5HRHA

The crystal structure of asfvpolx(h115f/r127a mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIAAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrhA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrhA01
4KLFA 4JWMA 3C2KA 7ICNA 3HJ4A 4WC4A 5DKWA 2DR7A 3MGHA 3JPPA 1Q78A 4NM1A 1TV9A 4WBYA 2ISPA 9ICMA 4X4VA 1ZJNA 4O9MA 2FMPA 1MIVA 4WC0A 4YCXA 1PX5A 4M0AA 4F5RA 2DRAA 5J2IA 5IIIA 4IQWA 1ZQNA 1KNYA 2BCVA 1KEJA 5J0SA 2ZH2A 3MDCA 9ICNA 4R63A 4P4MA 3OUYA 9ICKA 9ICOA 2ZHBA 4KLLA 3AU2A 4Z6DA 4RQ1A 4PH5A 4UAZA 4NXZA 3UXPA 3WFOA 1JAJA 3HJ1A 7ICMA 9ICCA 4P4OA 4NLZA 4NM2A 9ICQA 2PFOA 2M2WA 1JN3A 2NRKA 4NKTA 5DB7A 1BPBA 4NKUA 1FA0A 3LQCB 1TFYA 5HR9A 9ICAA 2M2TA 4M5DA 2ZH3A 1ZQLA 1MIWA 8ICUA 4YMOA 3C5GA 4I28A 2M2VA 2ZH5A 4AT8B 8ICQA 3JYYA 5HREA 5DBAA 1R8BA 4WCWA 5HRKA 4X4OA 4X4RA 4AT8A 8ICIA 8ICGA 5CR0A 1ZQDA 2BCRA 4PHEA 2FMQA 7ICUA 4X4UA 9ICGA 3H38A 4K4GA 1RPLA 4XQ7A 5HHHA 3JPRA 4DOAA 3MGIA 1UEUA 1BPZA 9ICUA 4FH3A 1V4AA 5BPCA 1ZQCA 3RH6A 4TUSA 4RQ2A 3JPSA 1ZQHA 4RWPA 8ICEA 4UD5A 4QZCA 1ZQRA 1KDHA 4R65A 5CHGA 5J0QA 5J2FA 9ICSA 8ICJA 7ICRA 8ICRA 3JPTA 2PFQA 4EP7A 3K75D 2W9MA 4EBKA 1MQ3A 8ICLA 1BPXA 2ZH1A 2IHMA 4X4NA 4I29A 2M2UA 5IIJA 3RJHA 4X4QA 1HUZA 2ISOA 5DB9A 3V7KA 1UETA 3WFRE 5F2VO 1ZQUA 3V72A 5J0OA 3OGUA 4UB2A 4M47A 8ICXA 5HRFA 3OVBA 5CP2A 4F5QA 1ZQMA 7ICPA 5CJ7A 5J2BA 7ICHA 4KLQA 4M9LA 3RJEA 3WFSC 3OVAA 3LK9A 8ICPA 2VANA 4X5VA 3RJJA 3TFSA 4P4PA 3HW8A 4RWQA 9ICBA 1R8CA 1XSPA 5J0PA 9ICJA 1BPEA 4FHXA 4UAYA 1MQ2A 5DB8A 3WFPA 4RWNA 8ICWA 4Z6CA 4RQ4A 3MDAA 4GXIA 8ICTA 4QZGA 4MFCA 1NO5A 1XSLA 3OUYB 5J2HA 9ICVA 7ICTA 4F5OA 5IIOA 1ZQPA 1VJ7A 1ZQSA 1BPYA 4WC1A 4I2FA 4X4SA 4NLNA 4KLUA 1HUOA 5CWRA 2BCUA 3AUOA 8ICKA 4I2EA 1R8AA 4F5NA 3NYBA 4RWOA 2DVIA 4FHWA 4R66A 4XA5A 4RPXA 5HRBA 8ICBA 3RJKA 2BPGA 3V7JA 4PHDA 5D4BA 7ICVA 7ICEA 4MFFA 1TFWA 3MBYA 3ISCA 4PGYA 5IIKA 1OU5A 2ZH6A 5J0WA 4DO9A 9ICTA 4FH5A 5DBBA 4FO6A 4Z6EA 3HX0A 7ICJA 9ICRA 3JPOA 4KLGA 4KLDA 5DEDA 4M9NA 9ICIA 3AQKA 2DRBA 3UQ0A 4WC3A 9ICHA 4MFAA 1WOTA 1YLQA 1F5AA 1ZQWA 4UB4A 1ZQBA 8ICNA 8ICAA 3C66A 5TZVA 9ICPA 1ZQTA 4I2CA 4KLIA 4X0BA 4UB5A 4WC5A 1XSNA 2DR8A 3PNCA 8ICOA 1ZQIA 5D46A 1MIYA 2ZH9A 1ZQEA 4X4TA 4KLEA 4KLHA 5DDYA 3C18A 4YN4A 3JPQA 3H3AA 3L9DA 4LVSA 5DDMA 4TURA 5J29A 4EBJA 3ISDA 4PGXA 4QZ8A 5BOLA 1VFGA 2BCQA 4K4IA 4KLSA 3PMLA 5J2CA 4M9HA 2RFFA 3C5FA 5IIMA 3HIYA 1ZQFA 7ICLA 4QZDA 1ZQJA 4QZBA 3RJFA 4WC2A 4I2GA 5HRDA 8ICVA 1JMSA 4TUQA 9ICWA 4UD4A 4I2DA 5CA7A 3JZ0A 4PHPA 3UPSA 4XRHA 4QZHA 4JWNA 4O5KA 2BCSA 4GXKA 4WBZA 1Q79A 4M2YA 2ZH4A 5EOZA 1ZQXA 5D49A 5J0YA 4I27A 3ISBA 4YMMA 4GXJA 2P66A 5CB1A 7ICGA 5J2EA 4MF2A 7ICKA 4LZDA 2DR9A 4RQ0A 1ZQYA 1ZQGA 2GWSA 9ICLA 4WC7A 2BPCA 5DB6A 5DECA 4QZIA 9ICEA 4IQUA 4PGQA 4K4HA 3AQNA 4O5EA 5IILA 4KLMA 8ICSA 5J2KA 8ICYA 4UBBA 1ZQZA 3UQ2A 3WFQE 4MF8A 3UXOA 3UPQA 3RH4A 1ZQQA 2ZHAA 4KLTA 4X4PA 4IQVA 5J2JA 4UB3A 4NY8A 4AT9B 4UB1A 3B0XA 2HHPA 1ZQKA 3RH5A 2O1PA 4AT9A 2I9GA 7ICOA 4DOBA 4O5CA 4ATBB 4KLJA 3RJGA 4RQ7A 4DOCA 4ATBA 4M04A 2O5AA 5J2DA 4RPZA 4I2IA 4PPXA 3V7LA 1NOMA 8ICMA 4WC6A 4XUSA 3JPNA 8ICZA 4QZEA 7ICQA 5DBCA 4YD2A 4TUPA 5HRLA 5HHIA 8ICHA 4IG8A 4RQ8A 2PFPA 5J2AA 4FHYA 4R64A 4YMNA 1BPDA 3B0YA 2DR5A 5J0UA 3AQLA 3H39A 3OVSA 2PFNA 3AQMA 5J2GA 7ICFA 3C2MA 4QZAA 4I2AA 3H37A 4M9GA 2Q66A 4NLKA 4X0AA 4S3NA 4LT6A 4RQ6A 2PXIA 4FHVA 4QZFA 4F5PA 3OV7A 4UAWA 1ZQVA 4RPYA 5J0TA 4XQ8A 4PHAA 2ID1A 3TFRA 2BPFA 2BE3A 3GDXA 4FHPA 3RJIA 4E8FA 4UBCA 9ICXA 1ZJMA 4AT7B 4I2BA 4P2HA 4YD1A 1R89A 1ZQOA 4AT7A 8ICCA 2FMSA 2PBEA 4LZGA 4M9JA 8ICFA 7ICIA 4IQTA 4RQ3A 5HC9A 3HWTA 5J0XA 5HRIA 5BOMA 4RQ5A 5HRGA 4KLOA 3C2LA 3PMNA 1ZQAA 4RT3A 3UXNA 7ICSA 4I2JA 4I2HA 5IINA 3AU6A 5HRHA 2ZH7A 4QZ9A 4RT2A 4E7XA 4E80A 2ZH8A 1UEVA 9ICFA 1RZTA 5J0RA 1JQRA 4Z6FA 1TVAA
