5HRIA

The crystal structure of asfvpolx:dna1 binary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
GMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of AsfvPolX: 1nt-gap(P) DNA1: dGTP ternary complex.
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 46
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hriA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hriA01
4WC2A 9ICWA 5J0SA 3OVBA 3RJKA 8ICTA 4QZGA 9ICPA 4E8FA 4K4HA 2BCVA 1PX5A 4RQ3A 4QZIA 4X0AA 5DEDA 2O1PA 1MQ2A 5D46A 1ZQZA 7ICPA 1NOMA 1ZQQA 4O5CA 3JPNA 3RJJA 3UXNA 3JPSA 2ZH5A 5D49A 3JPTA 2FMQA 4WC6A 9ICJA 2M2WA 4KLDA 3UXOA 4KLOA 3HJ1A 8ICMA 5J2JA 8ICFA 4M2YA 8ICAA 1ZQBA 2BE3A 4NLKA 4WBYA 1WOTA 5IIIA 4P4PA 4R64A 1ZQIA 2ZH2A 1BPXA 4FO6A 7ICOA 2GWSA 9ICLA 4LT6A 4I2GA 9ICOA 1TVAA 4RQ2A 1JAJA 1ZQKA 9ICRA 4FHWA 4Z6DA 4MF2A 1ZQRA 1ZQDA 4XA5A 7ICKA 5D4BA 5J0OA 1XSNA 1JMSA 8ICLA 3AUOA 3H39A 7ICIA 4NY8A 2DRAA 9ICAA 3H3AA 1ZQHA 4TURA 2FMSA 2ZHAA 1UETA 2I9GA 4RT3A 4JWNA 1MIWA 4DOAA 4WCWA 5J0YA 1ZQMA 8ICIA 8ICPA 4YMOA 2ISOA 7ICNA 4GXKA 4P2HA 3V7LA 2DR7A 5HRFA 9ICBA 4TUQA 3ISCA 9ICVA 9ICUA 4KLMA 5HRKA 4IQUA 2RFFA 4IQTA 5IILA 4M5DA 2Q66A 1KDHA 3RH4A 5DB8A 9ICFA 4Z6EA 1ZQLA 4RQ6A 4X4NA 3H37A 3UQ2A 3RJEA 4UB5A 5HRDA 1HUZA 4ATBB 4KLQA 1VFGA 4QZEA 8ICWA 8ICZA 4XQ8A 3AU6A 4WC5A 2DRBA 8ICKA 1F5AA 3OGUA 4P4MA 4WC0A 1ZQTA 3LQCB 2BPGA 4O9MA 1KEJA 7ICQA 4FHPA 3PMLA 4KLFA 5J2AA 8ICOA 1UEVA 4EP7A 3UQ0A 4MFAA 1ZJMA 5BOLA 4DOBA 4QZHA 5HRLA 1OU5A 4YD1A 3HX0A 4KLJA 3C66A 2O5AA 9ICQA 4K4GA 4ATBA 4X4UA 2NRKA 2BCUA 2DR5A 3B0YA 8ICUA 8ICHA 3OV7A 4RWNA 2ZH8A 4EBKA 1BPYA 2VANA 5DBCA 5DDYA 3MGIA 5J0XA 5BPCA 2ZH9A 4NKUA 4NM2A 4UB3A 4I2IA 4NKTA 3RH6A 4RQ5A 3MDAA 1ZJNA 4E80A 5J0QA 2DVIA 7ICRA 9ICKA 4X4QA 3RJFA 2HHPA 4QZDA 4X4SA 1RZTA 5CA7A 3RJGA 8ICGA 3RJIA 5HRHA 4PGYA 7ICVA 1YLQA 4RQ4A 8ICRA 2ZHBA 4X0BA 2PFPA 1ZQVA 7ICUA 4UB1A 8ICNA 3HW8A 5HHHA 8ICQA 8ICVA 5IINA 8ICBA 3OVSA 5HRIA 3AQKA 4KLHA 1BPBA 1ZQFA 1ZQGA 1ZQSA 3C18A 8ICJA 4I27A 4I2DA 4RPZA 4UBBA 4Z6CA 1UEUA 1MQ3A 3AQLA 5J29A 3WFQE 4R66A 3WFOA 5CB1A 5HRBA 4UD5A 1ZQWA 4PHPA 1TFYA 4IG8A 3L9DA 5DB7A 4QZCA 4WBZA 4KLLA 4I2AA 4DO9A 5IIMA 9ICSA 4TUSA 7ICJA 2BPCA 4FHXA 1TV9A 1RPLA 5DKWA 2PFOA 4QZ9A 5J0WA 3JPQA 2ZH4A 3GDXA 5CHGA 3PNCA 3HWTA 4KLUA 4PHAA 1ZQNA 3V72A 4RWPA 3ISBA 3V7KA 7ICEA 9ICTA 4I28A 2PBEA 4QZAA 1JN3A 9ICXA 4WC1A 4PPXA 3LK9A 4F5PA 5J2GA 4WC4A 4I2BA 3C2LA 4EBJA 4X4TA 2IHMA 5HC9A 7ICFA 4I29A 3JYYA 4XUSA 1ZQOA 4UAWA 2PXIA 5IIOA 4M9HA 4QZ8A 3RH5A 5J2CA 4E7XA 4R65A 4NLNA 2ZH6A 4UB2A 5IIKA 4RQ0A 1Q78A 1ZQCA 4I2CA 4KLEA 4YMMA 3AU2A 2DR9A 2M2VA 3AQNA 1HUOA 4M9JA 4LVSA 7ICHA 1TFWA 3NYBA 4YCXA 5CWRA 4UD4A 4FHYA 4FHVA 4MFCA 5DB6A 2DR8A 5J2DA 3WFRE 3UPSA 5J0PA 3AQMA 4RT2A 2BCRA 5J2HA 4WC7A 3UXPA 1FA0A 2PFQA 4M04A 4RWOA 3JPPA 3JPOA 3C5GA 5EOZA 3PMNA 1BPDA 3TFSA 4KLGA 1KNYA 5CJ7A 4X4OA 4PH5A 4MFFA 4KLTA 2ZH3A 4LZDA 1MIYA 4JWMA 1JQRA 3JZ0A 8ICXA 2BPFA 4UAZA 4F5RA 1MIVA 3ISDA 7ICGA 2M2TA 4UAYA 5J0UA 4X5VA 5DBBA 2PFNA 3B0XA 8ICCA 4FH3A 3TFRA 5CR0A 4NLZA 4RWQA 4YD2A 2BCSA 5IIJA 7ICMA 4AT8B 5HRGA 3HIYA 4XQ7A 1ZQUA 4UBCA 3C2MA 4O5EA 4F5OA 8ICSA 1V4AA 4QZBA 3WFSC 5J2FA 4IQWA 3C5FA 1XSLA 3MGHA 3MBYA 1XSPA 1BPZA 2BCQA 7ICTA 8ICEA 3OVAA 4AT7B 5HHIA 4TUPA 4QZFA 4LZGA 4NM1A 5DB9A 5BOMA 9ICMA 4AT9B 4M0AA 2ZH1A 4UB4A 4O5KA 4GXIA 5J2IA 4AT8A 4R63A 2ZH7A 3V7JA 4RQ7A 3UPQA 8ICYA 3HJ4A 7ICLA 4K4IA 4PHEA 1ZQEA 4M47A 4MF8A 3OUYB 5J2BA 1ZQPA 4X4VA 4I2EA 4I2HA 4GXJA 4M9LA 4PGQA 4RPYA 1NO5A 4YMNA 4YN4A 7ICSA 4AT7A 4RQ8A 5F2VO 4X4PA 4RPXA 4M9GA 4P4OA 5J2EA 2ID1A 4AT9A 2ISPA 4IQVA 5TZVA 3RJHA 4NXZA 4M9NA 2W9MA 4X4RA 5DDMA 1R8CA 4PHDA 3JPRA 2M2UA 1R8BA 1Q79A 9ICGA 4RQ1A 3C2KA 1VJ7A 4WC3A 5CP2A 4KLSA 3WFPA 5HREA 5DECA 4KLIA 1R89A 1R8AA 3OUYA 4F5NA 9ICEA 5J2KA 3H38A 2P66A 4I2JA 4PGXA 4I2FA 5J0TA 4Z6FA 1ZQJA 4XRHA 4DOCA 1ZQAA 9ICNA 3K75D 4F5QA 2FMPA 9ICCA 5HR9A 1ZQYA 5J0RA 5DBAA 1ZQXA 1BPEA 4S3NA 9ICIA 4FH5A 9ICHA 3MDCA
