5HRIA

The crystal structure of asfvpolx:dna1 binary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
GMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of AsfvPolX: 1nt-gap(P) DNA1: dGTP ternary complex.
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 46
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hriA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hriA01
4WBYA 2HHPA 3UQ0A 8ICMA 4QZBA 5HC9A 5BPCA 2VANA 1R8BA 3ISBA 1ZQOA 5J2EA 4KLLA 4LZDA 4GXJA 4NXZA 2PFOA 8ICRA 3L9DA 3OUYA 2BCSA 4M0AA 3B0YA 4R65A 3RH4A 2ID1A 2GWSA 4FHVA 4WCWA 8ICGA 4NM2A 1MIWA 4RQ4A 1ZQRA 4UD4A 4F5OA 3WFPA 3RJJA 2ISOA 1TFWA 2PFQA 4XUSA 2ZH7A 4M47A 1UETA 5IINA 4ATBA 1ZQQA 4F5QA 1ZJNA 2M2UA 9ICEA 4O5EA 4P4PA 1NO5A 4QZFA 4O5CA 1MIYA 2M2TA 3MGHA 3JPTA 5CA7A 2DR8A 3HW8A 5J2IA 7ICEA 4X0BA 4UD5A 1BPDA 8ICEA 2FMPA 1F5AA 8ICSA 1V4AA 4NLNA 5IIJA 3V7KA 4K4GA 4ATBB 4UB1A 5DEDA 4O9MA 5J2BA 2DR5A 9ICNA 2ISPA 1JAJA 1ZQMA 2FMSA 2O1PA 2BPGA 1XSNA 4MFAA 1ZQIA 4QZ9A 8ICYA 4Z6CA 4TUSA 3ISCA 1JQRA 4MFCA 2P66A 1KNYA 3C2MA 4WC4A 5J0UA 5DKWA 4X4RA 4WC3A 1TV9A 4MF2A 4QZEA 4M9NA 4RQ3A 3JPOA 8ICFA 4X4OA 5J0PA 4X4QA 5J2DA 3ISDA 1Q78A 4I27A 5D46A 5J0QA 7ICOA 2DVIA 5HRFA 5F2VO 2NRKA 3OVBA 4NLZA 1BPEA 9ICQA 1BPYA 4AT7A 3OV7A 4EP7A 7ICFA 8ICPA 4YMMA 4WBZA 5J0YA 5CJ7A 4X4UA 3AUOA 9ICCA 4QZIA 4I28A 9ICSA 8ICQA 8ICUA 4O5KA 5IIIA 3WFQE 4DOAA 4PHAA 3RJFA 5J2GA 4AT8B 3JYYA 5J2CA 8ICTA 4P2HA 5D49A 3H39A 4QZ8A 4RQ8A 5J2HA 4KLGA 8ICIA 4PGXA 4E80A 5J0WA 5HRGA 3B0XA 2BCQA 4M9LA 4FHXA 1ZQCA 1ZQKA 4X4VA 5J0XA 3JPSA 4EBKA 3JPPA 4GXIA 7ICUA 8ICKA 3LQCB 4RWPA 4R64A 4IQUA 5CWRA 4PPXA 2Q66A 1ZQWA 4RQ7A 5IIOA 9ICOA 2ZH1A 3WFSC 1ZQEA 8ICHA 4WC7A 5HR9A 4I2DA 4UAZA 8ICCA 4KLIA 1ZQAA 8ICZA 3UXPA 4RWNA 4KLHA 4IG8A 4M9GA 8ICJA 3JZ0A 2ZH2A 4I2BA 4F5NA 2DR9A 4JWNA 4YCXA 3RJHA 7ICHA 3OUYB 1JN3A 1ZQUA 4PHEA 2DR7A 5DDMA 4I2HA 4X4NA 4R63A 5BOMA 4TUQA 3MDCA 4X5VA 4QZCA 4YD2A 4QZHA 1TFYA 5HHHA 1HUOA 1FA0A 1ZQJA 4UBCA 3RH6A 2FMQA 4M9JA 9ICFA 1ZQGA 4RT3A 5J29A 2IHMA 4UB2A 2I9GA 4YN4A 9ICVA 4I2EA 9ICJA 4NM1A 8ICAA 7ICPA 4XRHA 2DRAA 9ICWA 3RJGA 4LVSA 4RWQA 4UAYA 5DB6A 4Z6DA 4KLMA 5HRKA 2PFNA 4NY8A 4LZGA 4X4SA 4NKTA 3AU2A 4RPYA 3C18A 4S3NA 4KLOA 8ICXA 7ICVA 1MIVA 1ZJMA 7ICGA 2ZH4A 4NLKA 4XA5A 9ICBA 4AT9A 2RFFA 9ICPA 4RQ5A 4P4OA 2PBEA 5J0SA 3H3AA 8ICVA 3AU6A 1ZQXA 5J2FA 5D4BA 1ZQPA 8ICOA 1R8CA 4RPZA 4PHDA 4DO9A 5J2JA 4KLDA 2M2VA 7ICLA 4TUPA 3PNCA 1BPZA 3HIYA 4XQ8A 3K75D 4F5PA 3GDXA 7ICSA 4FH3A 4RT2A 4JWMA 4QZGA 3OVAA 5CB1A 1YLQA 2BPCA 1HUZA 9ICGA 4DOBA 4K4HA 1Q79A 1ZQFA 4KLJA 3HJ1A 2ZHAA 1KEJA 3H37A 4RQ2A 4FO6A 3C66A 9ICXA 1MQ3A 5DB9A 3PMNA 7ICMA 3UXNA 5HHIA 2ZH5A 3JPRA 4R66A 7ICRA 4NKUA 3UPSA 4I2AA 4QZDA 4AT7B 4FHYA 1ZQLA 4PHPA 4M9HA 9ICUA 9ICKA 4KLQA 5HRHA 3MDAA 8ICWA 5CP2A 1UEUA 3WFOA 4WC6A 3V7LA 7ICKA 3PMLA 8ICLA 5DB8A 8ICNA 9ICAA 7ICIA 5HRIA 4LT6A 7ICJA 9ICHA 4FH5A 3H38A 3WFRE 1UEVA 3UXOA 5DBBA 4UAWA 4GXKA 4QZAA 3HJ4A 5HRDA 1XSPA 3AQKA 4FHPA 4EBJA 4UB4A 4RQ0A 4UB3A 4PH5A 1TVAA 2BCUA 1VFGA 4RWOA 4KLFA 5DB7A 1KDHA 4KLEA 4WC0A 5CR0A 4YMNA 3V72A 2W9MA 2PXIA 5J2KA 5HRLA 1VJ7A 4Z6FA 2ZH6A 2ZH3A 2O5AA 4RQ1A 1OU5A 3TFRA 4I2FA 3LK9A 4IQWA 4E7XA 4IQVA 4IQTA 1WOTA 1ZQVA 4I2JA 9ICRA 1RZTA 4KLSA 3JPQA 4RPXA 5IILA 2ZHBA 4UBBA 4I2GA 5IIKA 1JMSA 5J0RA 2BE3A 4PGQA 5DBCA 5BOLA 4M04A 5TZVA 4F5RA 2BCVA 3UQ2A 3RJEA 4Z6EA 4KLUA 5DDYA 1PX5A 3TFSA 1ZQZA 4WC1A 9ICMA 4K4IA 1R89A 5J2AA 9ICIA 3UPQA 7ICTA 3HX0A 1ZQHA 5J0OA 5EOZA 8ICBA 5DECA 3C2KA 9ICTA 1ZQYA 4YMOA 4P4MA 4I2CA 3OVSA 4WC2A 2ZH9A 4FHWA 4M5DA 3C5GA 5HREA 1RPLA 3RJKA 4I2IA 3RH5A 3HWTA 9ICLA 4M2YA 7ICQA 3C5FA 3AQNA 2BCRA 2DRBA 3OGUA 1ZQNA 5IIMA 1ZQDA 4RQ6A 4UB5A 5J0TA 1ZQTA 4X4TA 3MBYA 1ZQSA 4DOCA 3V7JA 4WC5A 4AT9B 4MFFA 3AQLA 1ZQBA 4TURA 5HRBA 4PGYA 4AT8A 2M2WA 1R8AA 5CHGA 4KLTA 4X0AA 7ICNA 1MQ2A 4YD1A 3C2LA 2BPFA 3AQMA 2PFPA 3JPNA 4X4PA 1XSLA 3RJIA 1BPBA 4XQ7A 1BPXA 4I29A 4E8FA 3MGIA 2ZH8A 4MF8A 5DBAA 3NYBA 1NOMA