chains in the Genus database with same CATH superfamily
4KLFA 4JWMA 5CFSA 3C2KA 7ICNA 3HJ4A 4WC4A 5DKWA 2DR7A 3MGHA 4WQLA 3JPPA 4OAGA 4NXTA 1Q78A 4NM1A 1TV9A 4WBYA 2ISPA 9ICMA 4X4VA 1ZJNA 4O9MA 2B4VA 2FMPA 1MIVA 4WC0A 4YCXA 1PX5A 4M0AA 4F5RA 2DRAA 5J2IA 5IIIA 4IQWA 1ZQNA 1KNYA 2BCVA 1KEJA 5J0SA 2ZH2A 3MDCA 9ICNA 4R63A 4EGWA 4K9AA 4P4MA 3OUYA 9ICKA 9ICOA 4NXWA 2ZHBA 2BBHA 4KLLA 3AU2A 4Z6DA 4RQ1A 4PH5A 4UAZA 4NXZA 3UXPA 3WFOA 1JAJA 3HJ1A 7ICMA 9ICCA 4P4OA 4NLZA 4NM2A 9ICQA 2PFOA 2M2WA 3PHZA 1JN3A 2NRKA 4NKTA 5DB7A 1BPBA 4NKUA 1FA0A 3LQCB 1TFYA 5HR9A 9ICAA 2M2TA 4M5DA 2ZH3A 1ZQLA 1MIWA 8ICUA 4YMOA 3C5GA 4I28A 2M2VA 2ZH5A 4AT8B 8ICQA 3JYYA 4KM5A 5HREA 5DBAA 1R8BA 4WCWA 5HRKA 4X4OA 4X4RA 4AT8A 8ICIA 8ICGA 5CR0A 1ZQDA 2BCRA 4PHEA 2FMQA 7ICUA 4X4UA 9ICGA 3H38A 4K4GA 3CK6A 1RPLA 4XQ7A 5HHHA 3EF2A 3JPRA 4DOAA 3MGIA 1UEUA 1BPZA 9ICUA 4FH3A 1V4AA 5BPCA 1ZQCA 3RH6A 4TUSA 4RQ2A 3JPSA 1ZQHA 4RWPA 8ICEA 4UD5A 4QZCA 1ZQRA 1KDHA 4R65A 5CHGA 5J0QA 5J2FA 9ICSA 8ICJA 7ICRA 8ICRA 3JPTA 2PFQA 4EP7A 3K75D 2W9MA 4K98A 4EBKA 4O6AA 1MQ3A 8ICLA 1BPXA 3OWGA 2ZH1A 4WOYA 2IHMA 4X4NA 4I29A 2M2UA 5IIJA 3RJHA 4X4QA 1HUZA 2ISOA 5DB9A 3V7KA 2B51A 1UETA 3WFRE 5F2VO 1ZQUA 3V72A 5J0OA 3OGUA 4UB2A 4M47A 8ICXA 3ER9B 5HRFA 3OVBA 5CP2A 2HN1A 4F5QA 1ZQMA 7ICPA 5CJ7A 5J2BA 7ICHA 4KLQA 4M9LA 3RJEA 3WFSC 4I0UA 3OVAA 3LK9A 3NVOA 4LEWA 8ICPA 2VANA 4X5VA 3RJJA 4OAHA 3TFSA 4P4PA 3HW8A 4RWQA 9ICBA 1R8CA 1XSPA 5J0PA 9ICJA 1BPEA 4FHXA 4HX0A 4UAYA 1MQ2A 5DB8A 3WFPA 4RWNA 4K8VA 8ICWA 4Z6CA 4RQ4A 3MDAA 4GXIA 8ICTA 4QZGA 4MFCA 1NO5A 5CHEA 1XSLA 3OUYB 5J2HA 9ICVA 7ICTA 4F5OA 2GAFD 4KB6A 5IIOA 1ZQPA 1VJ7A 1ZQSA 1BPYA 4WC1A 4I2FA 4X4SA 4NLNA 4KLUA 1HUOA 5CWRA 2BCUA 3AUOA 8ICKA 4I2EA 1R8AA 4F5NA 3NYBA 4RWOA 2DVIA 4FHWA 4R66A 4XA5A 4RPXA 5HRBA 8ICBA 3RJKA 4K96A 2BBJA 5B3PA 2BPGA 3V7JA 4PHDA 5D4BA 4EEBA 7ICVA 7ICEA 4MFFA 5JTGA 1TFWA 3MBYA 4NXXA 3ISCA 4O69A 4PGYA 5IIKA 1OU5A 2ZH6A 5J0WA 4DO9A 9ICTA 4FH5A 5DBBA 4FO6A 4Z6EA 3HX0A 7ICJA 9ICRA 3JPOA 4KLGA 4KLDA 5DEDA 4M9NA 9ICIA 3AQKA 2DRBA 4WQKA 3UQ0A 4WC3A 9ICHA 4MFAA 1WOTA 1YLQA 1F5AA 1ZQWA 4UB4A 1ZQBA 8ICNA 8ICAA 3C66A 5TZVA 9ICPA 1ZQTA 4I2CA 4KLIA 4X0BA 4UB5A 4WC5A 1XSNA 2IUBA 3PNCA 2DR8A 8ICOA 1ZQIA 5D46A 1MIYA 3ER8C 3K7DA 2ZH9A 1ZQEA 4EV6A 4X4TA 4KLEA 4KLHA 5DDYA 3C18A 4YN4A 3JPQA 3H3AA 3L9DA 4LVSA 2B56A 5DDMA 4TURA 5J29A 4NXVA 5D63A 4O68A 4EBJA 3ISDA 4PGXA 4QZ8A 5BOLA 1VFGA 2BCQA 4K4IA 4KLSA 3PMLA 5J2CA 4M9HA 2RFFA 3C5FA 5IIMA 3HIYA 1ZQFA 7ICLA 4QZDA 1ZQJA 4QZBA 3RJFA 4WC2A 4I2GA 5HRDA 8ICVA 1JMSA 4TUQA 9ICWA 4UD4A 4I2DA 5CA7A 3JZ0A 4PHPA 3UPSA 4XRHA 4LEZA 4QZHA 4JWNA 4O5KA 2BCSA 4GXKA 4WBZA 1Q79A 4WH5A 4M2YA 2ZH4A 5EOZA 1ZQXA 5D49A 5J0YA 4I27A 3JCFA 3ISBA 4YMMA 4GXJA 2P66A 5CB1A 4JLXA 5CFTA 7ICGA 5J2EA 4O67A 4MF2A 7ICKA 4LZDA 4MKPA 2DR9A 4RQ0A 1ZQYA 4OAIZ 1ZQGA 2GWSA 9ICLA 4WC7A 2BPCA 5DB6A 5DECA 4LEYA 4QZIA 9ICEA 4IQUA 4PGQA 4K4HA 3AQNA 4XJEA 4O5EA 5IILA 4KLMA 8ICSA 5J2KA 8ICYA 4UBBA 1ZQZA 3UQ2A 3WFQE 4MF8A 3UXOA 5D62A 3UPQA 5B3QA 3RH4A 1ZQQA 2ZHAA 4KLTA 2GA9D 4X4PA 4IQVA 5J2JA 4UB3A 4NY8A 4AT9B 4UB1A 3B0XA 2HHPA 1ZQKA 3RH5A 2O1PA 4AT9A 2I9GA 7ICOA 4DOBA 4O5CA 4ATBB 4KLJA 3RJGA 4RQ7A 4DOCA 4ATBA 4NXUA 4K9BA 4M04A 2O5AA 5J2DA 5CFUA 4RPZA 4I2IA 4PPXA 3V7LA 1NOMA 8ICMA 2HN2A 4WC6A 4XUSA 3JPNA 8ICZA 