chains in the Genus database with same CATH superfamily
4WC2A 9ICWA 5J0SA 3OVBA 3RJKA 8ICTA 4QZGA 9ICPA 4E8FA 4K4HA 2BCVA 1PX5A 4RQ3A 4QZIA 4I0UA 4X0AA 5DEDA 2O1PA 1MQ2A 5D46A 1ZQZA 7ICPA 3ER8C 1NOMA 1ZQQA 4O67A 4O5CA 3JPNA 3RJJA 3UXNA 3JPSA 2ZH5A 5D49A 3JPTA 2FMQA 4WC6A 9ICJA 2M2WA 4K99A 4KLDA 3UXOA 4KLOA 3HJ1A 8ICMA 4K9BA 5J2JA 8ICFA 4M2YA 8ICAA 1ZQBA 2BE3A 4NLKA 4WBYA 1WOTA 5IIIA 4P4PA 4R64A 1ZQIA 2ZH2A 1BPXA 4FO6A 7ICOA 4EGWA 3EF2A 4HX0A 2GWSA 9ICLA 4LT6A 4I2GA 9ICOA 1TVAA 4OAGA 4RQ2A 1JAJA 1ZQKA 9ICRA 4FHWA 4Z6DA 4MF2A 3ER9B 1ZQRA 1ZQDA 4XA5A 7ICKA 5D4BA 5J0OA 1XSNA 1JMSA 8ICLA 3AUOA 3H39A 7ICIA 4NY8A 2DRAA 9ICAA 3H3AA 1ZQHA 4TURA 2FMSA 3MCRA 2ZHAA 1UETA 2I9GA 4RT3A 4JWNA 1MIWA 4DOAA 4WCWA 5J0YA 1ZQMA 8ICIA 4FO1A 8ICPA 4YMOA 2ISOA 2B4VA 7ICNA 4GXKA 4P2HA 3V7LA 2DR7A 5HRFA 9ICBA 4TUQA 3ISCA 9ICVA 9ICUA 4KLMA 5HRKA 4IQUA 2RFFA 4IQTA 5IILA 4M5DA 2Q66A 5JTGA 1KDHA 3NWIA 3RH4A 5DB8A 9ICFA 4Z6EA 1ZQLA 4RQ6A 2BBJA 4X4NA 3H37A 3OWGA 4OAHA 3UQ2A 3RJEA 4UB5A 5HRDA 1HUZA 4ATBB 4EEDA 4KLQA 1VFGA 4QZEA 8ICWA 8ICZA 4XQ8A 3AU6A 4WC5A 2DRBA 4LEYA 8ICKA 5CHEA 1F5AA 3OGUA 1GPJA 4P4MA 4WC0A 1ZQTA 3LQCB 2HN2A 2BPGA 4O9MA 1KEJA 7ICQA 4FHPA 3PMLA 4KLFA 5J2AA 8ICOA 1UEVA 4EP7A 3UQ0A 4MFAA 1ZJMA 5BOLA 4DOBA 4QZHA 5HRLA 4K9AA 1OU5A 4YD1A 3HX0A 4KLJA 3C66A 2O5AA 9ICQA 3ERCC 4K4GA 2GAFD 4ATBA 4X4UA 2NRKA 2BCUA 2DR5A 3B0YA 8ICUA 8ICHA 4JLZA 3OV7A 4RWNA 2ZH8A 4MKPA 3NKUA 1BPYA 4EBKA 2VANA 5DBCA 5DDYA 3MGIA 5J0XA 5BPCA 5B3PA 2ZH9A 4NKUA 4NM2A 4UB3A 4I2IA 2B51A 4NKTA 3RH6A 4RQ5A 3MDAA 1ZJNA 4E80A 5J0QA 2DVIA 7ICRA 9ICKA 4X4QA 3RJFA 2HHPA 4QZDA 4X4SA 1RZTA 5CA7A 3RJGA 8ICGA 5B3QA 3RJIA 5HRHA 4PGYA 7ICVA 1YLQA 4RQ4A 8ICRA 3K7DA 4X0BA 2ZHBA 2PFPA 1ZQVA 7ICUA 4UB1A 8ICNA 3HW8A 5HHHA 8ICQA 8ICVA 5IINA 8ICBA 3OVSA 5HRIA 3AQKA 4KLHA 1BPBA 1ZQFA 1ZQGA 2B56A 1ZQSA 3C18A 3JCFA 8ICJA 4I27A 4I2DA 4RPZA 4UBBA 4Z6CA 1UEUA 1MQ3A 3AQLA 5J29A 3WFQE 4R66A 3WFOA 5CB1A 5HRBA 4UD5A 1ZQWA 4EEBA 4K97A 4PHPA 1TFYA 4IG8A 3L9DA 5DB7A 4QZCA 4WBZA 4KLLA 4I2AA 4DO9A 5IIMA 9ICSA 2IUBA 4TUSA 7ICJA 2BPCA 4FHXA 1TV9A 1RPLA 2HN1A 5DKWA 2PFOA 4QZ9A 5J0WA 4KB6A 3CK6A 3JPQA 2ZH4A 3GDXA 5CHGA 3PNCA 3HWTA 4KLUA 4PHAA 1ZQNA 3V72A 4RWPA 3ISBA 3V7KA 7ICEA 4N7RA 9ICTA 4I28A 2PBEA 4QZAA 1JN3A 9ICXA 4WC1A 4PPXA 3LK9A 4F5PA 5J2GA 4WC4A 4I2BA 4EV6A 3C2LA 4EBJA 4X4TA 2IHMA 5HC9A 7ICFA 4I29A 3JYYA 4XUSA 1ZQOA 4UAWA 2PXIA 5IIOA 4M9HA 4QZ8A 3RH5A 5J2CA 4E7XA 4R65A 4NLNA 2ZH6A 4UB2A 5IIKA 4RQ0A 1Q78A 1ZQCA 4I2CA 4KLEA 4YMMA 3AU2A 2DR9A 2M2VA 3AQNA 5CFUA 1HUOA 4M9JA 4LVSA 5D63A 7ICHA 1TFWA 4OAIZ 3NYBA 4YCXA 5CWRA 4UD4A 4FHYA 4FHVA 4MFCA 5DB6A 2DR8A 5J2DA 4WH5A 2EWRA 2BBHA 3WFRE 4NXWA 3UPSA 5J0PA 4O6AA 3AQMA 4RT2A 2BCRA 5J2HA 4NXTA 4WC7A 3UXPA 4K8VA 1FA0A 2PFQA 4M04A 4RWOA 3JPPA 5CFTA 3JPOA 3C5GA 5EOZA 3PMNA 1BPDA 3TFSA 4KLGA 1KNYA 5CJ7A 4X4OA 4PH5A 4MFFA 4KLTA 4WOYA 2ZH3A 4LZDA 1MIYA 4JWMA 1JQRA 3JZ0A 8ICXA 3PHZA 4O69A 2BPFA 4UAZA 4JLXA 4F5RA 1MIVA 3ISDA 7ICGA 2M2TA 4UAYA 5J0UA 4X5VA 5DBBA 2PFNA 4XJEA 3B0XA 8ICCA 4FH3A 3TFRA 5CR0A 4NLZA 4RWQA 4YD2A 2BCSA 5IIJA 7ICMA 4AT8B 5HRGA 3HIYA 4XQ7A 1ZQUA 4UBCA 3C2MA 4O5EA 4K98A 4F5OA 8ICSA 1V4AA 4QZBA 4OAFA 