UBB A;  4M9L A;  2RFF A;  4X0A A;  2IHM A;  2ZH8 A;  5HR9 A;  1ZQI A;  4KLF A;  4NKT A;  4Z6D A;  8ICS A;  9ICP A;  2PBE A;  4GXI A;  4FHV A;  4NLK A;  4RPZ A;  2W9M A;  1VFG A;  4PHA A;  9ICS A;  7ICP A;  4NXZ A;  3PMN A;  4F5R A;  3ISD A;  7ICJ A;  4QZH A;  3NYB A;  4ATB B;  7ICQ A;  1ZQZ A;  8ICX A;  1UEV A;  5HRK A;  3C66 A;  1ZQL A;  4X4Q A;  2FMQ A;  5F2V O;  9ICV A;  8ICH A;  4K4G A;  4FHP A;  4I2B A;  3AQL A;  3JYY A;  4X4S A;  4PHE A;  1RPL A;  5J2G A;  3RH4 A;  4RQ7 A;  4IG8 A;  1BPE A;  4WC5 A;  5BOL A;  3JZ0 A;  4XQ8 A;  1ZQM A;  8ICL A;  8ICM A;  8ICJ A;  4MF8 A;  2DR5 A;  3UPQ A;  4KLS A;  5HRD A;  4TUQ A;  4RQ1 A;  1ZQQ A;  4MFA A;  3H3A A;  4UAZ A;  1RZT A;  4FHX A;  1V4A A;  1XSP A;  4YD1 A;  3MDC A;  3C5F A;  1KNY A;  3UPS A;  1XSN A;  8ICU A;  1ZQS A;  9ICO A;  5J29 A;  4Z6F A;  5HRH A;  1NOM A;  3OVS A;  4KLI A;  4WC7 A;  1MQ2 A;  4QZG A;  3RJF A;  4PGY A;  3HX0 A;  5J2C A;  3AQK A;  4WC2 A;  5D4B A;  5J0X A;  4K4H A;  4RWN A;  9ICU A;  4JWM A;  4P2H A;  7ICT A;  3RH5 A;  4DO9 A;  1XSL A;  1ZQR A;  4IQT A;  9ICQ A;  4NY8 A;  3RJH A;  4I29 A;  8ICC A;  4RPY A;  2FMP A;  4KLO A;  5CB1 A;  5IIO A;  1UET A;  4FHY A;  4RWP A;  4NM1 A;  3TFS A;  5J0Y A;  4PHD A;  4FO6 A;  4DOC A;  5DBC A;  3MGI A;  4EBK A;  5J0W A;  3C2M A;  1JQR A;  1KEJ A; 
#chains in the Genus database with same CATH topology
 4UD5 A;  4I2H A;  2BCQ A;  4NXV A;  3JPQ A;  4QZ9 A;  2HN1 A;  8ICB A;  4RWO A;  3HJ4 A;  1ZQA A;  4M9N A;  5DB6 A;  4UAY A;  3RJK A;  4Z6E A;  1Q78 A;  5HRE A;  4M2Y A;  5HRF A;  2PFP A;  3V7L A;  3C5G A;  9ICB A;  1BPD A;  4EBJ A;  4WQK A;  8ICR A;  8ICY A;  1ZQB A;  4I2I A;  1ZJM A;  2PFQ A;  3UXP A;  3OGU A;  3PML A;  3ISB A;  5JTG A;  5III A;  4WC4 A;  4P4P A;  3MDA A;  4NXT A;  4XA5 A;  9ICJ A;  4K8V A;  5J2D A;  5DDY A;  1ZQO A;  4X4N A;  3TFR A;  4AT7 A;  3V7K A;  4K9A A;  3B0Y A;  2GA9 D;  8ICO A;  1TFW A;  3MGH A;  4LEV A;  3JPP A;  1MIW A;  4QZI A;  1ZQF A;  4UB5 A;  4YCX A;  2ZH4 A;  7ICU A;  1NO5 A;  9ICL A;  2B51 A;  3C2L A;  2PFO A;  4YMO A;  4O6A A;  4X0B A;  3JPN A;  1PX5 A;  1HUO