4QZEA 4OAFA 7ICQA 4FO1A 5DBCA 4YD2A 4TUPA 5HRLA 5HHIA 8ICHA 1GPJA 4IG8A 4RQ8A 2PFPA 5J2AA 4FHYA 4R64A 4YMNA 1BPDA 3B0YA 4N7RA 2DR5A 5J0UA 3AQLA 3MCRA 3NWIA 3H39A 3OVSA 2PFNA 3AQMA 5J2GA 7ICFA 3C2MA 4QZAA 4I2AA 3H37A 4M9GA 4EEDA 2Q66A 4NLKA 4X0AA 4S3NA 4LT6A 4RQ6A 2PXIA 4FHVA 4QZFA 3ERCC 4F5PA 3OV7A 4UAWA 1ZQVA 4RPYA 5J0TA 4XQ8A 4PHAA 4K97A 2ID1A 3TFRA 2BPFA 2BE3A 3GDXA 4FHPA 3RJIA 4E8FA 4UBCA 9ICXA 1ZJMA 4AT7B 4I2BA 4P2HA 4YD1A 1R89A 1ZQOA 4AT7A 8ICCA 2FMSA 2PBEA 4LEVA 2FCLA 4LZGA 4M9JA 8ICFA 7ICIA 4IQTA 4RQ3A 5HC9A 2EWRA 3HWTA 5J0XA 5HRIA 5BOMA 3NKUA 4RQ5A 5HRGA 4KLOA 3C2LA 3PMNA 1ZQAA 5D61A 4RT3A 3UXNA 7ICSA 4I2JA 4I2HA 5IINA 3AU6A 5HRHA 2ZH7A 4QZ9A 4K99A 4RT2A 2IHOA 4E7XA 4E80A 2ZH8A 1UEVA 9ICFA 1RZTA 5J0RA 4JLZA 1JQRA 4Z6FA 1TVAA
chains in the Genus database with same CATH topology
4KLFA 4JWMA 3C2KA 7ICNA 3HJ4A 4WC4A 5DKWA 2DR7A 3MGHA 3JPPA 1Q78A 4NM1A 1TV9A 4WBYA 2ISPA 9ICMA 4X4VA 1ZJNA 4O9MA 2FMPA 1MIVA 4WC0A 4YCXA 1PX5A 4M0AA 4F5RA 2DRAA 5J2IA 5IIIA 4IQWA 1ZQNA 1KNYA 2BCVA 1KEJA 5J0SA 2ZH2A 3MDCA 9ICNA 4R63A 4P4MA 3OUYA 9ICKA 9ICOA 2ZHBA 4KLLA 3AU2A 4Z6DA 4RQ1A 4PH5A 4UAZA 4NXZA 3UXPA 3WFOA 1JAJA 3HJ1A 7ICMA 9ICCA 4P4OA 4NLZA 4NM2A 9ICQA 2PFOA 2M2WA 1JN3A 2NRKA 4NKTA 5DB7A 1BPBA 4NKUA 1FA0A 3LQCB 1TFYA 5HR9A 9ICAA 2M2TA 4M5DA 2ZH3A 1ZQLA 1MIWA 8ICUA 4YMOA 3C5GA 4I28A 2M2VA 2ZH5A 4AT8B 8ICQA 3JYYA 5HREA 5DBAA 1R8BA 4WCWA 5HRKA 4X4OA 4X4RA 4AT8A 8ICIA 8ICGA 5CR0A 1ZQDA 2BCRA 4PHEA 2FMQA 7ICUA 4X4UA 9ICGA 3H38A 4K4GA 1RPLA 4XQ7A 5HHHA 3JPRA 4DOAA 3MGIA 1UEUA 1BPZA 9ICUA 4FH3A 1V4AA 5BPCA 1ZQCA 3RH6A 4TUSA 4RQ2A 3JPSA 1ZQHA 4RWPA 8ICEA 4UD5A 4QZCA 1ZQRA 1KDHA 4R65A 5CHGA 5J0QA 5J2FA 9ICSA 8ICJA 7ICRA 8ICRA 3JPTA 2PFQA 4EP7A 3K75D 2W9MA 4EBKA 1MQ3A 8ICLA 1BPXA 2ZH1A 2IHMA 4X4NA 4I29A 2M2UA 5IIJA 3RJHA 4X4QA 1HUZA 2ISOA 5DB9A 3V7KA 1UETA 3WFRE 5F2VO 1ZQUA 3V72A 5J0OA 3OGUA 4UB2A 4M47A 8ICXA 5HRFA 3OVBA 5CP2A 4F5QA 1ZQMA 7ICPA 5CJ7A 5J2BA 7ICHA 4KLQA 4M9LA 3RJEA 3WFSC 3OVAA 3LK9A 8ICPA 2VANA 4X5VA 3RJJA 3TFSA 4P4PA 3HW8A 4RWQA 9ICBA 1R8CA 1XSPA 5J0PA 9ICJA 1BPEA 4FHXA 4UAYA 1MQ2A 5DB8A 3WFPA 4RWNA 8ICWA 4Z6CA 4RQ4A 3MDAA 4GXIA 8ICTA 4QZGA 4MFCA 1NO5A 1XSLA 3OUYB 5J2HA 9ICVA 7ICTA 4F5OA 5IIOA 1ZQPA 1VJ7A 1ZQSA 1BPYA 4WC1A 4I2FA 4X4SA 4NLNA 4KLUA 1HUOA 5CWRA 2BCUA 3AUOA 8ICKA 4I2EA 1R8AA 4F5NA 3NYBA 4RWOA 2DVIA 4FHWA 4R66A 4XA5A 4RPXA 5HRBA 8ICBA 3RJKA 2BPGA 3V7JA 4PHDA 5D4BA 7ICVA 7ICEA 4MFFA 1TFWA 3MBYA 3ISCA 4PGYA 5IIKA 1OU5A 2ZH6A 5J0WA 4DO9A 9ICTA 4FH5A 5DBBA 4FO6A 4Z6EA 3HX0A 7ICJA 9ICRA 3JPOA 4KLGA 4KLDA 5DEDA 4M9NA 9ICIA 3AQKA 2DRBA 3UQ0A 4WC3A 9ICHA 4MFAA 1WOTA 1YLQA 1F5AA 1ZQWA 4UB4A 1ZQBA 8ICNA 8ICAA 3C66A 5TZVA 9ICPA 1ZQTA 4I2CA 4KLIA 4X0BA 4UB5A 4WC5A 1XSNA 2DR8A 3PNCA 8ICOA 1ZQIA 5D46A 1MIYA 2ZH9A 1ZQEA 4X4TA 4KLEA 4KLHA 5DDYA 3C18A 4YN4A 3JPQA 3H3AA 3L9DA 4LVSA 5DDMA 4TURA 5J29A 4EBJA 3ISDA 4PGXA 4QZ8A 5BOLA 1VFGA 2BCQA 4K4IA 4KLSA 3PMLA 5J2CA 4M9HA 2RFFA 3C5FA 5IIMA 3HIYA 1ZQFA 7ICLA 4QZDA 1ZQJA 4QZBA 3RJFA 4WC2A 4I2GA 5HRDA 8ICVA 1JMSA 4TUQA 9ICWA 4UD4A 4I2DA 5CA7A 3JZ0A 4PHPA 3UPSA 4XRHA 4QZHA 4JWNA 4O5KA 2BCSA 4GXKA 4WBZA 1Q79A 4M2YA 2ZH4A 5EOZA 1ZQXA 5D49A 5J0YA 4I27A 3ISBA 4YMMA 4GXJA 2P66A 5CB1A 7ICGA 5J2EA 4MF2A 7ICKA 4LZDA 2DR9A 4RQ0A 1ZQYA 1ZQGA 2GWSA 9ICLA 4WC7A 2BPCA 5DB6A 5DECA 4QZIA 9ICEA 4IQUA 4PGQA 4K4HA 3AQNA 4O5EA 5IILA 4KLMA 8ICSA 5J2KA 8ICYA 4UBBA 1ZQZA 3UQ2A 3WFQE 4MF8A 3UXOA 3UPQA 3RH4A 1ZQQA 2ZHAA 4KLTA 4X4PA 4IQVA 5J2JA 4UB3A 4NY8A 4AT9B 4UB1A 3B0XA 2HHPA 1ZQKA 3RH5A 