3WFSC 5J2FA 4IQWA 3C5FA 1XSLA 3MGHA 3MBYA 1XSPA 1BPZA 3NVOA 2BCQA 7ICTA 8ICEA 3OVAA 4AT7B 5HHIA 4TUPA 4QZFA 4LZGA 4NM1A 5DB9A 5BOMA 2IHOA 9ICMA 5D61A 4AT9B 4M0AA 2ZH1A 4UB4A 4O5KA 4GXIA 5D62A 5J2IA 4AT8A 4R63A 2ZH7A 3V7JA 4RQ7A 3UPQA 4O68A 8ICYA 3HJ4A 7ICLA 4NXUA 4K4IA 4PHEA 1ZQEA 4M47A 4MF8A 3OUYB 5J2BA 1ZQPA 4X4VA 4I2EA 4I2HA 4GXJA 4M9LA 4PGQA 4RPYA 1NO5A 4YMNA 4YN4A 7ICSA 4AT7A 4RQ8A 4LEZA 5F2VO 4X4PA 4RPXA 4M9GA 4K96A 4P4OA 5J2EA 2ID1A 4AT9A 2ISPA 4IQVA 4NXVA 5TZVA 3RJHA 4NXZA 2FCLA 4M9NA 2W9MA 4X4RA 5DDMA 1R8CA 4PHDA 3JPRA 2M2UA 1R8BA 1Q79A 9ICGA 4RQ1A 3C2KA 1VJ7A 4WC3A 5CP2A 4KLSA 3WFPA 5HREA 5DECA 4LEWA 4KLIA 1R89A 1R8AA 3OUYA 4F5NA 9ICEA 5J2KA 3H38A 2P66A 4I2JA 4PGXA 4I2FA 5J0TA 2GA9D 4Z6FA 1ZQJA 4WQLA 4XRHA 4KM5A 4DOCA 1ZQAA 9ICNA 3K75D 4F5QA 2FMPA 9ICCA 4NXXA 5HR9A 1ZQYA 5J0RA 5DBAA 1ZQXA 1BPEA 4S3NA 4LEVA 4WQKA 9ICIA 5CFSA 4FH5A 9ICHA 3MDCA
chains in the Genus database with same CATH topology
4WC2A 9ICWA 5J0SA 3OVBA 3RJKA 8ICTA 4QZGA 9ICPA 4E8FA 4K4HA 2BCVA 1PX5A 4RQ3A 4QZIA 4X0AA 5DEDA 2O1PA 1MQ2A 5D46A 1ZQZA 7ICPA 1NOMA 1ZQQA 4O5CA 3JPNA 3RJJA 3UXNA 3JPSA 2ZH5A 5D49A 3JPTA 2FMQA 4WC6A 9ICJA 2M2WA 4KLDA 3UXOA 4KLOA 3HJ1A 8ICMA 5J2JA 8ICFA 4M2YA 8ICAA 1ZQBA 2BE3A 4NLKA 4WBYA 1WOTA 5IIIA 4P4PA 4R64A 1ZQIA 2ZH2A 1BPXA 4FO6A 7ICOA 2GWSA 9ICLA 4LT6A 4I2GA 9ICOA 1TVAA 4RQ2A 1JAJA 1ZQKA 9ICRA 4FHWA 4Z6DA 4MF2A 1ZQRA 1ZQDA 4XA5A 7ICKA 5D4BA 5J0OA 1XSNA 1JMSA 8ICLA 3AUOA 3H39A 7ICIA 4NY8A 2DRAA 9ICAA 3H3AA 1ZQHA 4TURA 2FMSA 2ZHAA 1UETA 2I9GA 4RT3A 4JWNA 1MIWA 4DOAA 4WCWA 5J0YA 1ZQMA 8ICIA 8ICPA 4YMOA 2ISOA 7ICNA 4GXKA 4P2HA 3V7LA 2DR7A 5HRFA 9ICBA 4TUQA 3ISCA 9ICVA 9ICUA 4KLMA 5HRKA 4IQUA 2RFFA 4IQTA 5IILA 4M5DA 2Q66A 1KDHA 3RH4A 5DB8A 9ICFA 4Z6EA 1ZQLA 4RQ6A 4X4NA 3H37A 3UQ2A 3RJEA 4UB5A 5HRDA 1HUZA 4ATBB 4KLQA 1VFGA 4QZEA 8ICWA 8ICZA 4XQ8A 3AU6A 4WC5A 2DRBA 8ICKA 1F5AA 3OGUA 4P4MA 4WC0A 1ZQTA 3LQCB 2BPGA 4O9MA 1KEJA 7ICQA 4FHPA 3PMLA 4KLFA 5J2AA 8ICOA 1UEVA 4EP7A 3UQ0A 4MFAA 1ZJMA 5BOLA 4DOBA 4QZHA 5HRLA 1OU5A 4YD1A 3HX0A 4KLJA 3C66A 2O5AA 9ICQA 4K4GA 4ATBA 4X4UA 2NRKA 2BCUA 2DR5A 3B0YA 8ICUA 8ICHA 3OV7A 4RWNA 2ZH8A 4EBKA 1BPYA 2VANA 5DBCA 5DDYA 3MGIA 5J0XA 5BPCA 2ZH9A 4NKUA 4NM2A 4UB3A 4I2IA 4NKTA 3RH6A 4RQ5A 3MDAA 1ZJNA 4E80A 5J0QA 2DVIA 7ICRA 9ICKA 4X4QA 3RJFA 2HHPA 4QZDA 4X4SA 1RZTA 5CA7A 3RJGA 8ICGA 3RJIA 5HRHA 4PGYA 7ICVA 1YLQA 4RQ4A 8ICRA 2ZHBA 4X0BA 2PFPA 1ZQVA 7ICUA 4UB1A 8ICNA 3HW8A 5HHHA 8ICQA 8ICVA 5IINA 8ICBA 3OVSA 5HRIA 3AQKA 4KLHA 1BPBA 1ZQFA 1ZQGA 1ZQSA 3C18A 8ICJA 4I27A 4I2DA 4RPZA 4UBBA 4Z6CA 1UEUA 1MQ3A 3AQLA 5J29A 3WFQE 4R66A 3WFOA 5CB1A 5HRBA 4UD5A 1ZQWA 4PHPA 1TFYA 4IG8A 3L9DA 5DB7A 4QZCA 4WBZA 4KLLA 4I2AA 4DO9A 5IIMA 9ICSA 4TUSA 7ICJA 2BPCA 4FHXA 1TV9A 1RPLA 5DKWA 2PFOA 4QZ9A 5J0WA 3JPQA 2ZH4A 3GDXA 5CHGA 3PNCA 3HWTA 4KLUA 4PHAA 1ZQNA 3V72A 4RWPA 3ISBA 3V7KA 7ICEA 9ICTA 4I28A 2PBEA 4QZAA 1JN3A 9ICXA 4WC1A 4PPXA 3LK9A 4F5PA 5J2GA 4WC4A 4I2BA 3C2LA 4EBJA 4X4TA 2IHMA 5HC9A 7ICFA 4I29A 3JYYA 4XUSA 1ZQOA 4UAWA 2PXIA 5IIOA 4M9HA 4QZ8A 3RH5A 5J2CA 4E7XA 4R65A 4NLNA 2ZH6A 4UB2A 5IIKA 4RQ0A 1Q78A 1ZQCA 4I2CA 4KLEA 4YMMA 3AU2A 2DR9A 2M2VA 3AQNA 1HUOA 4M9JA 4LVSA 7ICHA 1TFWA 3NYBA 4YCXA 5CWRA 4UD4A 4FHYA 4FHVA 4MFCA 5DB6A 2DR8A 5J2DA 3WFRE 3UPSA 5J0PA 3AQMA 4RT2A 2BCRA 5J2HA 4WC7A 3UXPA 1FA0A 2PFQA 4M04A 4RWOA 3JPPA 3JPOA 3C5GA 5EOZA 3PMNA 1BPDA 3TFSA 4KLGA 1KNYA 5CJ7A 4X4OA 4PH5A 4MFFA 4KLTA 2ZH3A 4LZDA 1MIYA 4JWMA 1JQRA 3JZ0A 8ICXA 2BPFA 4UAZA 4F5RA 1MIVA 3ISDA 7ICGA 2M2TA 4UAYA 5J0UA 4X5VA 5DBBA 2PFNA 