chains in the Genus database with same CATH superfamily
4WBYA 2HHPA 3NVOA 3UQ0A 8ICMA 4QZBA 5HC9A 5BPCA 4NXXA 2VANA 1R8BA 3ISBA 2BBHA 1ZQOA 5J2EA 4KLLA 4LZDA 4GXJA 4NXZA 1GPJA 2PFOA 8ICRA 3L9DA 3OUYA 2BCSA 4M0AA 3B0YA 4R65A 3RH4A 2ID1A 2GWSA 4FHVA 4WCWA 8ICGA 2BBJA 4NM2A 1MIWA 4RQ4A 3PHZA 1ZQRA 4UD4A 4F5OA 3WFPA 3RJJA 2ISOA 1TFWA 2PFQA 4XUSA 2ZH7A 4K9BA 4M47A 1UETA 5IINA 4ATBA 3ER8C 1ZQQA 4F5QA 1ZJNA 2M2UA 9ICEA 4O5EA 4P4PA 1NO5A 4QZFA 4O5CA 1MIYA 4EEDA 5D62A 2M2TA 3MGHA 3JPTA 5CA7A 2DR8A 3HW8A 5J2IA 7ICEA 4X0BA 4UD5A 1BPDA 8ICEA 4FO1A 2FMPA 1F5AA 8ICSA 1V4AA 4NLNA 5IIJA 3V7KA 4K4GA 4ATBB 4UB1A 5DEDA 4O9MA 4JLXA 5J2BA 2DR5A 9ICNA 4WH5A 2ISPA 3CK6A 1JAJA 1ZQMA 2FMSA 2O1PA 2BPGA 1XSNA 4MFAA 4WOYA 1ZQIA 4QZ9A 8ICYA 4Z6CA 4TUSA 3ISCA 1JQRA 4MFCA 2P66A 1KNYA 4O69A 3C2MA 4WC4A 5J0UA 5DKWA 4X4RA 4WC3A 1TV9A 4MF2A 4QZEA 4M9NA 3ER9B 4LEZA 4RQ3A 3JPOA 8ICFA 4X4OA 5J0PA 2B51A 4X4QA 4O6AA 5J2DA 3ISDA 1Q78A 4I27A 5D46A 5J0QA 7ICOA 4OAIZ 2DVIA 5HRFA 5F2VO 2NRKA 3OVBA 4NLZA 1BPEA 9ICQA 1BPYA 4AT7A 3OV7A 4EP7A 7ICFA 8ICPA 4YMMA 4WBZA 5J0YA 5CJ7A 4X4UA 3AUOA 9ICCA 4QZIA 4I28A 9ICSA 8ICQA 8ICUA 4N7RA 4O5KA 5IIIA 3WFQE 4DOAA 3NKUA 4PHAA 3RJFA 5J2GA 4AT8B 3JYYA 5J2CA 8ICTA 4P2HA 5D49A 5CFUA 3H39A 4QZ8A 4O68A 4RQ8A 5JTGA 5J2HA 4K98A 4KLGA 8ICIA 5CFSA 4PGXA 4E80A 5J0WA 5HRGA 3B0XA 2BCQA 4M9LA 3NWIA 1ZQCA 4FHXA 1ZQKA 4X4VA 5J0XA 3JPSA 4EBKA 4EGWA 3JPPA 4GXIA 7ICUA 8ICKA 3LQCB 4RWPA 4R64A 4IQUA 5CWRA 4I0UA 4PPXA 2Q66A 1ZQWA 4RQ7A 5IIOA 9ICOA 5CFTA 2ZH1A 3WFSC 1ZQEA 8ICHA 4WC7A 5HR9A 4I2DA 4UAZA 8ICCA 4KLIA 1ZQAA 8ICZA 3UXPA 4NXWA 2GAFD 4RWNA 4KLHA 4IG8A 4OAHA 4M9GA 8ICJA 3JZ0A 2ZH2A 4I2BA 4F5NA 2DR9A 4JWNA 4YCXA 3RJHA 4LEWA 7ICHA 3OUYB 1JN3A 1ZQUA 4PHEA 2DR7A 5DDMA 4I2HA 4X4NA 4R63A 4EEBA 4K96A 5BOMA 4TUQA 3MDCA 4X5VA 4QZCA 4YD2A 3JCFA 4QZHA 1TFYA 5HHHA 1HUOA 1FA0A 4OAGA 4LEYA 1ZQJA 4UBCA 3RH6A 4NXUA 2FMQA 2B4VA 4M9JA 9ICFA 1ZQGA 4RT3A 5J29A 2IHMA 4UB2A 2I9GA 4YN4A 9ICVA 4I2EA 9ICJA 3K7DA 3EF2A 4NM1A 4HX0A 8ICAA 7ICPA 4XRHA 2DRAA 9ICWA 3RJGA 4LVSA 4RWQA 4UAYA 5DB6A 4Z6DA 4KLMA 5HRKA 2PFNA 4NY8A 4LZGA 4X4SA 4KB6A 4NKTA 3AU2A 4RPYA 3C18A 4S3NA 4K9AA 4KLOA 8ICXA 7ICVA 1MIVA 1ZJMA 7ICGA 2ZH4A 4NLKA 4XA5A 9ICBA 4AT9A 2RFFA 9ICPA 4RQ5A 4P4OA 2PBEA 5J0SA 3H3AA 8ICVA 3AU6A 1ZQXA 5J2FA 2HN1A 4K99A 5D4BA 1ZQPA 8ICOA 1R8CA 4RPZA 3OWGA 4PHDA 4DO9A 5B3PA 5J2JA 4KLDA 2M2VA 7ICLA 4TUPA 3PNCA 1BPZA 3HIYA 4XQ8A 3K75D 4F5PA 3GDXA 7ICSA 4FH3A 4RT2A 4JWMA 4QZGA 5B3QA 3OVAA 5CB1A 1YLQA 2BPCA 1HUZA 9ICGA 4DOBA 4K4HA 1Q79A 1ZQFA 4KLJA 3HJ1A 5CHEA 2ZHAA 1KEJA 3H37A 4O67A 4RQ2A 5D61A 4FO6A 3C66A 9ICXA 1MQ3A 4XJEA 5DB9A 3PMNA 7ICMA 3UXNA 5HHIA 2ZH5A 3JPRA 4R66A 7ICRA 4NKUA 3UPSA 4I2AA 4QZDA 4AT7B 4FHYA 1ZQLA 4PHPA 4M9HA 4WQLA 4JLZA 9ICUA 9ICKA 4KLQA 5HRHA 3MDAA 8ICWA 5CP2A 1UEUA 3WFOA 4WC6A 3V7LA 7ICKA 4KM5A 3PMLA 8ICLA 5DB8A 8ICNA 9ICAA 7ICIA 4LEVA 5HRIA 4LT6A 7ICJA 3MCRA 9ICHA 2HN2A 4FH5A 3H38A 3WFRE 1UEVA 3UXOA 5DBBA 4UAWA 4NXTA 4GXKA 4QZAA 3HJ4A 5HRDA 1XSPA 3AQKA 2FCLA 4FHPA 4EBJA 4UB4A 4RQ0A 2EWRA 4UB3A 4PH5A 1TVAA 2BCUA 1VFGA 4RWOA 2IUBA 4KLFA 5DB7A 1KDHA 4KLEA 4EV6A 4WC0A 5CR0A 4YMNA 3V72A 2W9MA 2PXIA 5J2KA 5HRLA 