A;  1TV9 A;  5D61 A;  2M2T A;  8ICI A;  4KLL A;  4RWQ A;  4KLG A;  4KLD A;  8ICZ A;  4F5Q A;  2DVI A;  4GXJ A;  4KLM A;  4K98 A;  4OAF A;  3V7J A;  5J2B A;  3V72 A;  3OVA A;  8ICG A;  4PGQ A;  4O68 A;  4M9H A;  5CFS A;  4Z6C A;  4X4P A;  3EF2 A;  4WC0 A;  1BPX A;  1ZQW A;  4I2C A;  1F5A A;  5CFT A;  5J0O A;  4DOA A;  4I2J A;  4R65 A;  5HHH A;  7ICS A;  8ICN A;  5J2F A;  3GDX A;  4RQ2 A;  4PPX A;  7ICG A;  2DR7 A;  4F5N A;  4E8F A;  9ICM A;  4WBZ A;  1ZQX A;  5HRI A;  4RQ3 A;  4I0U A;  7ICN A;  1ZQG A;  5TZV A;  4PH5 A;  1VJ7 A;  5HC9 A;  3AQM A;  8ICE A;  2DR8 A;  3H39 A;  9ICX A;  5EOZ A;  4IQW A;  2ZH1 A;  1ZQE A;  4RT2 A;  9ICR A;  4RPX A;  4O5K A;  7ICH A;  1ZQJ A;  3UQ0 A;  4WOY A;  4X4U A;  4RQ5 A;  3ISC A;  4O67 A;  5CWR A;  4O69 A;  4QZD A;  1ZJN A;  4K96 A;  3WFQ E;  1R8B A;  2M2U A;  5J0P A;  4FO1 A;  4JLX A;  4RQ6 A;  3PNC A;  1HUZ A;  4AT8 A;  3OV7 A;  4RQ4 A;  2BCR A;  4R64 A;  5J2I A;  5HRB A;  1ZQD A;  4LVS A;  4X4V A;  7ICI A;  4F5P A;  5DBB A;  3AU6 A;  4IQU A;  7ICK A;  5J2K A;  4LEY A;  4X4R A;  3UXN A;  3WFP A;  9ICW A;  4I2D A;  1KDH A;  4AT9 A;  4P4O A;  5IIM A;  1ZQT A;  3HIY A;  5IIN A;  4WC6 A;  5B3Q A;  4UD4 A;  4I2A A;  2BPF A;  4MF2 A;  4HX0 A;  2IUB A;  1JMS A;  4E7X A;  2VAN A;  1WOT A;  4LEZ A;  4UB2 A;  3AQN A;  3NWI A;  5DDM A;  5J2J A;  4GXK A;  2ZH3 A;  5B3P A;  5J2H A;  3RJG A;  3HJ1 A;  7ICO A;  4RQ0 A;  1OU5 A;  4M47 A;  4NLZ A;  4TUP A;  4QZA A;  4M04 A;  1TFY A;  4O9M A;  4WCW A;  1FA0 A;  5CHG A;  4QZ8 A;  4LZG A;  5J2A A;  2FCL A;  3OUY A;  3ER8 C;  4M0A A;  4PHP A;  4ATB A;  4XUS A;  4WH5 A;  4QZE A;  4YMN A;  5BOM A;  4NXW A;  4LT6 A;  4XQ7 A;  4TUR A;  1MIY A;  5CR0 A;  1JN3 A;  1Q79 A;  3JPO A;  4QZF A;  2BBJ A;  4UB3 A;  3H37 A;  3JCF A;  2BCU A;  4QZC A;  2BBH A;  4O5E A;  1ZQC A;  3RJE A;  3LQC B;  3H38 A;  3CK6 A;  5J0S A;  3K7D A;  2ZH6 A;  4NXU A;  2O1P A;  5D46 A;  3JPT A;  3JPR A;  5J0R A;  4P4M A;  4IQV A;  1ZQY A;  2BPC A;  4RT3 A;  5J0U A;  8ICF A;  3RH6 A;  1R8C A;  1ZQU A;  2ISO A;  2IHO A;  2Q66 A;  8ICK A;  2HHP A;  1BPY A;  2DRB A;  4AT7 B;  