3B0XA 8ICCA 4FH3A 3TFRA 5CR0A 4NLZA 4RWQA 4YD2A 2BCSA 5IIJA 7ICMA 4AT8B 5HRGA 3HIYA 4XQ7A 1ZQUA 4UBCA 3C2MA 4O5EA 4F5OA 8ICSA 1V4AA 4QZBA 3WFSC 5J2FA 4IQWA 3C5FA 1XSLA 3MGHA 3MBYA 1XSPA 1BPZA 2BCQA 7ICTA 8ICEA 3OVAA 4AT7B 5HHIA 4TUPA 4QZFA 4LZGA 4NM1A 5DB9A 5BOMA 9ICMA 4AT9B 4M0AA 2ZH1A 4UB4A 4O5KA 4GXIA 5J2IA 4AT8A 4R63A 2ZH7A 3V7JA 4RQ7A 3UPQA 8ICYA 3HJ4A 7ICLA 4K4IA 4PHEA 1ZQEA 4M47A 4MF8A 3OUYB 5J2BA 1ZQPA 4X4VA 4I2EA 4I2HA 4GXJA 4M9LA 4PGQA 4RPYA 1NO5A 4YMNA 4YN4A 7ICSA 4AT7A 4RQ8A 5F2VO 4X4PA 4RPXA 4M9GA 4P4OA 5J2EA 2ID1A 4AT9A 2ISPA 4IQVA 5TZVA 3RJHA 4NXZA 4M9NA 2W9MA 4X4RA 5DDMA 1R8CA 4PHDA 3JPRA 2M2UA 1R8BA 1Q79A 9ICGA 4RQ1A 3C2KA 1VJ7A 4WC3A 5CP2A 4KLSA 3WFPA 5HREA 5DECA 4KLIA 1R89A 1R8AA 3OUYA 4F5NA 9ICEA 5J2KA 3H38A 2P66A 4I2JA 4PGXA 4I2FA 5J0TA 4Z6FA 1ZQJA 4XRHA 4DOCA 1ZQAA 9ICNA 3K75D 4F5QA 2FMPA 9ICCA 5HR9A 1ZQYA 5J0RA 5DBAA 1ZQXA 1BPEA 4S3NA 9ICIA 4FH5A 9ICHA 3MDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC2 A;  9ICW A;  5J0S A;  3OVB A;  3RJK A;  8ICT A;  4QZG A;  9ICP A;  4E8F A;  4K4H A;  2BCV A;  1PX5 A;  4RQ3 A;  4QZI A;  4X0A A;  5DED A;  2O1P A;  1MQ2 A;  5D46 A;  1ZQZ A;  7ICP A;  1NOM A;  1ZQQ A;  4O5C A;  3JPN A;  3RJJ A;  3UXN A;  3JPS A;  2ZH5 A;  5D49 A;  3JPT A;  2FMQ A;  4WC6 A;  9ICJ A;  2M2W A;  4KLD A;  3UXO A;  4KLO A;  3HJ1 A;  8ICM A;  5J2J A;  8ICF A;  4M2Y A;  8ICA A;  1ZQB A;  2BE3 A;  4NLK A;  4WBY A;  1WOT A;  5III A;  4P4P A;  4R64 A;  1ZQI A;  2ZH2 A;  1BPX A;  4FO6 A;  7ICO A;  2GWS A;  9ICL A;  4LT6 A;  4I2G A;  9ICO A;  1TVA A;  4RQ2 A;  1JAJ A;  1ZQK A;  9ICR A;  4FHW A;  4Z6D A;  4MF2 A;  1ZQR A;  1ZQD A;  4XA5 A;  7ICK A;  5D4B A;  5J0O A;  1XSN A;  1JMS A;  8ICL A;  3AUO A;  3H39 A;  7ICI A;  4NY8 A;  2DRA A;  9ICA A;  3H3A A;  1ZQH A;  4TUR A;  2FMS A;  2ZHA A;  1UET A;  2I9G A;  4RT3 A;  4JWN A;  1MIW A;  4DOA A;  4WCW A;  5J0Y A;  1ZQM A;  8ICI A;  8ICP A;  4YMO A;  2ISO A;  7ICN A;  4GXK A;  4P2H A;  3V7L A;  2DR7 A;  5HRF A;  9ICB A;  4TUQ A;  3ISC A;  9ICV A;  9ICU A;  4KLM A;  5HRK A;  4IQU A;  2RFF A;  4IQT A;  5IIL A;  4M5D A;  2Q66 A;  1KDH A;  3RH4 A;  5DB8 A;  9ICF A;  4Z6E A;  1ZQL A;  4RQ6 A;  4X4N A;  3H37 A;  3UQ2 A;  3RJE A;  4UB5 A;  5HRD A;  1HUZ A;  4ATB B;  4KLQ A;  1VFG A;  4QZE A;  8ICW A;  8ICZ A;  4XQ8 A;  3AU6 A;  4WC5 A;  2DRB A;  8ICK A;  1F5A A;  3OGU A;  4P4M A;  4WC0 A;  1ZQT A;  3LQC B;  2BPG A;  4O9M A;  1KEJ A;  7ICQ A;  4FHP A;  3PML A;  4KLF A;  5J2A A;  8ICO A;  1UEV A;  4EP7 A;  3UQ0 A;  4MFA A;  1ZJM A;  5BOL A;  4DOB A;  4QZH A;  5HRL A;  1OU5 A;  4YD1 A;  3HX0 A;  4KLJ A;  3C66 A;  2O5A A;  9ICQ A;  4K4G A;  4ATB A;  4X4U A;  2NRK A;  2BCU A;  2DR5 A;  3B0Y A;  8ICU A;  8ICH A;  3OV7 A;  4RWN A;  2ZH8 A;  4EBK A;  1BPY A;  2VAN A;  5DBC A;  5DDY A;  3MGI A;  5J0X A;  5BPC A;  2ZH9 A;  4NKU A;  4NM2 A;  4UB3 A;  4I2I A;  4NKT A;  3RH6 A;  4RQ5 A;  3MDA A;  1ZJN A;  4E80 A;  5J0Q A;  2DVI A;  7ICR A;  9ICK A;  4X4Q A;  3RJF A;  2HHP A;  4QZD A;  4X4S A;  1RZT A;  5CA7 A;  3RJG A;  8ICG A;  3RJI A;  5HRH A;  4PGY A;  7ICV A;  1YLQ A;  4RQ4 A;  8ICR A;  2ZHB A;  4X0B A;  2PFP A;  1ZQV A;  7ICU A;  4UB1 A;  8ICN A;  3HW8 A;  5HHH A;  8ICQ A;  8ICV A;  5IIN A;  8ICB A;  3OVS A;  5HRI A;  3AQK A;  4KLH A;  1BPB A;  1ZQF A;  1ZQG A;  1ZQS A;  3C18 A;  8ICJ A;  4I27 A;  4I2D A;  4RPZ A;  4UBB A;  4Z6C A;  1UEU A;  1MQ3 A;  3AQL A;  5J29 A;  3WFQ E;  4R66 A;  3WFO A;  5CB1 A;  5HRB A;  4UD5 A;  1ZQW A;  4PHP A;  1TFY A;  4IG8 A;  3L9D A;  