1VJ7A 4Z6FA 2ZH6A 2ZH3A 2O5AA 4RQ1A 1OU5A 3TFRA 4I2FA 3LK9A 4IQWA 4E7XA 4IQVA 4WQKA 4OAFA 4IQTA 1WOTA 1ZQVA 4I2JA 9ICRA 1RZTA 4KLSA 3JPQA 4RPXA 5IILA 4MKPA 2ZHBA 4UBBA 4I2GA 5IIKA 1JMSA 5J0RA 2GA9D 2BE3A 4PGQA 4K8VA 5DBCA 5BOLA 4M04A 5TZVA 4F5RA 2BCVA 3UQ2A 3ERCC 3RJEA 4Z6EA 4KLUA 5DDYA 1PX5A 3TFSA 1ZQZA 4WC1A 9ICMA 4K4IA 1R89A 5J2AA 9ICIA 3UPQA 7ICTA 3HX0A 1ZQHA 5J0OA 5EOZA 8ICBA 5DECA 3C2KA 9ICTA 1ZQYA 4YMOA 4P4MA 4I2CA 3OVSA 4WC2A 2ZH9A 4FHWA 4M5DA 3C5GA 4NXVA 5HREA 1RPLA 3RJKA 4I2IA 3RH5A 3HWTA 9ICLA 4M2YA 7ICQA 3C5FA 3AQNA 2BCRA 2DRBA 3OGUA 1ZQNA 4K97A 5IIMA 1ZQDA 4RQ6A 4UB5A 5J0TA 1ZQTA 4X4TA 3MBYA 1ZQSA 4DOCA 3V7JA 4WC5A 4AT9B 4MFFA 3AQLA 1ZQBA 4TURA 5D63A 5HRBA 4PGYA 4AT8A 2M2WA 1R8AA 5CHGA 4KLTA 4X0AA 7ICNA 1MQ2A 4YD1A 3C2LA 2BPFA 2IHOA 3AQMA 2PFPA 2B56A 3JPNA 4X4PA 1XSLA 3RJIA 1BPBA 4XQ7A 1BPXA 4I29A 4E8FA 3MGIA 2ZH8A 4MF8A 5DBAA 3NYBA 1NOMA
chains in the Genus database with same CATH topology
4WBYA 2HHPA 3UQ0A 8ICMA 4QZBA 5HC9A 5BPCA 2VANA 1R8BA 3ISBA 1ZQOA 5J2EA 4KLLA 4LZDA 4GXJA 4NXZA 2PFOA 8ICRA 3L9DA 3OUYA 2BCSA 4M0AA 3B0YA 4R65A 3RH4A 2ID1A 2GWSA 4FHVA 4WCWA 8ICGA 4NM2A 1MIWA 4RQ4A 1ZQRA 4UD4A 4F5OA 3WFPA 3RJJA 2ISOA 1TFWA 2PFQA 4XUSA 2ZH7A 4M47A 1UETA 5IINA 4ATBA 1ZQQA 4F5QA 1ZJNA 2M2UA 9ICEA 4O5EA 4P4PA 1NO5A 4QZFA 4O5CA 1MIYA 2M2TA 3MGHA 3JPTA 5CA7A 2DR8A 3HW8A 5J2IA 7ICEA 4X0BA 4UD5A 1BPDA 8ICEA 2FMPA 1F5AA 8ICSA 1V4AA 4NLNA 5IIJA 3V7KA 4K4GA 4ATBB 4UB1A 5DEDA 4O9MA 5J2BA 2DR5A 9ICNA 2ISPA 1JAJA 1ZQMA 2FMSA 2O1PA 2BPGA 1XSNA 4MFAA 1ZQIA 4QZ9A 8ICYA 4Z6CA 4TUSA 3ISCA 1JQRA 4MFCA 2P66A 1KNYA 3C2MA 4WC4A 5J0UA 5DKWA 4X4RA 4WC3A 1TV9A 4MF2A 4QZEA 4M9NA 4RQ3A 3JPOA 8ICFA 4X4OA 5J0PA 4X4QA 5J2DA 3ISDA 1Q78A 4I27A 5D46A 5J0QA 7ICOA 2DVIA 5HRFA 5F2VO 2NRKA 3OVBA 4NLZA 1BPEA 9ICQA 1BPYA 4AT7A 3OV7A 4EP7A 7ICFA 8ICPA 4YMMA 4WBZA 5J0YA 5CJ7A 4X4UA 3AUOA 9ICCA 4QZIA 4I28A 9ICSA 8ICQA 8ICUA 4O5KA 5IIIA 3WFQE 4DOAA 4PHAA 3RJFA 5J2GA 4AT8B 3JYYA 5J2CA 8ICTA 4P2HA 5D49A 3H39A 4QZ8A 4RQ8A 5J2HA 4KLGA 8ICIA 4PGXA 4E80A 5J0WA 5HRGA 3B0XA 2BCQA 4M9LA 4FHXA 1ZQCA 1ZQKA 4X4VA 5J0XA 3JPSA 4EBKA 3JPPA 4GXIA 7ICUA 8ICKA 3LQCB 4RWPA 4R64A 4IQUA 5CWRA 4PPXA 2Q66A 1ZQWA 4RQ7A 5IIOA 9ICOA 2ZH1A 3WFSC 1ZQEA 8ICHA 4WC7A 5HR9A 4I2DA 4UAZA 8ICCA 4KLIA 1ZQAA 8ICZA 3UXPA 4RWNA 4KLHA 4IG8A 4M9GA 8ICJA 3JZ0A 2ZH2A 4I2BA 4F5NA 2DR9A 4JWNA 4YCXA 3RJHA 7ICHA 3OUYB 1JN3A 1ZQUA 4PHEA 2DR7A 5DDMA 4I2HA 4X4NA 4R63A 5BOMA 4TUQA 3MDCA 4X5VA 4QZCA 4YD2A 4QZHA 1TFYA 5HHHA 1HUOA 1FA0A 1ZQJA 4UBCA 3RH6A 2FMQA 4M9JA 9ICFA 1ZQGA 4RT3A 5J29A 2IHMA 4UB2A 2I9GA 4YN4A 9ICVA 4I2EA 9ICJA 4NM1A 8ICAA 7ICPA 4XRHA 2DRAA 9ICWA 3RJGA 4LVSA 4RWQA 4UAYA 5DB6A 4Z6DA 4KLMA 5HRKA 2PFNA 4NY8A 4LZGA 4X4SA 4NKTA 3AU2A 4RPYA 3C18A 4S3NA 4KLOA 8ICXA 7ICVA 1MIVA 1ZJMA 7ICGA 2ZH4A 4NLKA 4XA5A 9ICBA 4AT9A 2RFFA 9ICPA 4RQ5A 4P4OA 2PBEA 5J0SA 3H3AA 8ICVA 3AU6A 1ZQXA 5J2FA 5D4BA 1ZQPA 8ICOA 1R8CA 4RPZA 4PHDA 4DO9A 5J2JA 4KLDA 2M2VA 7ICLA 4TUPA 3PNCA 1BPZA 3HIYA 4XQ8A 3K75D 4F5PA 3GDXA 7ICSA 4FH3A 4RT2A 4JWMA 4QZGA 3OVAA 5CB1A 1YLQA 2BPCA 1HUZA 9ICGA 4DOBA 4K4HA 1Q79A 1ZQFA 4KLJA 3HJ1A 2ZHAA 1KEJA 3H37A 4RQ2A 4FO6A 3C66A 9ICXA 1MQ3A 5DB9A 3PMNA 7ICMA 3UXNA 5HHIA 2ZH5A 3JPRA 4R66A 7ICRA 4NKUA 3UPSA 4I2AA 4QZDA 4AT7B 4FHYA 1ZQLA 4PHPA 4M9HA 9ICUA 9ICKA 4KLQA 5HRHA 3MDAA 8ICWA 5CP2A 1UEUA 3WFOA 4WC6A 3V7LA 7ICKA 3PMLA 8ICLA 5DB8A 8ICNA 9ICAA 7ICIA 5HRIA 4LT6A 7ICJA 9ICHA 4FH5A 3H38A 3WFRE 1UEVA 3UXOA 5DBBA 4UAWA 4GXKA 4QZAA 3HJ4A 5HRDA 1XSPA 3AQKA 4FHPA 4EBJA 4UB4A 4RQ0A 4UB3A 4PH5A 