2ZH9 A;  4TUS A;  1ZQN A;  3OUY B;  9ICA A;  2ID1 A;  3JPS A;  1R8A A;  4OAH A;  4KLU A;  4OAI Z;  2ZHA A;  4KLE A;  4X4O A;  8ICT A;  4NM2 A;  8ICP A;  5DKW A;  4PGX A;  2BPG A;  2GWS A;  1ZQP A;  3WFO A;  9ICT A;  4EV6 A;  1JAJ A;  2O5A A;  9ICN A;  9ICF A;  2PFN A;  2ZH7 A;  5D49 A;  4KLQ A;  1UEU A;  4M5D A;  4S3N A;  3C2K A;  4FH3 A;  4XRH A;  7ICR A;  4NXX A;  4UAW A;  4MFF A;  4E80 A;  3HW8 A;  3AU2 A;  4LZD A;  5IIJ A;  4K99 A;  4MFC A;  3NKU A;  2P66 A;  4I28 A;  9ICH A;  7ICV A;  4M9J A;  5HHI A;  5DBA A;  5HRL A;  1BPB A;  4DOB A;  4KM5 A;  1BPZ A;  2M2V A;  4WC3 A;  4MKP A;  4YD2 A;  5J0Q A;  4QZB A;  2ZH5 A;  3L9D A;  4NKU A;  4RQ8 A;  8ICA A;  2BCS A;  5CHE A;  2M2W A;  4R63 A;  4KLJ A;  9ICK A;  5CJ7 A;  8ICQ A;  4XJE A;  5BPC A;  1MQ3 A;  3NVO A;  3UQ2 A;  4F5O A;  5IIL A;  2BE3 A;  5CFU A;  5IIK A;  2PXI A;  5DEC A;  4I2E A;  4FH5 A;  3RJI A;  5J0T A;  3LK9 A;  9ICG A;  7ICM A;  1R89 A;  3RJJ A;  4K4I A;  3AUO A;  5CP2 A;  5HRG A;  4JWN A;  1ZQH A;  3B0X A;  5DB8 A;  4WBY A;  8ICW A;  4FHW A;  5DED A;  3HWT A;  5DB7 A;  9ICC A;  1MIV A;  4EP7 A;  7ICL A;  9ICE A;  4I2F A;  3C18 A;  4X5V A;  4I27 A;  4KLH A;  4YMM A;  4UBC A;  1YLQ A;  2ZHB A;  3WFS C;  3MBY A;  4X4T A;  5CA7 A;  1ZQV A;  2NRK A;  4NLN A;  4I2G A;  2B4V A;  4AT8 B;  3OWG A;  2BCV A;  4O5C A;  4WC1 A;  7ICF A;  4UB1 A;  3OVB A;  7ICE A;  4JLZ A;  5J2E A;  3UXO A;  2I9G A;  8ICV A;  2ISP A;  4UB4 A;  2ZH2 A;  1ZQK A;  4R66 A;  3WFR E;  4AT9 B;  4KLT A;  4WQL A;  3K75 D;  9ICI A;  1TVA A;  2DR9 A;  5DB9 A;  4M9G A;  2DRA A;  3PHZ A;  2FMS A;  4YN4 A;  4UBB A;  4M9L A;  2RFF A;  4X0A A;  2IHM A;  2ZH8 A;  5HR9 A;  1ZQI A;  4KLF A;  4NKT A;  4Z6D A;  8ICS A;  9ICP A;  2PBE A;  4GXI A;  4FHV A;  4NLK A;  4RPZ A;  2W9M A;  2B56 A;  1VFG A;  4PHA A;  9ICS A;  7ICP A;  4NXZ A;  3PMN A;  4F5R A;  3ISD A;  7ICJ A;  4QZH A;  3NYB A;  5D63 A;  4ATB B;  7ICQ A;  1ZQZ A;  8ICX A;  1UEV A;  5HRK A;  3C66 A;  1ZQL A;  4X4Q A;  2FMQ A;  5F2V O;  9ICV A;  8ICH A;  4EEB A;  4K4G A;  4FHP A;  4I2B A;  3AQL A;  3JYY A;  4X4S A;  4PHE A;  1RPL