5DB7 A;  4QZC A;  4WBZ A;  4KLL A;  4I2A A;  4DO9 A;  5IIM A;  9ICS A;  4TUS A;  7ICJ A;  2BPC A;  4FHX A;  1TV9 A;  1RPL A;  5DKW A;  2PFO A;  4QZ9 A;  5J0W A;  3JPQ A;  2ZH4 A;  3GDX A;  5CHG A;  3PNC A;  3HWT A;  4KLU A;  4PHA A;  1ZQN A;  3V72 A;  4RWP A;  3ISB A;  3V7K A;  7ICE A;  9ICT A;  4I28 A;  2PBE A;  4QZA A;  1JN3 A;  9ICX A;  4WC1 A;  4PPX A;  3LK9 A;  4F5P A;  5J2G A;  4WC4 A;  4I2B A;  3C2L A;  4EBJ A;  4X4T A;  2IHM A;  5HC9 A;  7ICF A;  4I29 A;  3JYY A;  4XUS A;  1ZQO A;  4UAW A;  2PXI A;  5IIO A;  4M9H A;  4QZ8 A;  3RH5 A;  5J2C A;  4E7X A;  4R65 A;  4NLN A;  2ZH6 A;  4UB2 A;  5IIK A;  4RQ0 A;  1Q78 A;  1ZQC A;  4I2C A;  4KLE A;  4YMM A;  3AU2 A;  2DR9 A;  2M2V A;  3AQN A;  1HUO A;  4M9J A;  4LVS A;  7ICH A;  1TFW A;  3NYB A;  4YCX A;  5CWR A;  4UD4 A;  4FHY A;  4FHV A;  4MFC A;  5DB6 A;  2DR8 A;  5J2D A;  3WFR E;  3UPS A;  5J0P A;  3AQM A;  4RT2 A;  2BCR A;  5J2H A;  4WC7 A;  3UXP A;  1FA0 A;  2PFQ A;  4M04 A;  4RWO A;  3JPP A;  3JPO A;  3C5G A;  5EOZ A;  3PMN A;  1BPD A;  3TFS A;  4KLG A;  1KNY A;  5CJ7 A;  4X4O A;  4PH5 A;  4MFF A;  4KLT A;  2ZH3 A;  4LZD A;  1MIY A;  4JWM A;  1JQR A;  3JZ0 A;  8ICX A;  2BPF A;  4UAZ A;  4F5R A;  1MIV A;  3ISD A;  7ICG A;  2M2T A;  4UAY A;  5J0U A;  4X5V A;  5DBB A;  2PFN A;  3B0X A;  8ICC A;  4FH3 A;  3TFR A;  5CR0 A;  4NLZ A;  4RWQ A;  4YD2 A;  2BCS A;  5IIJ A;  7ICM A;  4AT8 B;  5HRG A;  3HIY A;  4XQ7 A;  1ZQU A;  4UBC A;  3C2M A;  4O5E A;  4F5O A;  8ICS A;  1V4A A;  4QZB A;  3WFS C;  5J2F A;  4IQW A;  3C5F A;  1XSL A;  3MGH A;  3MBY A;  1XSP A;  1BPZ A;  2BCQ A;  7ICT A;  8ICE A;  3OVA A;  4AT7 B;  5HHI A;  4TUP A;  4QZF A;  4LZG A;  4NM1 A;  5DB9 A;  5BOM A;  9ICM A;  4AT9 B;  4M0A A;  2ZH1 A;  4UB4 A;  4O5K A;  4GXI A;  5J2I A;  4AT8 A;  4R63 A;  2ZH7 A;  3V7J A;  4RQ7 A;  3UPQ A;  8ICY A;  3HJ4 A;  7ICL A;  4K4I A;  4PHE A;  1ZQE A;  4M47 A;  4MF8 A;  3OUY B;  5J2B A;  1ZQP A;  4X4V A;  4I2E A;  4I2H A;  4GXJ A;  4M9L A;  4PGQ A;  4RPY A;  1NO5 A;  4YMN A;  4YN4 A;  7ICS A;  4AT7 A;  4RQ8 A;  5F2V O;  4X4P A;  4RPX A;  4M9G A;  4P4O A;  5J2E A;  2ID1 A;  4AT9 A;  2ISP A;  4IQV A;  5TZV A;  3RJH A;  4NXZ A;  4M9N A;  2W9M A;  4X4R A;  5DDM A;  1R8C A;  4PHD A;  3JPR A;  2M2U A;  1R8B A;  1Q79 A;  9ICG A;  4RQ1 A;  3C2K A;  1VJ7 A;  4WC3 A;  5CP2 A;  4KLS A;  3WFP A;  5HRE A;  5DEC A;  4KLI A;  1R89 A;  1R8A A;  3OUY A;  4F5N A;  9ICE A;  5J2K A;  3H38 A;  2P66 A;  4I2J A;  4PGX A;  4I2F A;  5J0T A;  4Z6F A;  1ZQJ A;  4XRH A;  4DOC A;  1ZQA A;  9ICN A;  3K75 D;  4F5Q A;  2FMP A;  9ICC A;  5HR9 A;  1ZQY A;  5J0R A;  5DBA A;  1ZQX A;  1BPE A;  4S3N A;  9ICI A;  4FH5 A;  9ICH A;  3MDC A; 
#chains in the Genus database with same CATH topology
 4WC2 A;  9ICW A;  5J0S A;  3OVB A;  3RJK A;  8ICT A;  4QZG A;  9ICP A;  4E8F A;  4K4H A;  2BCV A;  1PX5 A;  4RQ3 A;  4QZI A;  4I0U A;  4X0A A;  5DED A;  2O1P A;  1MQ2 A;  5D46 A;  1ZQZ A;  7ICP A;  3ER8 C;  1NOM A;  1ZQQ A;  4O67 A;  4O5C A;  3JPN A;  3RJJ A;  3UXN A;  3JPS A;  2ZH5 A;  5D49 A;  3JPT A;  2FMQ A;  4WC6 A;  9ICJ A;  2M2W A;  4K99 A;  4KLD A;  3UXO A;  4KLO A;  3HJ1 A;  8ICM A;  4K9B A;  5J2J A;  8ICF A;  4M2Y A;  8ICA A;  1ZQB A;  2BE3 A;  4NLK A;  4WBY A;  1WOT A;  5III A;  4P4P A;  4R64 A;  1ZQI A;  2ZH2 A;  1BPX A;  4FO6 A;  7ICO A;  4EGW A;  3EF2 A;  4HX0 A;  2GWS A;  9ICL A;  4LT6 A;  4I2G A;  9ICO A;  1TVA A;  4OAG A;  4RQ2 A;  1JAJ A;  1ZQK A;  9ICR A;  4FHW A;  4Z6D A;  4MF2 A;  3ER9 B;  1ZQR A;  1ZQD A;  