2O1PA 4AT9A 2I9GA 7ICOA 4DOBA 4O5CA 4ATBB 4KLJA 3RJGA 4RQ7A 4DOCA 4ATBA 4M04A 2O5AA 5J2DA 4RPZA 4I2IA 4PPXA 3V7LA 1NOMA 8ICMA 4WC6A 4XUSA 3JPNA 8ICZA 4QZEA 7ICQA 5DBCA 4YD2A 4TUPA 5HRLA 5HHIA 8ICHA 4IG8A 4RQ8A 2PFPA 5J2AA 4FHYA 4R64A 4YMNA 1BPDA 3B0YA 2DR5A 5J0UA 3AQLA 3H39A 3OVSA 2PFNA 3AQMA 5J2GA 7ICFA 3C2MA 4QZAA 4I2AA 3H37A 4M9GA 2Q66A 4NLKA 4X0AA 4S3NA 4LT6A 4RQ6A 2PXIA 4FHVA 4QZFA 4F5PA 3OV7A 4UAWA 1ZQVA 4RPYA 5J0TA 4XQ8A 4PHAA 2ID1A 3TFRA 2BPFA 2BE3A 3GDXA 4FHPA 3RJIA 4E8FA 4UBCA 9ICXA 1ZJMA 4AT7B 4I2BA 4P2HA 4YD1A 1R89A 1ZQOA 4AT7A 8ICCA 2FMSA 2PBEA 4LZGA 4M9JA 8ICFA 7ICIA 4IQTA 4RQ3A 5HC9A 3HWTA 5J0XA 5HRIA 5BOMA 4RQ5A 5HRGA 4KLOA 3C2LA 3PMNA 1ZQAA 4RT3A 3UXNA 7ICSA 4I2JA 4I2HA 5IINA 3AU6A 5HRHA 2ZH7A 4QZ9A 4RT2A 4E7XA 4E80A 2ZH8A 1UEVA 9ICFA 1RZTA 5J0RA 1JQRA 4Z6FA 1TVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLF A;  4JWM A;  3C2K A;  7ICN A;  3HJ4 A;  4WC4 A;  5DKW A;  2DR7 A;  3MGH A;  3JPP A;  1Q78 A;  4NM1 A;  1TV9 A;  4WBY A;  2ISP A;  9ICM A;  4X4V A;  1ZJN A;  4O9M A;  2FMP A;  1MIV A;  4WC0 A;  4YCX A;  1PX5 A;  4M0A A;  4F5R A;  2DRA A;  5J2I A;  5III A;  4IQW A;  1ZQN A;  1KNY A;  2BCV A;  1KEJ A;  5J0S A;  2ZH2 A;  3MDC A;  9ICN A;  4R63 A;  4P4M A;  3OUY A;  9ICK A;  9ICO A;  2ZHB A;  4KLL A;  3AU2 A;  4Z6D A;  4RQ1 A;  4PH5 A;  4UAZ A;  4NXZ A;  3UXP A;  3WFO A;  1JAJ A;  3HJ1 A;  7ICM A;  9ICC A;  4P4O A;  4NLZ A;  4NM2 A;  9ICQ A;  2PFO A;  2M2W A;  1JN3 A;  2NRK A;  4NKT A;  5DB7 A;  1BPB A;  4NKU A;  1FA0 A;  3LQC B;  1TFY A;  5HR9 A;  9ICA A;  2M2T A;  4M5D A;  2ZH3 A;  1ZQL A;  1MIW A;  8ICU A;  4YMO A;  3C5G A;  4I28 A;  2M2V A;  2ZH5 A;  4AT8 B;  8ICQ A;  3JYY A;  5HRE A;  5DBA A;  1R8B A;  4WCW A;  5HRK A;  4X4O A;  4X4R A;  4AT8 A;  8ICI A;  8ICG A;  5CR0 A;  1ZQD A;  2BCR A;  4PHE A;  2FMQ A;  7ICU A;  4X4U A;  9ICG A;  3H38 A;  4K4G A;  1RPL A;  4XQ7 A;  5HHH A;  3JPR A;  4DOA A;  3MGI A;  1UEU A;  1BPZ A;  9ICU A;  4FH3 A;  1V4A A;  5BPC A;  1ZQC A;  3RH6 A;  4TUS A;  4RQ2 A;  3JPS A;  1ZQH A;  4RWP A;  8ICE A;  4UD5 A;  4QZC A;  1ZQR A;  1KDH A;  4R65 A;  5CHG A;  5J0Q A;  5J2F A;  9ICS A;  8ICJ A;  7ICR A;  8ICR A;  3JPT A;  2PFQ A;  4EP7 A;  3K75 D;  2W9M A;  4EBK A;  1MQ3 A;  8ICL A;  1BPX A;  2ZH1 A;  2IHM A;  4X4N A;  4I29 A;  2M2U A;  5IIJ A;  3RJH A;  4X4Q A;  1HUZ A;  2ISO A;  5DB9 A;  3V7K A;  1UET A;  3WFR E;  5F2V O;  1ZQU A;  3V72 A;  5J0O A;  3OGU A;  4UB2 A;  4M47 A;  8ICX A;  5HRF A;  3OVB A;  5CP2 A;  4F5Q A;  1ZQM A;  7ICP A;  5CJ7 A;  5J2B A;  7ICH A;  4KLQ A;  4M9L A;  3RJE A;  3WFS C;  3OVA A;  3LK9 A;  8ICP A;  2VAN A;  4X5V A;  3RJJ A;  3TFS A;  4P4P A;  3HW8 A;  4RWQ A;  9ICB A;  1R8C A;  1XSP A;  5J0P A;  9ICJ A;  1BPE A;  4FHX A;  4UAY A;  1MQ2 A;  5DB8 A;  3WFP A;  4RWN A;  8ICW A;  4Z6C A;  4RQ4 A;  3MDA A;  4GXI A;  8ICT A;  4QZG A;  4MFC A;  1NO5 A;  1XSL A;  3OUY B;  5J2H A;  9ICV A;  7ICT A;  4F5O A;  5IIO A;  1ZQP A;  1VJ7 A;  1ZQS A;  1BPY A;  4WC1 A;  4I2F A;  4X4S A;  4NLN A;  4KLU A;  1HUO A;  5CWR A;  2BCU A;  3AUO A;  8ICK A;  4I2E A;  1R8A A;  4F5N A;  3NYB A;  4RWO A;  2DVI A;  4FHW A;  4R66 A;  4XA5 A;  4RPX A;  5HRB A;  8ICB A;  3RJK A;  2BPG A;  3V7J A;  4PHD A;  5D4B A;  7ICV A;  7ICE A;  4MFF A;  1TFW A;  3MBY A;  3ISC A;  4PGY A;  5IIK A;  1OU5 A;  2ZH6 A;  5J0W A;  4DO9 A;  9ICT A;  4FH5 A;  5DBB A;  4FO6 A;  4Z6E A;  3HX0 A;  7ICJ A;  9ICR A;  3JPO A;  4KLG A;  4KLD A;  5DED A;  4M9N A;  9ICI A;  3AQK A;  2DRB A;  