1TVAA 2BCUA 1VFGA 4RWOA 4KLFA 5DB7A 1KDHA 4KLEA 4WC0A 5CR0A 4YMNA 3V72A 2W9MA 2PXIA 5J2KA 5HRLA 1VJ7A 4Z6FA 2ZH6A 2ZH3A 2O5AA 4RQ1A 1OU5A 3TFRA 4I2FA 3LK9A 4IQWA 4E7XA 4IQVA 4IQTA 1WOTA 1ZQVA 4I2JA 9ICRA 1RZTA 4KLSA 3JPQA 4RPXA 5IILA 2ZHBA 4UBBA 4I2GA 5IIKA 1JMSA 5J0RA 2BE3A 4PGQA 5DBCA 5BOLA 4M04A 5TZVA 4F5RA 2BCVA 3UQ2A 3RJEA 4Z6EA 4KLUA 5DDYA 1PX5A 3TFSA 1ZQZA 4WC1A 9ICMA 4K4IA 1R89A 5J2AA 9ICIA 3UPQA 7ICTA 3HX0A 1ZQHA 5J0OA 5EOZA 8ICBA 5DECA 3C2KA 9ICTA 1ZQYA 4YMOA 4P4MA 4I2CA 3OVSA 4WC2A 2ZH9A 4FHWA 4M5DA 3C5GA 5HREA 1RPLA 3RJKA 4I2IA 3RH5A 3HWTA 9ICLA 4M2YA 7ICQA 3C5FA 3AQNA 2BCRA 2DRBA 3OGUA 1ZQNA 5IIMA 1ZQDA 4RQ6A 4UB5A 5J0TA 1ZQTA 4X4TA 3MBYA 1ZQSA 4DOCA 3V7JA 4WC5A 4AT9B 4MFFA 3AQLA 1ZQBA 4TURA 5HRBA 4PGYA 4AT8A 2M2WA 1R8AA 5CHGA 4KLTA 4X0AA 7ICNA 1MQ2A 4YD1A 3C2LA 2BPFA 3AQMA 2PFPA 3JPNA 4X4PA 1XSLA 3RJIA 1BPBA 4XQ7A 1BPXA 4I29A 4E8FA 3MGIA 2ZH8A 4MF8A 5DBAA 3NYBA 1NOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBY A;  2HHP A;  3UQ0 A;  8ICM A;  4QZB A;  5HC9 A;  5BPC A;  2VAN A;  1R8B A;  3ISB A;  1ZQO A;  5J2E A;  4KLL A;  4LZD A;  4GXJ A;  4NXZ A;  2PFO A;  8ICR A;  3L9D A;  3OUY A;  2BCS A;  4M0A A;  3B0Y A;  4R65 A;  3RH4 A;  2ID1 A;  2GWS A;  4FHV A;  4WCW A;  8ICG A;  4NM2 A;  1MIW A;  4RQ4 A;  1ZQR A;  4UD4 A;  4F5O A;  3WFP A;  3RJJ A;  2ISO A;  1TFW A;  2PFQ A;  4XUS A;  2ZH7 A;  4M47 A;  1UET A;  5IIN A;  4ATB A;  1ZQQ A;  4F5Q A;  1ZJN A;  2M2U A;  9ICE A;  4O5E A;  4P4P A;  1NO5 A;  4QZF A;  4O5C A;  1MIY A;  2M2T A;  3MGH A;  3JPT A;  5CA7 A;  2DR8 A;  3HW8 A;  5J2I A;  7ICE A;  4X0B A;  4UD5 A;  1BPD A;  8ICE A;  2FMP A;  1F5A A;  8ICS A;  1V4A A;  4NLN A;  5IIJ A;  3V7K A;  4K4G A;  4ATB B;  4UB1 A;  5DED A;  4O9M A;  5J2B A;  2DR5 A;  9ICN A;  2ISP A;  1JAJ A;  1ZQM A;  2FMS A;  2O1P A;  2BPG A;  1XSN A;  4MFA A;  1ZQI A;  4QZ9 A;  8ICY A;  4Z6C A;  4TUS A;  3ISC A;  1JQR A;  4MFC A;  2P66 A;  1KNY A;  3C2M A;  4WC4 A;  5J0U A;  5DKW A;  4X4R A;  4WC3 A;  1TV9 A;  4MF2 A;  4QZE A;  4M9N A;  4RQ3 A;  3JPO A;  8ICF A;  4X4O A;  5J0P A;  4X4Q A;  5J2D A;  3ISD A;  1Q78 A;  4I27 A;  5D46 A;  5J0Q A;  7ICO A;  2DVI A;  5HRF A;  5F2V O;  2NRK A;  3OVB A;  4NLZ A;  1BPE A;  9ICQ A;  1BPY A;  4AT7 A;  3OV7 A;  4EP7 A;  7ICF A;  8ICP A;  4YMM A;  4WBZ A;  5J0Y A;  5CJ7 A;  4X4U A;  3AUO A;  9ICC A;  4QZI A;  4I28 A;  9ICS A;  8ICQ A;  8ICU A;  4O5K A;  5III A;  3WFQ E;  4DOA A;  4PHA A;  3RJF A;  5J2G A;  4AT8 B;  3JYY A;  5J2C A;  8ICT A;  4P2H A;  5D49 A;  3H39 A;  4QZ8 A;  4RQ8 A;  5J2H A;  4KLG A;  8ICI A;  4PGX A;  4E80 A;  5J0W A;  5HRG A;  3B0X A;  2BCQ A;  4M9L A;  4FHX A;  1ZQC A;  1ZQK A;  4X4V A;  5J0X A;  3JPS A;  4EBK A;  3JPP A;  4GXI A;  7ICU A;  8ICK A;  3LQC B;  4RWP A;  4R64 A;  4IQU A;  5CWR A;  4PPX A;  2Q66 A;  1ZQW A;  4RQ7 A;  5IIO A;  9ICO A;  2ZH1 A;  3WFS C;  1ZQE A;  8ICH A;  4WC7 A;  5HR9 A;  4I2D A;  4UAZ A;  8ICC A;  4KLI A;  1ZQA A;  8ICZ A;  3UXP A;  4RWN A;  4KLH A;  4IG8 A;  4M9G A;  8ICJ A;  3JZ0 A;  2ZH2 A;  4I2B A;  4F5N A;  2DR9 A;  4JWN A;  4YCX A;  3RJH A;  7ICH A;  3OUY B;  1JN3 A;  1ZQU A;  4PHE A;  2DR7 A;  5DDM A;  4I2H A;  4X4N A;  4R63 A;  5BOM A;  4TUQ A;  3MDC A;  4X5V A;  4QZC A;  4YD2 A;  4QZH A;  1TFY A;  5HHH A;  1HUO A;  1FA0 A;  1ZQJ A;  4UBC A;  3RH6 A;  2FMQ A;  4M9J A;  9ICF A;  1ZQG A;  4RT3 A;  5J29 A;  2IHM A;  4UB2 A;  2I9G A;  4YN4 A;  9ICV A;  4I2E A;  9ICJ A;  4NM1 A;  8ICA A;  7ICP A;  4XRH A;  2DRA A;  9ICW A;  3RJG A;  4LVS A;  4RWQ A;  