4XA5 A;  7ICK A;  5D4B A;  5J0O A;  1XSN A;  1JMS A;  8ICL A;  3AUO A;  3H39 A;  7ICI A;  4NY8 A;  2DRA A;  9ICA A;  3H3A A;  1ZQH A;  4TUR A;  2FMS A;  3MCR A;  2ZHA A;  1UET A;  2I9G A;  4RT3 A;  4JWN A;  1MIW A;  4DOA A;  4WCW A;  5J0Y A;  1ZQM A;  8ICI A;  4FO1 A;  8ICP A;  4YMO A;  2ISO A;  2B4V A;  7ICN A;  4GXK A;  4P2H A;  3V7L A;  2DR7 A;  5HRF A;  9ICB A;  4TUQ A;  3ISC A;  9ICV A;  9ICU A;  4KLM A;  5HRK A;  4IQU A;  2RFF A;  4IQT A;  5IIL A;  4M5D A;  2Q66 A;  5JTG A;  1KDH A;  3NWI A;  3RH4 A;  5DB8 A;  9ICF A;  4Z6E A;  1ZQL A;  4RQ6 A;  2BBJ A;  4X4N A;  3H37 A;  3OWG A;  4OAH A;  3UQ2 A;  3RJE A;  4UB5 A;  5HRD A;  1HUZ A;  4ATB B;  4EED A;  4KLQ A;  1VFG A;  4QZE A;  8ICW A;  8ICZ A;  4XQ8 A;  3AU6 A;  4WC5 A;  2DRB A;  4LEY A;  8ICK A;  5CHE A;  1F5A A;  3OGU A;  1GPJ A;  4P4M A;  4WC0 A;  1ZQT A;  3LQC B;  2HN2 A;  2BPG A;  4O9M A;  1KEJ A;  7ICQ A;  4FHP A;  3PML A;  4KLF A;  5J2A A;  8ICO A;  1UEV A;  4EP7 A;  3UQ0 A;  4MFA A;  1ZJM A;  5BOL A;  4DOB A;  4QZH A;  5HRL A;  4K9A A;  1OU5 A;  4YD1 A;  3HX0 A;  4KLJ A;  3C66 A;  2O5A A;  9ICQ A;  3ERC C;  4K4G A;  2GAF D;  4ATB A;  4X4U A;  2NRK A;  2BCU A;  2DR5 A;  3B0Y A;  8ICU A;  8ICH A;  4JLZ A;  3OV7 A;  4RWN A;  2ZH8 A;  4MKP A;  3NKU A;  1BPY A;  4EBK A;  2VAN A;  5DBC A;  5DDY A;  3MGI A;  5J0X A;  5BPC A;  5B3P A;  2ZH9 A;  4NKU A;  4NM2 A;  4UB3 A;  4I2I A;  2B51 A;  4NKT A;  3RH6 A;  4RQ5 A;  3MDA A;  1ZJN A;  4E80 A;  5J0Q A;  2DVI A;  7ICR A;  9ICK A;  4X4Q A;  3RJF A;  2HHP A;  4QZD A;  4X4S A;  1RZT A;  5CA7 A;  3RJG A;  8ICG A;  5B3Q A;  3RJI A;  5HRH A;  4PGY A;  7ICV A;  1YLQ A;  4RQ4 A;  8ICR A;  3K7D A;  4X0B A;  2ZHB A;  2PFP A;  1ZQV A;  7ICU A;  4UB1 A;  8ICN A;  3HW8 A;  5HHH A;  8ICQ A;  8ICV A;  5IIN A;  8ICB A;  3OVS A;  5HRI A;  3AQK A;  4KLH A;  1BPB A;  1ZQF A;  1ZQG A;  2B56 A;  1ZQS A;  3C18 A;  3JCF A;  8ICJ A;  4I27 A;  4I2D A;  4RPZ A;  4UBB A;  4Z6C A;  1UEU A;  1MQ3 A;  3AQL A;  5J29 A;  3WFQ E;  4R66 A;  3WFO A;  5CB1 A;  5HRB A;  4UD5 A;  1ZQW A;  4EEB A;  4K97 A;  4PHP A;  1TFY A;  4IG8 A;  3L9D A;  5DB7 A;  4QZC A;  4WBZ A;  4KLL A;  4I2A A;  4DO9 A;  5IIM A;  9ICS A;  2IUB A;  4TUS A;  7ICJ A;  2BPC A;  4FHX A;  1TV9 A;  1RPL A;  2HN1 A;  5DKW A;  2PFO A;  4QZ9 A;  5J0W A;  4KB6 A;  3CK6 A;  3JPQ A;  2ZH4 A;  3GDX A;  5CHG A;  3PNC A;  3HWT A;  4KLU A;  4PHA A;  1ZQN A;  3V72 A;  4RWP A;  3ISB A;  3V7K A;  7ICE A;  4N7R A;  9ICT A;  4I28 A;  2PBE A;  4QZA A;  1JN3 A;  9ICX A;  4WC1 A;  4PPX A;  3LK9 A;  4F5P A;  5J2G A;  4WC4 A;  4I2B A;  4EV6 A;  3C2L A;  4EBJ A;  4X4T A;  2IHM A;  5HC9 A;  7ICF A;  4I29 A;  3JYY A;  4XUS A;  1ZQO A;  4UAW A;  2PXI A;  5IIO A;  4M9H A;  4QZ8 A;  3RH5 A;  5J2C A;  4E7X A;  4R65 A;  4NLN A;  2ZH6 A;  4UB2 A;  5IIK A;  4RQ0 A;  1Q78 A;  1ZQC A;  4I2C A;  4KLE A;  4YMM A;  3AU2 A;  2DR9 A;  2M2V A;  3AQN A;  5CFU A;  1HUO A;  4M9J A;  4LVS A;  5D63 A;  7ICH A;  1TFW A;  4OAI Z;  3NYB A;  4YCX A;  5CWR A;  4UD4 A;  4FHY A;  4FHV A;  4MFC A;  5DB6 A;  2DR8 A;  5J2D A;  4WH5 A;  2EWR A;  2BBH A;  3WFR E;  4NXW A;  3UPS A;  5J0P A;  4O6A A;  3AQM A;  4RT2 A;  2BCR A;  5J2H A;  4NXT A;  4WC7 A;  3UXP A;  4K8V A;  1FA0 A;  2PFQ A;  4M04 A;  4RWO A;  3JPP A;  5CFT A;  3JPO A;  3C5G A;  5EOZ A;  3PMN A;  1BPD A;  3TFS A;  4KLG A;  1KNY A;  5CJ7 A;  4X4O A;  4PH5 A;  4MFF A;  4KLT A;  4WOY A;  2ZH3 A;  4LZD A;  1MIY A;  4JWM A;  1JQR A;  3JZ0 A;  8ICX A;  3PHZ A;  4O69 A;  2BPF A;  4UAZ A;  