3UQ0 A;  4WC3 A;  9ICH A;  4MFA A;  1WOT A;  1YLQ A;  1F5A A;  1ZQW A;  4UB4 A;  1ZQB A;  8ICN A;  8ICA A;  3C66 A;  5TZV A;  9ICP A;  1ZQT A;  4I2C A;  4KLI A;  4X0B A;  4UB5 A;  4WC5 A;  1XSN A;  2DR8 A;  3PNC A;  8ICO A;  1ZQI A;  5D46 A;  1MIY A;  2ZH9 A;  1ZQE A;  4X4T A;  4KLE A;  4KLH A;  5DDY A;  3C18 A;  4YN4 A;  3JPQ A;  3H3A A;  3L9D A;  4LVS A;  5DDM A;  4TUR A;  5J29 A;  4EBJ A;  3ISD A;  4PGX A;  4QZ8 A;  5BOL A;  1VFG A;  2BCQ A;  4K4I A;  4KLS A;  3PML A;  5J2C A;  4M9H A;  2RFF A;  3C5F A;  5IIM A;  3HIY A;  1ZQF A;  7ICL A;  4QZD A;  1ZQJ A;  4QZB A;  3RJF A;  4WC2 A;  4I2G A;  5HRD A;  8ICV A;  1JMS A;  4TUQ A;  9ICW A;  4UD4 A;  4I2D A;  5CA7 A;  3JZ0 A;  4PHP A;  3UPS A;  4XRH A;  4QZH A;  4JWN A;  4O5K A;  2BCS A;  4GXK A;  4WBZ A;  1Q79 A;  4M2Y A;  2ZH4 A;  5EOZ A;  1ZQX A;  5D49 A;  5J0Y A;  4I27 A;  3ISB A;  4YMM A;  4GXJ A;  2P66 A;  5CB1 A;  7ICG A;  5J2E A;  4MF2 A;  7ICK A;  4LZD A;  2DR9 A;  4RQ0 A;  1ZQY A;  1ZQG A;  2GWS A;  9ICL A;  4WC7 A;  2BPC A;  5DB6 A;  5DEC A;  4QZI A;  9ICE A;  4IQU A;  4PGQ A;  4K4H A;  3AQN A;  4O5E A;  5IIL A;  4KLM A;  8ICS A;  5J2K A;  8ICY A;  4UBB A;  1ZQZ A;  3UQ2 A;  3WFQ E;  4MF8 A;  3UXO A;  3UPQ A;  3RH4 A;  1ZQQ A;  2ZHA A;  4KLT A;  4X4P A;  4IQV A;  5J2J A;  4UB3 A;  4NY8 A;  4AT9 B;  4UB1 A;  3B0X A;  2HHP A;  1ZQK A;  3RH5 A;  2O1P A;  4AT9 A;  2I9G A;  7ICO A;  4DOB A;  4O5C A;  4ATB B;  4KLJ A;  3RJG A;  4RQ7 A;  4DOC A;  4ATB A;  4M04 A;  2O5A A;  5J2D A;  4RPZ A;  4I2I A;  4PPX A;  3V7L A;  1NOM A;  8ICM A;  4WC6 A;  4XUS A;  3JPN A;  8ICZ A;  4QZE A;  7ICQ A;  5DBC A;  4YD2 A;  4TUP A;  5HRL A;  5HHI A;  8ICH A;  4IG8 A;  4RQ8 A;  2PFP A;  5J2A A;  4FHY A;  4R64 A;  4YMN A;  1BPD A;  3B0Y A;  2DR5 A;  5J0U A;  3AQL A;  3H39 A;  3OVS A;  2PFN A;  3AQM A;  5J2G A;  7ICF A;  3C2M A;  4QZA A;  4I2A A;  3H37 A;  4M9G A;  2Q66 A;  4NLK A;  4X0A A;  4S3N A;  4LT6 A;  4RQ6 A;  2PXI A;  4FHV A;  4QZF A;  4F5P A;  3OV7 A;  4UAW A;  1ZQV A;  4RPY A;  5J0T A;  4XQ8 A;  4PHA A;  2ID1 A;  3TFR A;  2BPF A;  2BE3 A;  3GDX A;  4FHP A;  3RJI A;  4E8F A;  4UBC A;  9ICX A;  1ZJM A;  4AT7 B;  4I2B A;  4P2H A;  4YD1 A;  1R89 A;  1ZQO A;  4AT7 A;  8ICC A;  2FMS A;  2PBE A;  4LZG A;  4M9J A;  8ICF A;  7ICI A;  4IQT A;  4RQ3 A;  5HC9 A;  3HWT A;  5J0X A;  5HRI A;  5BOM A;  4RQ5 A;  5HRG A;  4KLO A;  3C2L A;  3PMN A;  1ZQA A;  4RT3 A;  3UXN A;  7ICS A;  4I2J A;  4I2H A;  5IIN A;  3AU6 A;  5HRH A;  2ZH7 A;  4QZ9 A;  4RT2 A;  4E7X A;  4E80 A;  2ZH8 A;  1UEV A;  9ICF A;  1RZT A;  5J0R A;  1JQR A;  4Z6F A;  1TVA A; 
#chains in the Genus database with same CATH topology
 4KLF A;  4JWM A;  5CFS A;  3C2K A;  7ICN A;  3HJ4 A;  4WC4 A;  5DKW A;  2DR7 A;  3MGH A;  4WQL A;  3JPP A;  4OAG A;  4NXT A;  1Q78 A;  4NM1 A;  1TV9 A;  4WBY A;  2ISP A;  9ICM A;  4X4V A;  1ZJN A;  4O9M A;  2B4V A;  2FMP A;  1MIV A;  4WC0 A;  4YCX A;  1PX5 A;  4M0A A;  4F5R A;  2DRA A;  5J2I A;  5III A;  4IQW A;  1ZQN A;  1KNY A;  2BCV A;  1KEJ A;  5J0S A;  2ZH2 A;  3MDC A;  9ICN A;  4R63 A;  4EGW A;  4K9A A;  4P4M A;  3OUY A;  9ICK A;  9ICO A;  4NXW A;  2ZHB A;  2BBH A;  4KLL A;  3AU2 A;  4Z6D A;  4RQ1 A;  4PH5 A;  4UAZ A;  4NXZ A;  3UXP A;  3WFO A;  1JAJ A;  3HJ1 A;  7ICM A;  9ICC A;  4P4O A;  4NLZ A;  4NM2 A;  9ICQ A;  2PFO A;  2M2W A;  3PHZ A;  1JN3 A;  2NRK A;  4NKT A;  5DB7 A;  1BPB A;  4NKU A;  1FA0 A;  3LQC B;  1TFY A;  5HR9 A;  9ICA A;  2M2T A;  4M5D A;  2ZH3 A;  1ZQL A;  1MIW