4UAY A;  5DB6 A;  4Z6D A;  4KLM A;  5HRK A;  2PFN A;  4NY8 A;  4LZG A;  4X4S A;  4NKT A;  3AU2 A;  4RPY A;  3C18 A;  4S3N A;  4KLO A;  8ICX A;  7ICV A;  1MIV A;  1ZJM A;  7ICG A;  2ZH4 A;  4NLK A;  4XA5 A;  9ICB A;  4AT9 A;  2RFF A;  9ICP A;  4RQ5 A;  4P4O A;  2PBE A;  5J0S A;  3H3A A;  8ICV A;  3AU6 A;  1ZQX A;  5J2F A;  5D4B A;  1ZQP A;  8ICO A;  1R8C A;  4RPZ A;  4PHD A;  4DO9 A;  5J2J A;  4KLD A;  2M2V A;  7ICL A;  4TUP A;  3PNC A;  1BPZ A;  3HIY A;  4XQ8 A;  3K75 D;  4F5P A;  3GDX A;  7ICS A;  4FH3 A;  4RT2 A;  4JWM A;  4QZG A;  3OVA A;  5CB1 A;  1YLQ A;  2BPC A;  1HUZ A;  9ICG A;  4DOB A;  4K4H A;  1Q79 A;  1ZQF A;  4KLJ A;  3HJ1 A;  2ZHA A;  1KEJ A;  3H37 A;  4RQ2 A;  4FO6 A;  3C66 A;  9ICX A;  1MQ3 A;  5DB9 A;  3PMN A;  7ICM A;  3UXN A;  5HHI A;  2ZH5 A;  3JPR A;  4R66 A;  7ICR A;  4NKU A;  3UPS A;  4I2A A;  4QZD A;  4AT7 B;  4FHY A;  1ZQL A;  4PHP A;  4M9H A;  9ICU A;  9ICK A;  4KLQ A;  5HRH A;  3MDA A;  8ICW A;  5CP2 A;  1UEU A;  3WFO A;  4WC6 A;  3V7L A;  7ICK A;  3PML A;  8ICL A;  5DB8 A;  8ICN A;  9ICA A;  7ICI A;  5HRI A;  4LT6 A;  7ICJ A;  9ICH A;  4FH5 A;  3H38 A;  3WFR E;  1UEV A;  3UXO A;  5DBB A;  4UAW A;  4GXK A;  4QZA A;  3HJ4 A;  5HRD A;  1XSP A;  3AQK A;  4FHP A;  4EBJ A;  4UB4 A;  4RQ0 A;  4UB3 A;  4PH5 A;  1TVA A;  2BCU A;  1VFG A;  4RWO A;  4KLF A;  5DB7 A;  1KDH A;  4KLE A;  4WC0 A;  5CR0 A;  4YMN A;  3V72 A;  2W9M A;  2PXI A;  5J2K A;  5HRL A;  1VJ7 A;  4Z6F A;  2ZH6 A;  2ZH3 A;  2O5A A;  4RQ1 A;  1OU5 A;  3TFR A;  4I2F A;  3LK9 A;  4IQW A;  4E7X A;  4IQV A;  4IQT A;  1WOT A;  1ZQV A;  4I2J A;  9ICR A;  1RZT A;  4KLS A;  3JPQ A;  4RPX A;  5IIL A;  2ZHB A;  4UBB A;  4I2G A;  5IIK A;  1JMS A;  5J0R A;  2BE3 A;  4PGQ A;  5DBC A;  5BOL A;  4M04 A;  5TZV A;  4F5R A;  2BCV A;  3UQ2 A;  3RJE A;  4Z6E A;  4KLU A;  5DDY A;  1PX5 A;  3TFS A;  1ZQZ A;  4WC1 A;  9ICM A;  4K4I A;  1R89 A;  5J2A A;  9ICI A;  3UPQ A;  7ICT A;  3HX0 A;  1ZQH A;  5J0O A;  5EOZ A;  8ICB A;  5DEC A;  3C2K A;  9ICT A;  1ZQY A;  4YMO A;  4P4M A;  4I2C A;  3OVS A;  4WC2 A;  2ZH9 A;  4FHW A;  4M5D A;  3C5G A;  5HRE A;  1RPL A;  3RJK A;  4I2I A;  3RH5 A;  3HWT A;  9ICL A;  4M2Y A;  7ICQ A;  3C5F A;  3AQN A;  2BCR A;  2DRB A;  3OGU A;  1ZQN A;  5IIM A;  1ZQD A;  4RQ6 A;  4UB5 A;  5J0T A;  1ZQT A;  4X4T A;  3MBY A;  1ZQS A;  4DOC A;  3V7J A;  4WC5 A;  4AT9 B;  4MFF A;  3AQL A;  1ZQB A;  4TUR A;  5HRB A;  4PGY A;  4AT8 A;  2M2W A;  1R8A A;  5CHG A;  4KLT A;  4X0A A;  7ICN A;  1MQ2 A;  4YD1 A;  3C2L A;  2BPF A;  3AQM A;  2PFP A;  3JPN A;  4X4P A;  1XSL A;  3RJI A;  1BPB A;  4XQ7 A;  1BPX A;  4I29 A;  4E8F A;  3MGI A;  2ZH8 A;  4MF8 A;  5DBA A;  3NYB A;  1NOM A; 
#chains in the Genus database with same CATH topology
 4WBY A;  2HHP A;  3NVO A;  3UQ0 A;  8ICM A;  4QZB A;  5HC9 A;  5BPC A;  4NXX A;  2VAN A;  1R8B A;  3ISB A;  2BBH A;  1ZQO A;  5J2E A;  4KLL A;  4LZD A;  4GXJ A;  4NXZ A;  1GPJ A;  2PFO A;  8ICR A;  3L9D A;  3OUY A;  2BCS A;  4M0A A;  3B0Y A;  4R65 A;  3RH4 A;  2ID1 A;  2GWS A;  4FHV A;  4WCW A;  8ICG A;  2BBJ A;  4NM2 A;  1MIW A;  4RQ4 A;  3PHZ A;  1ZQR A;  4UD4 A;  4F5O A;  3WFP A;  3RJJ A;  2ISO A;  1TFW A;  2PFQ A;  4XUS A;  2ZH7 A;  4K9B A;  4M47 A;  1UET A;  5IIN A;  4ATB A;  3ER8 C;  1ZQQ A;  4F5Q A;  1ZJN A;  2M2U A;  9ICE A;  4O5E A;  4P4P A;  1NO5 A;  4QZF A;  4O5C A;  1MIY A;  4EED A;  5D62 A;  2M2T A;  3MGH A;  3JPT A;  5CA7 A;  2DR8 A;  3HW8 A;  5J2I A;  7ICE A;  4X0B A;  4UD5 A;  1BPD A;  8ICE A;  4FO1 A;  2FMP A;  