A;  5J2G A;  3RH4 A;  4RQ7 A;  4IG8 A;  1BPE A;  4KB6 A;  4WC5 A;  2EWR A;  4OAG A;  5BOL A;  3JZ0 A;  4XQ8 A;  1ZQM A;  8ICL A;  8ICM A;  8ICJ A;  4MF8 A;  2DR5 A;  5D62 A;  3UPQ A;  4KLS A;  4N7R A;  5HRD A;  4TUQ A;  4RQ1 A;  1ZQQ A;  4MFA A;  3H3A A;  4UAZ A;  1RZT A;  4FHX A;  1V4A A;  1XSP A;  4YD1 A;  3MDC A;  3C5F A;  1KNY A;  3UPS A;  1XSN A;  8ICU A;  1ZQS A;  9ICO A;  5J29 A;  4Z6F A;  3MCR A;  5HRH A;  4K97 A;  3ERC C;  1NOM A;  3OVS A;  4KLI A;  4WC7 A;  1MQ2 A;  4QZG A;  3RJF A;  4PGY A;  3HX0 A;  5J2C A;  2HN2 A;  3AQK A;  4WC2 A;  5D4B A;  5J0X A;  4K4H A;  4RWN A;  9ICU A;  4JWM A;  4P2H A;  7ICT A;  4EGW A;  3RH5 A;  4DO9 A;  1XSL A;  1ZQR A;  4LEW A;  4IQT A;  9ICQ A;  4NY8 A;  4EED A;  3RJH A;  4I29 A;  8ICC A;  4RPY A;  2FMP A;  4KLO A;  5CB1 A;  5IIO A;  1UET A;  4FHY A;  3ER9 B;  4RWP A;  4NM1 A;  3TFS A;  5J0Y A;  4PHD A;  4FO6 A;  1GPJ A;  4K9B A;  4DOC A;  5DBC A;  3MGI A;  4EBK A;  5J0W A;  3C2M A;  1JQR A;  1KEJ A;  2GAF D; 
#chains in the Genus database with same CATH homology
 4UD5 A;  4I2H A;  2BCQ A;  3JPQ A;  4QZ9 A;  4RWO A;  8ICB A;  3HJ4 A;  1ZQA A;  4M9N A;  5DB6 A;  4UAY A;  3RJK A;  4Z6E A;  1Q78 A;  5HRE A;  4M2Y A;  5HRF A;  2PFP A;  3V7L A;  3C5G A;  9ICB A;  1BPD A;  4EBJ A;  8ICR A;  8ICY A;  1ZQB A;  4I2I A;  1ZJM A;  2PFQ A;  3UXP A;  3OGU A;  3PML A;  3ISB A;  5III A;  4WC4 A;  4P4P A;  3MDA A;  4XA5 A;  9ICJ A;  5J2D A;  5DDY A;  1ZQO A;  4X4N A;  3TFR A;  4AT7 A;  3V7K A;  3B0Y A;  8ICO A;  1TFW A;  3MGH A;  3JPP A;  1MIW A;  4QZI A;  1ZQF A;  4UB5 A;  4YCX A;  2ZH4 A;  7ICU A;  1NO5 A;  9ICL A;  3C2L A;  2PFO A;  4YMO A;  4X0B A;  3JPN A;  1PX5 A;  1HUO A;  1TV9 A;  2M2T A;  8ICI A;  4KLL A;  4RWQ A;  4KLG A;  4KLD A;  8ICZ A;  4F5Q A;  2DVI A;  4GXJ A;  4KLM A;  3V7J A;  5J2B A;  3V72 A;  3OVA A;  8ICG A;  4PGQ A;  4M9H A;  4Z6C A;  4X4P A;  4WC0 A;  1BPX A;  1ZQW A;  4I2C A;  1F5A A;  5J0O A;  4DOA A;  4I2J A;  4R65 A;  5HHH A;  7ICS A;  8ICN A;  5J2F A;  3GDX A;  4RQ2 A;  4PPX A;  7ICG A;  2DR7 A;  4F5N A;  4E8F A;  9ICM A;  4WBZ A;  1ZQX A;  5HRI