A;  8ICU A;  4YMO A;  3C5G A;  4I28 A;  2M2V A;  2ZH5 A;  4AT8 B;  8ICQ A;  3JYY A;  4KM5 A;  5HRE A;  5DBA A;  1R8B A;  4WCW A;  5HRK A;  4X4O A;  4X4R A;  4AT8 A;  8ICI A;  8ICG A;  5CR0 A;  1ZQD A;  2BCR A;  4PHE A;  2FMQ A;  7ICU A;  4X4U A;  9ICG A;  3H38 A;  4K4G A;  3CK6 A;  1RPL A;  4XQ7 A;  5HHH A;  3EF2 A;  3JPR A;  4DOA A;  3MGI A;  1UEU A;  1BPZ A;  9ICU A;  4FH3 A;  1V4A A;  5BPC A;  1ZQC A;  3RH6 A;  4TUS A;  4RQ2 A;  3JPS A;  1ZQH A;  4RWP A;  8ICE A;  4UD5 A;  4QZC A;  1ZQR A;  1KDH A;  4R65 A;  5CHG A;  5J0Q A;  5J2F A;  9ICS A;  8ICJ A;  7ICR A;  8ICR A;  3JPT A;  2PFQ A;  4EP7 A;  3K75 D;  2W9M A;  4K98 A;  4EBK A;  4O6A A;  1MQ3 A;  8ICL A;  1BPX A;  3OWG A;  2ZH1 A;  4WOY A;  2IHM A;  4X4N A;  4I29 A;  2M2U A;  5IIJ A;  3RJH A;  4X4Q A;  1HUZ A;  2ISO A;  5DB9 A;  3V7K A;  2B51 A;  1UET A;  3WFR E;  5F2V O;  1ZQU A;  3V72 A;  5J0O A;  3OGU A;  4UB2 A;  4M47 A;  8ICX A;  3ER9 B;  5HRF A;  3OVB A;  5CP2 A;  2HN1 A;  4F5Q A;  1ZQM A;  7ICP A;  5CJ7 A;  5J2B A;  7ICH A;  4KLQ A;  4M9L A;  3RJE A;  3WFS C;  4I0U A;  3OVA A;  3LK9 A;  3NVO A;  4LEW A;  8ICP A;  2VAN A;  4X5V A;  3RJJ A;  4OAH A;  3TFS A;  4P4P A;  3HW8 A;  4RWQ A;  9ICB A;  1R8C A;  1XSP A;  5J0P A;  9ICJ A;  1BPE A;  4FHX A;  4HX0 A;  4UAY A;  1MQ2 A;  5DB8 A;  3WFP A;  4RWN A;  4K8V A;  8ICW A;  4Z6C A;  4RQ4 A;  3MDA A;  4GXI A;  8ICT A;  4QZG A;  4MFC A;  1NO5 A;  5CHE A;  1XSL A;  3OUY B;  5J2H A;  9ICV A;  7ICT A;  4F5O A;  2GAF D;  4KB6 A;  5IIO A;  1ZQP A;  1VJ7 A;  1ZQS A;  1BPY A;  4WC1 A;  4I2F A;  4X4S A;  4NLN A;  4KLU A;  1HUO A;  5CWR A;  2BCU A;  3AUO A;  8ICK A;  4I2E A;  1R8A A;  4F5N A;  3NYB A;  4RWO A;  2DVI A;  4FHW A;  4R66 A;  4XA5 A;  4RPX A;  5HRB A;  8ICB A;  3RJK A;  4K96 A;  2BBJ A;  5B3P A;  2BPG A;  3V7J A;  4PHD A;  5D4B A;  4EEB A;  7ICV A;  7ICE A;  4MFF A;  5JTG A;  1TFW A;  3MBY A;  4NXX A;  3ISC A;  4O69 A;  4PGY A;  5IIK A;  1OU5 A;  2ZH6 A;  5J0W A;  4DO9 A;  9ICT A;  4FH5 A;  5DBB A;  4FO6 A;  4Z6E A;  3HX0 A;  7ICJ A;  9ICR A;  3JPO A;  4KLG A;  4KLD A;  5DED A;  4M9N A;  9ICI A;  3AQK A;  2DRB A;  4WQK A;  3UQ0 A;  4WC3 A;  9ICH A;  4MFA A;  1WOT A;  1YLQ A;  1F5A A;  1ZQW A;  4UB4 A;  1ZQB A;  8ICN A;  8ICA A;  3C66 A;  5TZV A;  9ICP A;  1ZQT A;  4I2C A;  4KLI A;  4X0B A;  4UB5 A;  4WC5 A;  1XSN A;  2IUB A;  3PNC A;  2DR8 A;  8ICO A;  1ZQI A;  5D46 A;  1MIY A;  3ER8 C;  3K7D A;  2ZH9 A;  1ZQE A;  4EV6 A;  4X4T A;  4KLE A;  4KLH A;  5DDY A;  3C18 A;  4YN4 A;  3JPQ A;  3H3A A;  3L9D A;  4LVS A;  2B56 A;  5DDM A;  4TUR A;  5J29 A;  4NXV A;  5D63 A;  4O68 A;  4EBJ A;  3ISD A;  4PGX A;  4QZ8 A;  5BOL A;  1VFG A;  2BCQ A;  4K4I A;  4KLS A;  3PML A;  5J2C A;  4M9H A;  2RFF A;  3C5F A;  5IIM A;  3HIY A;  1ZQF A;  7ICL A;  4QZD A;  1ZQJ A;  4QZB A;  3RJF A;  4WC2 A;  4I2G A;  5HRD A;  8ICV A;  1JMS A;  4TUQ A;  9ICW A;  4UD4 A;  4I2D A;  5CA7 A;  3JZ0 A;  4PHP A;  3UPS A;  4XRH A;  4LEZ A;  4QZH A;  4JWN A;  4O5K A;  2BCS A;  4GXK A;  4WBZ A;  1Q79 A;  4WH5 A;  4M2Y A;  2ZH4 A;  5EOZ A;  1ZQX A;  5D49 A;  5J0Y A;  4I27 A;  3JCF A;  3ISB A;  4YMM A;  4GXJ A;  2P66 A;  5CB1 A;  4JLX A;  5CFT A;  7ICG A;  5J2E A;  4O67 A;  4MF2 A;  7ICK A;  4LZD A;  4MKP A;  2DR9 A;  4RQ0 A;  1ZQY A;  4OAI Z;  1ZQG A;  2GWS A;  9ICL A;  4WC7 A;  2BPC A;  5DB6 A;  5DEC A;  4LEY A;  4QZI A;  9ICE A;  4IQU A;  4PGQ A;  4K4H A;  3AQN A;  4XJE A;  4O5E A;  5IIL A;  4KLM A;  8ICS A;  5J2K A;  8ICY A;  4UBB A;  1ZQZ A;  3UQ2 A;  3WFQ E;  4MF8 A;  3UXO A;  5D62 A;  3UPQ A;  5B3Q A;  3RH4 A;  1ZQQ A;  2ZHA A;  4KLT A;  2GA9 D;  4X4P A;  4IQV A;  5J2J A;  4UB3 A;  4NY8 A;  4AT9 B;  4UB1 A;  3B0X A;  2HHP A;  1ZQK A;  3RH5 A;  2O1P A;  4AT9 A;  2I9G A;  7ICO A;  4DOB A;  4O5C A;  4ATB B;  4KLJ A;  3RJG A;  4RQ7 A;  4DOC A;  4ATB A;  4NXU A;  4K9B A;  4M04 A;  2O5A A;  5J2D A;  5CFU A;  4RPZ A;  4I2I A;  4PPX A;  3V7L A;  1NOM A;  8ICM A;  2HN2 A;  4WC6 A;  4XUS A;  3JPN A;  8ICZ A;  4QZE A;  4OAF A;  7ICQ A;  4FO1 A;  5DBC A;  4YD2 A;  4TUP A;  5HRL A;  5HHI A;  8ICH A;  1GPJ A;  4IG8 A;  4RQ8 A;  2PFP A;  5J2A A;  4FHY A;  4R64 A;  4YMN A;  1BPD A;  3B0Y A;  4N7R A;  2DR5 A;  5J0U A;  3AQL A;  3MCR A;  3NWI A;  3H39 A;  3OVS A;  2PFN A;  3AQM A;  5J2G A;  7ICF A;  3C2M A;  4QZA A;  4I2A A;  3H37 A;  4M9G A;  4EED A;  2Q66 A;  4NLK A;  4X0A A;  4S3N A;  4LT6 A;  4RQ6 A;  2PXI A;  4FHV A;  4QZF A;  3ERC C;  4F5P A;  3OV7 A;  4UAW A;  1ZQV A;  4RPY A;  5J0T A;  4XQ8 A;  4PHA A;  4K97 A;  2ID1 A;  3TFR A;  2BPF A;  2BE3 A;  3GDX A;  4FHP A;  3RJI A;  4E8F A;  4UBC A;  9ICX A;  1ZJM A;  4AT7 B;  4I2B A;  4P2H A;  4YD1 A;  1R89 A;  1ZQO A;  4AT7 A;  8ICC A;  2FMS A;  2PBE A;  4LEV A;  2FCL A;  4LZG A;  4M9J A;  8ICF A;  7ICI A;  4IQT A;  4RQ3 A;  5HC9 A;  2EWR A;  3HWT A;  5J0X A;  5HRI A;  5BOM A;  3NKU A;  4RQ5 A;  5HRG A;  4KLO A;  3C2L A;  3PMN A;  1ZQA A;  5D61 A;  4RT3 A;  3UXN A;  7ICS A;  4I2J A;  4I2H A;  5IIN A;  3AU6 A;  5HRH A;  2ZH7 A;  4QZ9 A;  4K99 A;  4RT2 A;  2IHO A;  4E7X A;  4E80 A;  2ZH8 A;  1UEV A;  9ICF A;  1RZT A;  5J0R A;  4JLZ A;  1JQR A;  4Z6F A;  1TVA A; 
#chains in the Genus database with same CATH homology
 4KLF A;  4JWM A;  3C2K A;  7ICN A;  3HJ4 A;  4WC4 A;  5DKW A;  2DR7 A;  3MGH A;  3JPP A;  1Q78 A;  4NM1 A;  1TV9 A;  4WBY A;  2ISP A;  9ICM A;  4X4V A;  1ZJN A;  4O9M A;  2FMP A;  1MIV A;  4WC0 A;  4YCX A;  1PX5 A;  4M0A A;  4F5R A;  2DRA A;  5J2I A;  5III A;  4IQW A;  1ZQN A;  1KNY A;  2BCV A;  1KEJ A;  5J0S A;  2ZH2 A;  3MDC A;  9ICN A;  4R63 A;  4P4M A;  3OUY A;  9ICK A;  9ICO A;  2ZHB A;  4KLL A;  3AU2 A;  4Z6D A;  4RQ1 A;  4PH5 A;  4UAZ A;  4NXZ A;  3UXP A;  3WFO A;  1JAJ A;  3HJ1 A;  7ICM A;  9ICC A;  4P4O A;  4NLZ A;  4NM2 A;  9ICQ A;  2PFO A;  2M2W A;  1JN3 A;  2NRK A;  4NKT A;  5DB7 A;  1BPB A;  4NKU A;  1FA0 A;  3LQC B;  1TFY A;  5HR9 A;  9ICA A;  2M2T A;  4M5D A;  2ZH3 A;  1ZQL A;  1MIW A;  8ICU A;  4YMO A;  3C5G A;  4I28 A;  2M2V A;  2ZH5 A;  4AT8 B;  8ICQ A;  3JYY A;  5HRE A;  5DBA A;  1R8B A;  4WCW A;  5HRK A;  4X4O A;  4X4R A;  4AT8 A;  8ICI A;  8ICG A;  5CR0 A;  1ZQD A;  2BCR A;  4PHE A;  2FMQ A;  7ICU A;  4X4U A;  9ICG A;  3H38 A;  4K4G A;  1RPL A;  4XQ7 A;  5HHH A;  3JPR A;  4DOA A;  3MGI A;  1UEU A;  1BPZ A;  9ICU A;  4FH3 A;  1V4A A;  5BPC A;  1ZQC A;  3RH6 A;  4TUS A;  4RQ2 A;  3JPS A;  1ZQH A;  4RWP A;  8ICE A;  4UD5 A;  4QZC A;  1ZQR A;  1KDH A;  4R65 A;  5CHG A;  5J0Q A;  5J2F A;  9ICS A;  8ICJ A;  7ICR A;  8ICR A;  3JPT A;  2PFQ A;  4EP7 A;  3K75 D;  2W9M A;  4EBK A;  1MQ3 A;  8ICL A;  1BPX A;  2ZH1 A;  2IHM A;  4X4N A;  4I29 A;  2M2U A;  5IIJ A;  3RJH A;  4X4Q A;  1HUZ A;  2ISO A;  5DB9 A;  3V7K A;  1UET A;  3WFR E;  5F2V O;  1ZQU A;  3V72 A;  5J0O A;  3OGU A;  4UB2 A;  4M47 A;  8ICX A;  5HRF A;  3OVB A;  5CP2 A;  4F5Q A;  1ZQM A;  7ICP A;  5CJ7 A;  5J2B A;  7ICH A;  4KLQ A;  4M9L A;  3RJE A;  3WFS C;  3OVA A;  3LK9 A;  8ICP A;  2VAN A;  4X5V A;  3RJJ A;  3TFS A;  4P4P