1F5A A;  8ICS A;  1V4A A;  4NLN A;  5IIJ A;  3V7K A;  4K4G A;  4ATB B;  4UB1 A;  5DED A;  4O9M A;  4JLX A;  5J2B A;  2DR5 A;  9ICN A;  4WH5 A;  2ISP A;  3CK6 A;  1JAJ A;  1ZQM A;  2FMS A;  2O1P A;  2BPG A;  1XSN A;  4MFA A;  4WOY A;  1ZQI A;  4QZ9 A;  8ICY A;  4Z6C A;  4TUS A;  3ISC A;  1JQR A;  4MFC A;  2P66 A;  1KNY A;  4O69 A;  3C2M A;  4WC4 A;  5J0U A;  5DKW A;  4X4R A;  4WC3 A;  1TV9 A;  4MF2 A;  4QZE A;  4M9N A;  3ER9 B;  4LEZ A;  4RQ3 A;  3JPO A;  8ICF A;  4X4O A;  5J0P A;  2B51 A;  4X4Q A;  4O6A A;  5J2D A;  3ISD A;  1Q78 A;  4I27 A;  5D46 A;  5J0Q A;  7ICO A;  4OAI Z;  2DVI A;  5HRF A;  5F2V O;  2NRK A;  3OVB A;  4NLZ A;  1BPE A;  9ICQ A;  1BPY A;  4AT7 A;  3OV7 A;  4EP7 A;  7ICF A;  8ICP A;  4YMM A;  4WBZ A;  5J0Y A;  5CJ7 A;  4X4U A;  3AUO A;  9ICC A;  4QZI A;  4I28 A;  9ICS A;  8ICQ A;  8ICU A;  4N7R A;  4O5K A;  5III A;  3WFQ E;  4DOA A;  3NKU A;  4PHA A;  3RJF A;  5J2G A;  4AT8 B;  3JYY A;  5J2C A;  8ICT A;  4P2H A;  5D49 A;  5CFU A;  3H39 A;  4QZ8 A;  4O68 A;  4RQ8 A;  5JTG A;  5J2H A;  4K98 A;  4KLG A;  8ICI A;  5CFS A;  4PGX A;  4E80 A;  5J0W A;  5HRG A;  3B0X A;  2BCQ A;  4M9L A;  3NWI A;  1ZQC A;  4FHX A;  1ZQK A;  4X4V A;  5J0X A;  3JPS A;  4EBK A;  4EGW A;  3JPP A;  4GXI A;  7ICU A;  8ICK A;  3LQC B;  4RWP A;  4R64 A;  4IQU A;  5CWR A;  4I0U A;  4PPX A;  2Q66 A;  1ZQW A;  4RQ7 A;  5IIO A;  9ICO A;  5CFT A;  2ZH1 A;  3WFS C;  1ZQE A;  8ICH A;  4WC7 A;  5HR9 A;  4I2D A;  4UAZ A;  8ICC A;  4KLI A;  1ZQA A;  8ICZ A;  3UXP A;  4NXW A;  2GAF D;  4RWN A;  4KLH A;  4IG8 A;  4OAH A;  4M9G A;  8ICJ A;  3JZ0 A;  2ZH2 A;  4I2B A;  4F5N A;  2DR9 A;  4JWN A;  4YCX A;  3RJH A;  4LEW A;  7ICH A;  3OUY B;  1JN3 A;  1ZQU A;  4PHE A;  2DR7 A;  5DDM A;  4I2H A;  4X4N A;  4R63 A;  4EEB A;  4K96 A;  5BOM A;  4TUQ A;  3MDC A;  4X5V A;  4QZC A;  4YD2 A;  3JCF A;  4QZH A;  1TFY A;  5HHH A;  1HUO A;  1FA0 A;  4OAG A;  4LEY A;  1ZQJ A;  4UBC A;  3RH6 A;  4NXU A;  2FMQ A;  2B4V A;  4M9J A;  9ICF A;  1ZQG A;  4RT3 A;  5J29 A;  2IHM A;  4UB2 A;  2I9G A;  4YN4 A;  9ICV A;  4I2E A;  9ICJ A;  3K7D A;  3EF2 A;  4NM1 A;  4HX0 A;  8ICA A;  7ICP A;  4XRH A;  2DRA A;  9ICW A;  3RJG A;  4LVS A;  4RWQ A;  4UAY A;  5DB6 A;  4Z6D A;  4KLM A;  5HRK A;  2PFN A;  4NY8 A;  4LZG A;  4X4S A;  4KB6 A;  4NKT A;  3AU2 A;  4RPY A;  3C18 A;  4S3N A;  4K9A A;  4KLO A;  8ICX A;  7ICV A;  1MIV A;  1ZJM A;  7ICG A;  2ZH4 A;  4NLK A;  4XA5 A;  9ICB A;  4AT9 A;  2RFF A;  9ICP A;  4RQ5 A;  4P4O A;  2PBE A;  5J0S A;  3H3A A;  8ICV A;  3AU6 A;  1ZQX A;  5J2F A;  2HN1 A;  4K99 A;  5D4B A;  1ZQP A;  8ICO A;  1R8C A;  4RPZ A;  3OWG A;  4PHD A;  4DO9 A;  5B3P A;  5J2J A;  4KLD A;  2M2V A;  7ICL A;  4TUP A;  3PNC A;  1BPZ A;  3HIY A;  4XQ8 A;  3K75 D;  4F5P A;  3GDX A;  7ICS A;  4FH3 A;  4RT2 A;  4JWM A;  4QZG A;  5B3Q A;  3OVA A;  5CB1 A;  1YLQ A;  2BPC A;  1HUZ A;  9ICG A;  4DOB A;  4K4H A;  1Q79 A;  1ZQF A;  4KLJ A;  3HJ1 A;  5CHE A;  2ZHA A;  1KEJ A;  3H37 A;  4O67 A;  4RQ2 A;  5D61 A;  4FO6 A;  3C66 A;  9ICX A;  1MQ3 A;  4XJE A;  5DB9 A;  3PMN A;  7ICM A;  3UXN A;  5HHI A;  2ZH5 A;  3JPR A;  4R66 A;  7ICR A;  4NKU A;  3UPS A;  4I2A A;  4QZD A;  4AT7 B;  4FHY A;  1ZQL A;  4PHP A;  4M9H A;  4WQL A;  4JLZ A;  9ICU A;  9ICK A;  4KLQ A;  5HRH A;  3MDA A;  8ICW A;  5CP2 A;  1UEU A;  3WFO A;  4WC6 A;  3V7L A;  7ICK A;  4KM5 A;  3PML A;  8ICL A;  5DB8 A;  8ICN A;  9ICA A;  7ICI A;  4LEV A;  5HRI A;  4LT6 A;  7ICJ A;  3MCR A;  9ICH A;  2HN2 A;  4FH5 A;  3H38 A;  3WFR E;  