4JLX A;  4F5R A;  1MIV A;  3ISD A;  7ICG A;  2M2T A;  4UAY A;  5J0U A;  4X5V A;  5DBB A;  2PFN A;  4XJE A;  3B0X A;  8ICC A;  4FH3 A;  3TFR A;  5CR0 A;  4NLZ A;  4RWQ A;  4YD2 A;  2BCS A;  5IIJ A;  7ICM A;  4AT8 B;  5HRG A;  3HIY A;  4XQ7 A;  1ZQU A;  4UBC A;  3C2M A;  4O5E A;  4K98 A;  4F5O A;  8ICS A;  1V4A A;  4QZB A;  4OAF A;  3WFS C;  5J2F A;  4IQW A;  3C5F A;  1XSL A;  3MGH A;  3MBY A;  1XSP A;  1BPZ A;  3NVO A;  2BCQ A;  7ICT A;  8ICE A;  3OVA A;  4AT7 B;  5HHI A;  4TUP A;  4QZF A;  4LZG A;  4NM1 A;  5DB9 A;  5BOM A;  2IHO A;  9ICM A;  5D61 A;  4AT9 B;  4M0A A;  2ZH1 A;  4UB4 A;  4O5K A;  4GXI A;  5D62 A;  5J2I A;  4AT8 A;  4R63 A;  2ZH7 A;  3V7J A;  4RQ7 A;  3UPQ A;  4O68 A;  8ICY A;  3HJ4 A;  7ICL A;  4NXU A;  4K4I A;  4PHE A;  1ZQE A;  4M47 A;  4MF8 A;  3OUY B;  5J2B A;  1ZQP A;  4X4V A;  4I2E A;  4I2H A;  4GXJ A;  4M9L A;  4PGQ A;  4RPY A;  1NO5 A;  4YMN A;  4YN4 A;  7ICS A;  4AT7 A;  4RQ8 A;  4LEZ A;  5F2V O;  4X4P A;  4RPX A;  4M9G A;  4K96 A;  4P4O A;  5J2E A;  2ID1 A;  4AT9 A;  2ISP A;  4IQV A;  4NXV A;  5TZV A;  3RJH A;  4NXZ A;  2FCL A;  4M9N A;  2W9M A;  4X4R A;  5DDM A;  1R8C A;  4PHD A;  3JPR A;  2M2U A;  1R8B A;  1Q79 A;  9ICG A;  4RQ1 A;  3C2K A;  1VJ7 A;  4WC3 A;  5CP2 A;  4KLS A;  3WFP A;  5HRE A;  5DEC A;  4LEW A;  4KLI A;  1R89 A;  1R8A A;  3OUY A;  4F5N A;  9ICE A;  5J2K A;  3H38 A;  2P66 A;  4I2J A;  4PGX A;  4I2F A;  5J0T A;  2GA9 D;  4Z6F A;  1ZQJ A;  4WQL A;  4XRH A;  4KM5 A;  4DOC A;  1ZQA A;  9ICN A;  3K75 D;  4F5Q A;  2FMP A;  9ICC A;  4NXX A;  5HR9 A;  1ZQY A;  5J0R A;  5DBA A;  1ZQX A;  1BPE A;  4S3N A;  4LEV A;  4WQK A;  9ICI A;  5CFS A;  4FH5 A;  9ICH A;  3MDC A; 
#chains in the Genus database with same CATH homology
 4WC2 A;  9ICW A;  5J0S A;  3OVB A;  3RJK A;  8ICT A;  4QZG A;  9ICP A;  4E8F A;  4K4H A;  2BCV A;  1PX5 A;  4RQ3 A;  4QZI A;  4X0A A;  5DED A;  2O1P A;  1MQ2 A;  5D46 A;  1ZQZ A;  7ICP A;  1NOM A;  1ZQQ A;  4O5C A;  3JPN A;  3RJJ A;  3UXN A;  3JPS A;  2ZH5 A;  5D49 A;  3JPT A;  2FMQ A;  4WC6 A;  9ICJ A;  2M2W A;  4KLD A;  3UXO A;  4KLO A;  3HJ1 A;  8ICM A;  5J2J A;  8ICF A;  4M2Y A;  8ICA A;  1ZQB A;  2BE3 A;  4NLK A;  4WBY A;  1WOT A;  5III A;  4P4P A;  4R64 A;  1ZQI A;  2ZH2 A;  1BPX A;  4FO6 A;  7ICO A;  2GWS A;  9ICL A;  4LT6 A;  4I2G A;  9ICO A;  1TVA A;  4RQ2 A;  1JAJ A;  1ZQK A;  9ICR A;  4FHW A;  4Z6D A;  4MF2 A;  1ZQR A;  1ZQD A;  4XA5 A;  7ICK A;  5D4B A;  5J0O A;  1XSN A;  1JMS A;  8ICL A;  3AUO A;  3H39 A;  7ICI A;  4NY8 A;  2DRA A;  9ICA A;  3H3A A;  1ZQH A;  4TUR A;  2FMS A;  2ZHA A;  1UET A;  2I9G A;  4RT3 A;  4JWN A;  1MIW A;  4DOA A;  4WCW A;  5J0Y A;  1ZQM A;  8ICI A;  8ICP A;  4YMO A;  2ISO A;  7ICN A;  4GXK A;  4P2H A;  3V7L A;  2DR7 A;  5HRF A;  9ICB A;  4TUQ A;  3ISC A;  9ICV A;  9ICU A;  4KLM A;  5HRK A;  4IQU A;  2RFF A;  4IQT A;  5IIL A;  4M5D A;  2Q66 A;  1KDH A;  3RH4 A;  5DB8 A;  9ICF A;  4Z6E A;  1ZQL A;  4RQ6 A;  4X4N A;  3H37 A;  3UQ2 A;  3RJE A;  4UB5 A;  5HRD A;  1HUZ A;  4ATB B;  4KLQ A;  1VFG A;  4QZE A;  8ICW A;  8ICZ A;  4XQ8 A;  3AU6 A;  4WC5 A;  2DRB A;  8ICK A;  1F5A A;  3OGU A;  4P4M A;  4WC0 A;  1ZQT A;  3LQC B;  2BPG A;  4O9M A;  1KEJ A;  7ICQ A;  4FHP A;  3PML A;  4KLF A;  5J2A A;  8ICO A;  1UEV A;  4EP7 A;  3UQ0 A;  4MFA A;  1ZJM A;  5BOL A;  4DOB A;  4QZH A;  5HRL A;  1OU5 A;  4YD1 A;  3HX0 A;  4KLJ A;  3C66 A;  2O5A A;  9ICQ A;  4K4G A;  4ATB A;  4X4U A;  2NRK A;  2BCU A;  2DR5 A;  3B0Y A;  8ICU A;  8ICH A;  3OV7 A;  4RWN A;  2ZH8 