A;  3HW8 A;  4RWQ A;  9ICB A;  1R8C A;  1XSP A;  5J0P A;  9ICJ A;  1BPE A;  4FHX A;  4UAY A;  1MQ2 A;  5DB8 A;  3WFP A;  4RWN A;  8ICW A;  4Z6C A;  4RQ4 A;  3MDA A;  4GXI A;  8ICT A;  4QZG A;  4MFC A;  1NO5 A;  1XSL A;  3OUY B;  5J2H A;  9ICV A;  7ICT A;  4F5O A;  5IIO A;  1ZQP A;  1VJ7 A;  1ZQS A;  1BPY A;  4WC1 A;  4I2F A;  4X4S A;  4NLN A;  4KLU A;  1HUO A;  5CWR A;  2BCU A;  3AUO A;  8ICK A;  4I2E A;  1R8A A;  4F5N A;  3NYB A;  4RWO A;  2DVI A;  4FHW A;  4R66 A;  4XA5 A;  4RPX A;  5HRB A;  8ICB A;  3RJK A;  2BPG A;  3V7J A;  4PHD A;  5D4B A;  7ICV A;  7ICE A;  4MFF A;  1TFW A;  3MBY A;  3ISC A;  4PGY A;  5IIK A;  1OU5 A;  2ZH6 A;  5J0W A;  4DO9 A;  9ICT A;  4FH5 A;  5DBB A;  4FO6 A;  4Z6E A;  3HX0 A;  7ICJ A;  9ICR A;  3JPO A;  4KLG A;  4KLD A;  5DED A;  4M9N A;  9ICI A;  3AQK A;  2DRB A;  3UQ0 A;  4WC3 A;  9ICH A;  4MFA A;  1WOT A;  1YLQ A;  1F5A A;  1ZQW A;  4UB4 A;  1ZQB A;  8ICN A;  8ICA A;  3C66 A;  5TZV A;  9ICP A;  1ZQT A;  4I2C A;  4KLI A;  4X0B A;  4UB5 A;  4WC5 A;  1XSN A;  2DR8 A;  3PNC A;  8ICO A;  1ZQI A;  5D46 A;  1MIY A;  2ZH9 A;  1ZQE A;  4X4T A;  4KLE A;  4KLH A;  5DDY A;  3C18 A;  4YN4 A;  3JPQ A;  3H3A A;  3L9D A;  4LVS A;  5DDM A;  4TUR A;  5J29 A;  4EBJ A;  3ISD A;  4PGX A;  4QZ8 A;  5BOL A;  1VFG A;  2BCQ A;  4K4I A;  4KLS A;  3PML A;  5J2C A;  4M9H A;  2RFF A;  3C5F A;  5IIM A;  3HIY A;  1ZQF A;  7ICL A;  4QZD A;  1ZQJ A;  4QZB A;  3RJF A;  4WC2 A;  4I2G A;  5HRD A;  8ICV A;  1JMS A;  4TUQ A;  9ICW A;  4UD4 A;  4I2D A;  5CA7 A;  3JZ0 A;  4PHP A;  3UPS A;  4XRH A;  4QZH A;  4JWN A;  4O5K A;  2BCS A;  4GXK A;  4WBZ A;  1Q79 A;  4M2Y A;  2ZH4 A;  5EOZ A;  1ZQX A;  5D49 A;  5J0Y A;  4I27 A;  3ISB A;  4YMM A;  4GXJ A;  2P66 A;  5CB1 A;  7ICG A;  5J2E A;  4MF2 A;  7ICK A;  4LZD A;  2DR9 A;  4RQ0 A;  1ZQY A;  1ZQG A;  2GWS A;  9ICL A;  4WC7 A;  2BPC A;  5DB6 A;  5DEC A;  4QZI A;  9ICE A;  4IQU A;  4PGQ A;  4K4H A;  3AQN A;  4O5E A;  5IIL A;  4KLM A;  8ICS A;  5J2K A;  8ICY A;  4UBB A;  1ZQZ A;  3UQ2 A;  3WFQ E;  4MF8 A;  3UXO A;  3UPQ A;  3RH4 A;  1ZQQ A;  2ZHA A;  4KLT A;  4X4P A;  4IQV A;  5J2J A;  4UB3 A;  4NY8 A;  4AT9 B;  4UB1 A;  3B0X A;  2HHP A;  1ZQK A;  3RH5 A;  2O1P A;  4AT9 A;  2I9G A;  7ICO A;  4DOB A;  4O5C A;  4ATB B;  4KLJ A;  3RJG A;  4RQ7 A;  4DOC A;  4ATB A;  4M04 A;  2O5A A;  5J2D A;  4RPZ A;  4I2I A;  4PPX A;  3V7L A;  1NOM A;  8ICM A;  4WC6 A;  4XUS A;  3JPN A;  8ICZ A;  4QZE A;  7ICQ A;  5DBC A;  4YD2 A;  4TUP A;  5HRL A;  5HHI A;  8ICH A;  4IG8 A;  4RQ8 A;  2PFP A;  5J2A A;  4FHY A;  4R64 A;  4YMN A;  1BPD A;  3B0Y A;  2DR5 A;  5J0U A;  3AQL A;  3H39 A;  3OVS A;  2PFN A;  3AQM A;  5J2G A;  7ICF A;  3C2M A;  4QZA A;  4I2A A;  3H37 A;  4M9G A;  2Q66 A;  4NLK A;  4X0A A;  4S3N A;  4LT6 A;  4RQ6 A;  2PXI A;  4FHV A;  4QZF A;  4F5P A;  3OV7 A;  4UAW A;  1ZQV A;  4RPY A;  5J0T A;  4XQ8 A;  4PHA A;  2ID1 A;  3TFR A;  2BPF A;  2BE3 A;  3GDX A;  4FHP A;  3RJI A;  4E8F A;  4UBC A;  9ICX A;  1ZJM A;  4AT7 B;  4I2B A;  4P2H A;  4YD1 A;  1R89 A;  1ZQO A;  4AT7 A;  8ICC A;  2FMS A;  2PBE A;  4LZG A;  4M9J A;  8ICF A;  7ICI A;  4IQT A;  4RQ3 A;  5HC9 A;  3HWT A;  5J0X A;  5HRI A;  5BOM A;  4RQ5 A;  5HRG A;  4KLO A;  3C2L A;  3PMN A;  1ZQA A;  4RT3 A;  3UXN A;  7ICS A;  4I2J A;  4I2H A;  5IIN A;  3AU6 A;  5HRH A;  2ZH7 A;  4QZ9 A;  4RT2 A;  4E7X A;  4E80 A;  2ZH8 A;  1UEV A;  9ICF A;  1RZT A;  5J0R A;  1JQR A;  4Z6F A;  1TVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...