A;  4RQ3 A;  7ICN A;  1ZQG A;  5TZV A;  4PH5 A;  1VJ7 A;  5HC9 A;  3AQM A;  8ICE A;  2DR8 A;  3H39 A;  9ICX A;  5EOZ A;  4IQW A;  2ZH1 A;  1ZQE A;  4RT2 A;  9ICR A;  4RPX A;  4O5K A;  7ICH A;  1ZQJ A;  3UQ0 A;  4X4U A;  4RQ5 A;  3ISC A;  5CWR A;  4QZD A;  1ZJN A;  3WFQ E;  1R8B A;  2M2U A;  5J0P A;  4RQ6 A;  3PNC A;  1HUZ A;  4AT8 A;  3OV7 A;  4RQ4 A;  2BCR A;  4R64 A;  5J2I A;  5HRB A;  1ZQD A;  4LVS A;  4X4V A;  7ICI A;  4F5P A;  5DBB A;  3AU6 A;  4IQU A;  7ICK A;  5J2K A;  4X4R A;  3UXN A;  3WFP A;  9ICW A;  4I2D A;  1KDH A;  4AT9 A;  4P4O A;  5IIM A;  1ZQT A;  3HIY A;  5IIN A;  4WC6 A;  4UD4 A;  4I2A A;  2BPF A;  4MF2 A;  1JMS A;  4E7X A;  2VAN A;  1WOT A;  4UB2 A;  3AQN A;  5DDM A;  5J2J A;  4GXK A;  2ZH3 A;  5J2H A;  3RJG A;  3HJ1 A;  7ICO A;  4RQ0 A;  1OU5 A;  4M47 A;  4NLZ A;  4TUP A;  4QZA A;  4M04 A;  1TFY A;  4O9M A;  4WCW A;  1FA0 A;  5CHG A;  4QZ8 A;  4LZG A;  5J2A A;  3OUY A;  4M0A A;  4PHP A;  4ATB A;  4XUS A;  4QZE A;  4YMN A;  5BOM A;  4LT6 A;  4XQ7 A;  4TUR A;  1MIY A;  5CR0 A;  1JN3 A;  1Q79 A;  3JPO A;  4QZF A;  4UB3 A;  3H37 A;  2BCU A;  4QZC A;  4O5E A;  1ZQC A;  3RJE A;  3LQC B;  3H38 A;  5J0S A;  2ZH6 A;  2O1P A;  5D46 A;  3JPT A;  3JPR A;  5J0R A;  4P4M A;  4IQV A;  1ZQY A;  2BPC A;  4RT3 A;  5J0U A;  8ICF A;  3RH6 A;  1R8C A;  1ZQU A;  2ISO A;  2Q66 A;  8ICK A;  2HHP A;  1BPY A;  2DRB A;  4AT7 B;  2ZH9 A;  4TUS A;  1ZQN A;  3OUY B;  9ICA A;  2ID1 A;  3JPS A;  1R8A A;  4KLU A;  2ZHA A;  4KLE A;  4X4O A;  8ICT A;  4NM2 A;  8ICP A;  5DKW A;  4PGX A;  2BPG A;  2GWS A;  1ZQP A;  3WFO A;  9ICT A;  1JAJ A;  2O5A A;  9ICN A;  9ICF A;  2PFN A;  2ZH7 A;  5D49 A;  4KLQ A;  1UEU A;  4M5D A;  4S3N A;  3C2K A;  4FH3 A;  4XRH A;  7ICR A;  4UAW A;  4MFF A;  4E80 A;  3HW8 A;  3AU2 A;  4LZD A;  5IIJ A;  4MFC A;  2P66 A;  4I28 A;  9ICH A;  7ICV A;  4M9J A;  5HHI A;  5DBA A;  5HRL A;  1BPB A;  4DOB A;  1BPZ A;  2M2V A;  4WC3 A;  4YD2 A;  5J0Q A;  4QZB A;  2ZH5 A;  3L9D A;  4NKU A;  4RQ8 A;  8ICA A;  2BCS A;  2M2W A;  4R63 A;  4KLJ A;  9ICK A;  5CJ7 A;  8ICQ A;  5BPC A;  1MQ3 A;  3UQ2 A;  4F5O A;  5IIL A;  2BE3 A;  5IIK A;  2PXI A;  5DEC A;  4I2E A;  4FH5 A;  3RJI A;  5J0T A;  3LK9 A;  9ICG A;  7ICM A;  1R89 A;  3RJJ A;  4K4I A;  3AUO A;  5CP2 A;  5HRG A;  4JWN A;  1ZQH A;  3B0X A;  5DB8 A;  4WBY A;  8ICW A;  4FHW A;  5DED A;  3HWT A;  5DB7 A;  9ICC A;  1MIV A;  4EP7 A;  7ICL A;  9ICE A;  4I2F A;  3C18 A;  4X5V A;  4I27 A;  4KLH A;  4YMM A;  4UBC A;  1YLQ A;  2ZHB A;  3WFS C;  3MBY A;  4X4T A;  5CA7 A;  1ZQV A;  2NRK A;  4NLN A;  4I2G A;  4AT8 B;  2BCV A;  4O5C A;  4WC1 A;  7ICF A;  4UB1 A;  3OVB A;  7ICE A;  5J2E A;  3UXO A;  2I9G A;  8ICV A;  2ISP A;  4UB4 A;  2ZH2 A;  1ZQK A;  4R66 A;  3WFR E;  4AT9 B;  4KLT A;  3K75 D;  9ICI A;  1TVA A;  2DR9 A;  5DB9 A;  4M9G A;  2DRA A;  2FMS A;  4YN4 A;  4UBB A;  4M9L A;  2RFF A;  4X0A A;  2IHM A;  2ZH8 A;  5HR9 A;  1ZQI A;  4KLF A;  4NKT A;  4Z6D A;  8ICS A;  9ICP A;  2PBE A;  4GXI A;  4FHV A;  4NLK A;  4RPZ A;  2W9M A;  1VFG A;  4PHA A;  9ICS A;  7ICP A;  4NXZ A;  3PMN A;  4F5R A;  3ISD A;  7ICJ A;  4QZH A;  3NYB A;  4ATB B;  7ICQ A;  1ZQZ A;  8ICX A;  1UEV A;  5HRK A;  3C66 A;  1ZQL A;  4X4Q A;  2FMQ A;  5F2V O;  9ICV A;  8ICH A;  4K4G A;  4FHP A;  4I2B A;  3AQL A;  3JYY A;  4X4S A;  4PHE A;  1RPL A;  5J2G A;  3RH4 A;  4RQ7 A;  4IG8 A;  1BPE A;  4WC5 A;  5BOL A;  3JZ0 A;  4XQ8 A;  1ZQM A;  8ICL A;  8ICM A;  8ICJ A;  4MF8 A;  2DR5 A;  3UPQ A;  4KLS A;  5HRD A;  4TUQ A;  4RQ1 A;  1ZQQ A;  4MFA A;  3H3A A;  4UAZ A;  1RZT A;  4FHX A;  1V4A A;  1XSP A;  4YD1 A;  3MDC A;  3C5F A;  1KNY A;  3UPS A;  1XSN A;  8ICU A;  1ZQS A;  9ICO A;  5J29 A;  4Z6F A;  5HRH A;  1NOM A;  3OVS A;  4KLI A;  4WC7 A;  1MQ2 A;  4QZG A;  3RJF A;  4PGY A;  3HX0 A;  5J2C A;  3AQK A;  4WC2 A;  5D4B A;  5J0X A;  4K4H A;  4RWN A;  9ICU A;  4JWM A;  4P2H A;  7ICT A;  3RH5 A;  4DO9 A;  1XSL A;  1ZQR A;  4IQT A;  9ICQ A;  4NY8 A;  3RJH A;  4I29 A;  8ICC A;  4RPY A;  2FMP A;  4KLO A;  5CB1 A;  5IIO A;  1UET A;  4FHY A;  4RWP A;  4NM1 A;  3TFS A;  5J0Y A;  4PHD A;  4FO6 A;  4DOC A;  5DBC A;  3MGI A;  4EBK A;  5J0W A;  3C2M A;  1JQR A;  1KEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...