A;  4EBK A;  1BPY A;  2VAN A;  5DBC A;  5DDY A;  3MGI A;  5J0X A;  5BPC A;  2ZH9 A;  4NKU A;  4NM2 A;  4UB3 A;  4I2I A;  4NKT A;  3RH6 A;  4RQ5 A;  3MDA A;  1ZJN A;  4E80 A;  5J0Q A;  2DVI A;  7ICR A;  9ICK A;  4X4Q A;  3RJF A;  2HHP A;  4QZD A;  4X4S A;  1RZT A;  5CA7 A;  3RJG A;  8ICG A;  3RJI A;  5HRH A;  4PGY A;  7ICV A;  1YLQ A;  4RQ4 A;  8ICR A;  2ZHB A;  4X0B A;  2PFP A;  1ZQV A;  7ICU A;  4UB1 A;  8ICN A;  3HW8 A;  5HHH A;  8ICQ A;  8ICV A;  5IIN A;  8ICB A;  3OVS A;  5HRI A;  3AQK A;  4KLH A;  1BPB A;  1ZQF A;  1ZQG A;  1ZQS A;  3C18 A;  8ICJ A;  4I27 A;  4I2D A;  4RPZ A;  4UBB A;  4Z6C A;  1UEU A;  1MQ3 A;  3AQL A;  5J29 A;  3WFQ E;  4R66 A;  3WFO A;  5CB1 A;  5HRB A;  4UD5 A;  1ZQW A;  4PHP A;  1TFY A;  4IG8 A;  3L9D A;  5DB7 A;  4QZC A;  4WBZ A;  4KLL A;  4I2A A;  4DO9 A;  5IIM A;  9ICS A;  4TUS A;  7ICJ A;  2BPC A;  4FHX A;  1TV9 A;  1RPL A;  5DKW A;  2PFO A;  4QZ9 A;  5J0W A;  3JPQ A;  2ZH4 A;  3GDX A;  5CHG A;  3PNC A;  3HWT A;  4KLU A;  4PHA A;  1ZQN A;  3V72 A;  4RWP A;  3ISB A;  3V7K A;  7ICE A;  9ICT A;  4I28 A;  2PBE A;  4QZA A;  1JN3 A;  9ICX A;  4WC1 A;  4PPX A;  3LK9 A;  4F5P A;  5J2G A;  4WC4 A;  4I2B A;  3C2L A;  4EBJ A;  4X4T A;  2IHM A;  5HC9 A;  7ICF A;  4I29 A;  3JYY A;  4XUS A;  1ZQO A;  4UAW A;  2PXI A;  5IIO A;  4M9H A;  4QZ8 A;  3RH5 A;  5J2C A;  4E7X A;  4R65 A;  4NLN A;  2ZH6 A;  4UB2 A;  5IIK A;  4RQ0 A;  1Q78 A;  1ZQC A;  4I2C A;  4KLE A;  4YMM A;  3AU2 A;  2DR9 A;  2M2V A;  3AQN A;  1HUO A;  4M9J A;  4LVS A;  7ICH A;  1TFW A;  3NYB A;  4YCX A;  5CWR A;  4UD4 A;  4FHY A;  4FHV A;  4MFC A;  5DB6 A;  2DR8 A;  5J2D A;  3WFR E;  3UPS A;  5J0P A;  3AQM A;  4RT2 A;  2BCR A;  5J2H A;  4WC7 A;  3UXP A;  1FA0 A;  2PFQ A;  4M04 A;  4RWO A;  3JPP A;  3JPO A;  3C5G A;  5EOZ A;  3PMN A;  1BPD A;  3TFS A;  4KLG A;  1KNY A;  5CJ7 A;  4X4O A;  4PH5 A;  4MFF A;  4KLT A;  2ZH3 A;  4LZD A;  1MIY A;  4JWM A;  1JQR A;  3JZ0 A;  8ICX A;  2BPF A;  4UAZ A;  4F5R A;  1MIV A;  3ISD A;  7ICG A;  2M2T A;  4UAY A;  5J0U A;  4X5V A;  5DBB A;  2PFN A;  3B0X A;  8ICC A;  4FH3 A;  3TFR A;  5CR0 A;  4NLZ A;  4RWQ A;  4YD2 A;  2BCS A;  5IIJ A;  7ICM A;  4AT8 B;  5HRG A;  3HIY A;  4XQ7 A;  1ZQU A;  4UBC A;  3C2M A;  4O5E A;  4F5O A;  8ICS A;  1V4A A;  4QZB A;  3WFS C;  5J2F A;  4IQW A;  3C5F A;  1XSL A;  3MGH A;  3MBY A;  1XSP A;  1BPZ A;  2BCQ A;  7ICT A;  8ICE A;  3OVA A;  4AT7 B;  5HHI A;  4TUP A;  4QZF A;  4LZG A;  4NM1 A;  5DB9 A;  5BOM A;  9ICM A;  4AT9 B;  4M0A A;  2ZH1 A;  4UB4 A;  4O5K A;  4GXI A;  5J2I A;  4AT8 A;  4R63 A;  2ZH7 A;  3V7J A;  4RQ7 A;  3UPQ A;  8ICY A;  3HJ4 A;  7ICL A;  4K4I A;  4PHE A;  1ZQE A;  4M47 A;  4MF8 A;  3OUY B;  5J2B A;  1ZQP A;  4X4V A;  4I2E A;  4I2H A;  4GXJ A;  4M9L A;  4PGQ A;  4RPY A;  1NO5 A;  4YMN A;  4YN4 A;  7ICS A;  4AT7 A;  4RQ8 A;  5F2V O;  4X4P A;  4RPX A;  4M9G A;  4P4O A;  5J2E A;  2ID1 A;  4AT9 A;  2ISP A;  4IQV A;  5TZV A;  3RJH A;  4NXZ A;  4M9N A;  2W9M A;  4X4R A;  5DDM A;  1R8C A;  4PHD A;  3JPR A;  2M2U A;  1R8B A;  1Q79 A;  9ICG A;  4RQ1 A;  3C2K A;  1VJ7 A;  4WC3 A;  5CP2 A;  4KLS A;  3WFP A;  5HRE A;  5DEC A;  4KLI A;  1R89 A;  1R8A A;  3OUY A;  4F5N A;  9ICE A;  5J2K A;  3H38 A;  2P66 A;  4I2J A;  4PGX A;  4I2F A;  5J0T A;  4Z6F A;  1ZQJ A;  4XRH A;  4DOC A;  1ZQA A;  9ICN A;  3K75 D;  4F5Q A;  2FMP A;  9ICC A;  5HR9 A;  1ZQY A;  5J0R A;  5DBA A;  1ZQX A;  1BPE A;  4S3N A;  9ICI A;  4FH5 A;  9ICH A;  3MDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...