1UEV A;  3UXO A;  5DBB A;  4UAW A;  4NXT A;  4GXK A;  4QZA A;  3HJ4 A;  5HRD A;  1XSP A;  3AQK A;  2FCL A;  4FHP A;  4EBJ A;  4UB4 A;  4RQ0 A;  2EWR A;  4UB3 A;  4PH5 A;  1TVA A;  2BCU A;  1VFG A;  4RWO A;  2IUB A;  4KLF A;  5DB7 A;  1KDH A;  4KLE A;  4EV6 A;  4WC0 A;  5CR0 A;  4YMN A;  3V72 A;  2W9M A;  2PXI A;  5J2K A;  5HRL A;  1VJ7 A;  4Z6F A;  2ZH6 A;  2ZH3 A;  2O5A A;  4RQ1 A;  1OU5 A;  3TFR A;  4I2F A;  3LK9 A;  4IQW A;  4E7X A;  4IQV A;  4WQK A;  4OAF A;  4IQT A;  1WOT A;  1ZQV A;  4I2J A;  9ICR A;  1RZT A;  4KLS A;  3JPQ A;  4RPX A;  5IIL A;  4MKP A;  2ZHB A;  4UBB A;  4I2G A;  5IIK A;  1JMS A;  5J0R A;  2GA9 D;  2BE3 A;  4PGQ A;  4K8V A;  5DBC A;  5BOL A;  4M04 A;  5TZV A;  4F5R A;  2BCV A;  3UQ2 A;  3ERC C;  3RJE A;  4Z6E A;  4KLU A;  5DDY A;  1PX5 A;  3TFS A;  1ZQZ A;  4WC1 A;  9ICM A;  4K4I A;  1R89 A;  5J2A A;  9ICI A;  3UPQ A;  7ICT A;  3HX0 A;  1ZQH A;  5J0O A;  5EOZ A;  8ICB A;  5DEC A;  3C2K A;  9ICT A;  1ZQY A;  4YMO A;  4P4M A;  4I2C A;  3OVS A;  4WC2 A;  2ZH9 A;  4FHW A;  4M5D A;  3C5G A;  4NXV A;  5HRE A;  1RPL A;  3RJK A;  4I2I A;  3RH5 A;  3HWT A;  9ICL A;  4M2Y A;  7ICQ A;  3C5F A;  3AQN A;  2BCR A;  2DRB A;  3OGU A;  1ZQN A;  4K97 A;  5IIM A;  1ZQD A;  4RQ6 A;  4UB5 A;  5J0T A;  1ZQT A;  4X4T A;  3MBY A;  1ZQS A;  4DOC A;  3V7J A;  4WC5 A;  4AT9 B;  4MFF A;  3AQL A;  1ZQB A;  4TUR A;  5D63 A;  5HRB A;  4PGY A;  4AT8 A;  2M2W A;  1R8A A;  5CHG A;  4KLT A;  4X0A A;  7ICN A;  1MQ2 A;  4YD1 A;  3C2L A;  2BPF A;  2IHO A;  3AQM A;  2PFP A;  2B56 A;  3JPN A;  4X4P A;  1XSL A;  3RJI A;  1BPB A;  4XQ7 A;  1BPX A;  4I29 A;  4E8F A;  3MGI A;  2ZH8 A;  4MF8 A;  5DBA A;  3NYB A;  1NOM A; 
#chains in the Genus database with same CATH homology
 4WBY A;  2HHP A;  3UQ0 A;  8ICM A;  4QZB A;  5HC9 A;  5BPC A;  2VAN A;  1R8B A;  3ISB A;  1ZQO A;  5J2E A;  4KLL A;  4LZD A;  4GXJ A;  4NXZ A;  2PFO A;  8ICR A;  3L9D A;  3OUY A;  2BCS A;  4M0A A;  3B0Y A;  4R65 A;  3RH4 A;  2ID1 A;  2GWS A;  4FHV A;  4WCW A;  8ICG A;  4NM2 A;  1MIW A;  4RQ4 A;  1ZQR A;  4UD4 A;  4F5O A;  3WFP A;  3RJJ A;  2ISO A;  1TFW A;  2PFQ A;  4XUS A;  2ZH7 A;  4M47 A;  1UET A;  5IIN A;  4ATB A;  1ZQQ A;  4F5Q A;  1ZJN A;  2M2U A;  9ICE A;  4O5E A;  4P4P A;  1NO5 A;  4QZF A;  4O5C A;  1MIY A;  2M2T A;  3MGH A;  3JPT A;  5CA7 A;  2DR8 A;  3HW8 A;  5J2I A;  7ICE A;  4X0B A;  4UD5 A;  1BPD A;  8ICE A;  2FMP A;  1F5A A;  8ICS A;  1V4A A;  4NLN A;  5IIJ A;  3V7K A;  4K4G A;  4ATB B;  4UB1 A;  5DED A;  4O9M A;  5J2B A;  2DR5 A;  9ICN A;  2ISP A;  1JAJ A;  1ZQM A;  2FMS A;  2O1P A;  2BPG A;  1XSN A;  4MFA A;  1ZQI A;  4QZ9 A;  8ICY A;  4Z6C A;  4TUS A;  3ISC A;  1JQR A;  4MFC A;  2P66 A;  1KNY A;  3C2M A;  4WC4 A;  5J0U A;  5DKW A;  4X4R A;  4WC3 A;  1TV9 A;  4MF2 A;  4QZE A;  4M9N A;  4RQ3 A;  3JPO A;  8ICF A;  4X4O A;  5J0P A;  4X4Q A;  5J2D A;  3ISD A;  1Q78 A;  4I27 A;  5D46 A;  5J0Q A;  7ICO A;  2DVI A;  5HRF A;  5F2V O;  2NRK A;  3OVB A;  4NLZ A;  1BPE A;  9ICQ A;  1BPY A;  4AT7 A;  3OV7 A;  4EP7 A;  7ICF A;  8ICP A;  4YMM A;  4WBZ A;  5J0Y A;  5CJ7 A;  4X4U A;  3AUO A;  9ICC A;  4QZI A;  4I28 A;  9ICS A;  8ICQ A;  8ICU A;  4O5K A;  5III A;  3WFQ E;  4DOA A;  4PHA A;  3RJF A;  5J2G A;  4AT8 B;  3JYY A;  5J2C A;  8ICT A;  4P2H A;  5D49 A;  3H39 A;  4QZ8 A;  4RQ8 A;  5J2H A;  4KLG A;  8ICI A;  4PGX A;  4E80 A;  5J0W A;  5HRG A;  3B0X A;  2BCQ A;  4M9L A;  4FHX A;  1ZQC A;  1ZQK A;  4X4V A;  5J0X A;  3JPS A;  4EBK A;  3JPP A;  4GXI A;  7ICU A;  8ICK A;  3LQC B;  4RWP A;  4R64 A;  4IQU A;  5CWR A;  4PPX A;  2Q66 A;  1ZQW A;  4RQ7 A;  5IIO A;  9ICO A;  2ZH1 A;  3WFS C;  1ZQE A;  8ICH A;  4WC7 A;  5HR9 A;  4I2D A;  4UAZ A;  8ICC A;  4KLI A;  1ZQA A;  8ICZ A;  3UXP A;  4RWN A;  4KLH A;  4IG8 A;  4M9G A;  8ICJ A;  3JZ0 A;  2ZH2 A;  4I2B A;  4F5N A;  2DR9 A;  4JWN A;  4YCX A;  3RJH A;  7ICH A;  3OUY B;  1JN3 A;  1ZQU A;  4PHE A;  2DR7 A;  5DDM A;  4I2H A;  4X4N A;  4R63 A;  5BOM A;  4TUQ A;  3MDC A;  4X5V A;  4QZC A;  4YD2 A;  4QZH A;  1TFY A;  5HHH A;  1HUO A;  1FA0 A;  1ZQJ A;  4UBC A;  3RH6 A;  2FMQ A;  4M9J A;  9ICF A;  1ZQG A;  4RT3 A;  5J29 A;  2IHM A;  4UB2 A;  2I9G A;  4YN4 A;  9ICV A;  4I2E A;  9ICJ A;  4NM1 A;  8ICA A;  7ICP A;  4XRH A;  2DRA A;  9ICW A;  3RJG A;  4LVS A;  4RWQ A;  4UAY A;  5DB6 A;  4Z6D A;  4KLM A;  5HRK A;  2PFN A;  4NY8 A;  4LZG A;  4X4S A;  4NKT A;  3AU2 A;  4RPY A;  3C18 A;  4S3N A;  4KLO A;  8ICX A;  7ICV A;  1MIV A;  1ZJM A;  7ICG A;  2ZH4 A;  4NLK A;  4XA5 A;  9ICB A;  4AT9 A;  2RFF A;  9ICP A;  4RQ5 A;  4P4O A;  2PBE A;  5J0S A;  3H3A A;  8ICV A;  3AU6 A;  1ZQX A;  5J2F A;  5D4B A;  1ZQP A;  8ICO A;  1R8C A;  4RPZ A;  4PHD A;  4DO9 A;  5J2J A;  4KLD A;  2M2V A;  7ICL A;  4TUP A;  3PNC A;  1BPZ A;  3HIY A;  4XQ8 A;  3K75 D;  4F5P A;  3GDX A;  7ICS A;  4FH3 A;  4RT2 A;  4JWM A;  4QZG A;  3OVA A;  5CB1 A;  1YLQ A;  2BPC A;  1HUZ A;  9ICG A;  4DOB A;  4K4H A;  1Q79 A;  1ZQF A;  4KLJ A;  3HJ1 A;  2ZHA A;  1KEJ A;  3H37 A;  4RQ2 A;  4FO6 A;  3C66 A;  9ICX A;  1MQ3 A;  5DB9 A;  3PMN A;  7ICM A;  3UXN A;  5HHI A;  2ZH5 A;  3JPR A;  4R66 A;  7ICR A;  4NKU A;  3UPS A;  4I2A A;  4QZD A;  4AT7 B;  4FHY A;  1ZQL A;  4PHP A;  4M9H A;  9ICU A;  9ICK A;  4KLQ A;  5HRH A;  3MDA A;  8ICW A;  5CP2 A;  1UEU A;  3WFO A;  4WC6 A;  3V7L A;  7ICK A;  3PML A;  8ICL A;  5DB8 A;  8ICN A;  9ICA A;  7ICI A;  5HRI A;  4LT6 A;  7ICJ A;  9ICH A;  4FH5 A;  3H38 A;  3WFR E;  1UEV A;  3UXO A;  5DBB A;  4UAW A;  4GXK A;  4QZA A;  3HJ4 A;  5HRD A;  1XSP A;  3AQK A;  4FHP A;  4EBJ A;  4UB4 A;  4RQ0 A;  4UB3 A;  4PH5 A;  1TVA A;  2BCU A;  1VFG A;  4RWO A;  4KLF A;  5DB7 A;  1KDH A;  4KLE A;  4WC0 A;  5CR0 A;  4YMN A;  3V72 A;  2W9M A;  2PXI A;  5J2K A;  5HRL A;  1VJ7 A;  4Z6F A;  2ZH6 A;  2ZH3 A;  2O5A A;  4RQ1 A;  1OU5 A;  3TFR A;  4I2F A;  3LK9 A;  4IQW A;  4E7X A;  4IQV A;  4IQT A;  1WOT A;  1ZQV A;  4I2J A;  9ICR A;  1RZT A;  4KLS A;  3JPQ A;  4RPX A;  5IIL A;  2ZHB A;  4UBB A;  4I2G A;  5IIK A;  1JMS A;  5J0R A;  2BE3 A;  4PGQ A;  5DBC A;  5BOL A;  4M04 A;  5TZV A;  4F5R A;  2BCV A;  3UQ2 A;  3RJE A;  4Z6E A;  4KLU A;  5DDY A;  1PX5 A;  3TFS A;  1ZQZ A;  4WC1 A;  9ICM A;  4K4I A;  1R89 A;  5J2A A;  9ICI A;  3UPQ A;  7ICT A;  3HX0 A;  1ZQH A;  5J0O A;  5EOZ A;  8ICB A;  5DEC A;  3C2K A;  9ICT A;  1ZQY A;  4YMO A;  4P4M A;  4I2C A;  3OVS A;  4WC2 A;  2ZH9 A;  4FHW A;  4M5D A;  3C5G A;  5HRE A;  1RPL A;  3RJK A;  4I2I A;  3RH5 A;  3HWT A;  9ICL A;  4M2Y A;  7ICQ A;  3C5F A;  3AQN A;  2BCR A;  2DRB A;  3OGU A;  1ZQN A;  5IIM A;  1ZQD A;  4RQ6 A;  4UB5 A;  5J0T A;  1ZQT A;  4X4T A;  3MBY A;  1ZQS A;  4DOC A;  3V7J A;  4WC5 A;  4AT9 B;  4MFF A;  3AQL A;  1ZQB A;  4TUR A;  5HRB A;  4PGY A;  4AT8 A;  2M2W A;  1R8A A;  5CHG A;  4KLT A;  4X0A A;  7ICN A;  1MQ2 A;  4YD1 A;  3C2L A;  2BPF A;  3AQM A;  2PFP A;  3JPN A;  4X4P A;  1XSL A;  3RJI A;  1BPB A;  4XQ7 A;  1BPX A;  4I29 A;  4E8F A;  3MGI A;  2ZH8 A;  4MF8 A;  5DBA A;  3NYB A;  1NOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...