5HRPA

Hiv integrase catalytic domain containing f185k + a124t mutations complexed with gsk0002
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 51
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrpA00
3EY1A 4DMNA 1NK4A 4CK1A 4FVMA 5CZ2A 4CHZA 4O44A 3RR7A 4DSLA 2R7YA 3AV9A 3K57A 4B8AB 1ASWA 4DQSA 4KPYA 3AO1A 3OS0A 4FYDA 2X6SA 4GW6A 1LW2A 4IFVA 3O4NA 4E89A 4YFUA 3VA0A 4KO0A 4E7KA 1JL2A 2ZD1A 3SV4A 3QESA 2HHSA 3KIOA 1HJRA 4RW6A 4CK3A 1C6VA 4MQ3A 5FRMA 1ITGA 4FM1A 3WNHA 1QSYA 2F8TA 2HMIA 4M3TA 4NCBA 3AVIA 5CYQA 4CHPA 4DTRA 1J9AA 3L8BA 2I5JA 4KHUA 2G8WA 4Z4HA 4KI4A 3L3UA 4RW7A 3S9HA 4J2DA 2DY4A 3OYFA 2E4LA 3HVTA 4DG1A 3SUPA 3OYCA 1SL0A 3PY8A 2QK9A 1FKPA 2D0CA 1KSPA 5HRSA 4O5BA 3CYMA 3AVFA 4AH9A 3HM9A 1XC9A 1SL1A 4FJGA 4M3YA 1RTIA 3QIOA 4HUGA 3ISNC 4CHYA 4B3OA 3O4QA 4Q5VA 3ZSXA 1IG9A 2B5JA 3UIQA 5KRSA 3SV3A 1T05A 4BE2A 5FDLA 3ULDA 1L3UA 3NCIA 5J2QA 4DSJA 1TK5A 4ELTA 4KI6A 1ZBUA 4H4MA 1TKTA 1L3VA 1HNIA 3E01A 4BDPA 4W5RA 3B6OA 1IO2A 2ZQBA 1KVCA 3AO3A 4BACA 4YNQA 3V9WA 3TAEA 2P51A 4B9UA 4FJNA 2JGUA 4B08A 1WSGA 2ETJA 4CEAA 4CJEA 4JLHA 3T1AA 3HPGA 1WSFA 1EXQA 1RT6A 3ZCMA 5KRTA 1HNVA 1VSIA 1K6YA 1WSJA 1NK8A 1L3TA 4KTQA 3S3MA 4RW4A 5KGXA 1VSJA 1VSHA 4FZZA 4C8KA 4CJSA 3LPTA 5J2PA 2HNZA 1TGOA 4CFDA 1TL3A 1X9SA 1EX4A 1EETA 3G10A 4CGJA 3KK3A 3RRHA 4DS5A 2G8UA 1KCFA 3VQCA 3AVHA 4M41A 4LH5A 1JLQA 1BHLA 5HRPA 3V9XA 4FJHA 1TKXA 3AA2A 4ICLA 4DQRA 3KK1A 1RT2A 1HQUA 3CFRA 3TR8A 1RT1A 3DOLA 2B6AA 3NGYA 4DQIA 2HHXA 4AHUA 1D5AA 3DRRA 3V4IA 4M42A 4FCYA 4CJWA 3TABA 1HRHA 1XWLA 2FBTA 1HYZA 1Q8IA 3HL8A 3HJFA 4FLWA 1TK8A 2RF2A 4OPJA 5CY4A 3EYZA 1WNSA 1A5VA 1KRPA 3NE6A 4DLEA 1BI4B 4CF2A 4DQPA 1TKZA 2XY5A 1S1TA 3HP9A 4LH4A 3TWHA 1KLMA 3DOKA 5HLFA 1KFDA 3VQBA 4Z4CA 3C6UA 3OY9A 2FC0A 3DM2A 4B9MA 4DU3A 4CEOA 4L8RB 4H8KA 4FJKA 4IBNA 4N5SA 3AVGA 4AHTA 1EP4A 4FLZA 4E0DA 1XHXA 4HVJA 1GOAA 2PYJA 4EP4A 3NDKA 2FBVA 1LWEA 3L3VA 1VSKA 3OYAA 3V6DA 1X9WA 3K2PA 4DTMA 3OYEA 3PO4A 1GOCA 1LW0A 3OJUA 3KTQA 2QXFA 3SPYA 1C1CA 3AVBA 3MEGA 2XO7A 3LWLA 1Y97A 2Z1HA 1ZBFA 4CJPA 2GUIA 1TL1A 4CIEA 3C6TA 4KTZA 2EX3A 3VA3A 4DTOA 1REVA 1WLJA 3ZSRA 5I42A 4H4OA 4CJFA 4AHVA 4M3XA 4QOZB 4F3TA 3DMJA 2LSNA 5DK5A 3M8PA 1SKSA 4ELUA 1BGXT 1MU2A 1YTAA 2Y1IA 3DLBA 3NF7A 1WN7A 3V81A 5HROA 2B4JA 4Z4IA 1LAVA 4CHOA 1CLQA 1G15A 4DSEA 3LP3A 1RT3A 1WAJA 1C1AA 1WSIA 4LY7A 4OGCA 4M3UA 1W9HA 2OYQA 3HSTB 4I9LA 3ZSZA 3I8DA 2YNFA 4DF4A 3AA4A 1JL1A 4JRQA 4R5PA 1ASVA 3RMCA 3V9UA 4B9VA 2YNIA 1QE1A 2Y1JA 1FXXA 2RN2A 2A1SA 1TAQA 1F21A 4F2RA 4FZYA 4IKFA 4FK4A 4KREA 3IG1A 4CJ5A 3M8QA 1NOZA 4CFAA 1TK0A 4DTJA 1VRUA 1FKOA 2KZMA 4CHQA 4FJ8A 4W5QA 4CF9A 5KTQA 1RBVA 4DTPA 3KLIA 4QCLA 4E1NA 1O1WA 3V9ZA 3LZJA 4ZTJA 1YTUA 2VG5A 1S6PA 2VG6A 4AHSA 4B8CA 2XY8A 4C8OA 4CJLA 4DSIA 4Y1DA 3G0ZA 3OYHA 4IG3A 4CJKA 1X9MA 3S3OA 1QTMA 4HUFA 2E6MA 3QLHA 4WE1A 3QNOA 1NJZA 2OZMA 4JS5A 2YHBA 3H08A 3ALYA 1ZBLA 3NF6A 3L2WA 2FBXA 1A5XA 4CJVA 2Z1JA 3KJVA 2W42A 4CERA 3ZSOA 4CECA 3MXIA 4KB1A 3VQ8A 1NK6A 1ZBIA 3ZT0A 2KQ2A 4B9NA 3V1QA 4I2QA 1VK0A 3NF9A 4FLXA 4GMJB 3SI6A 4KHYA 3QEPA 1JLBA 2YKMA 2KFZA 4AHCA 1YT3A 5DMRA 4CJRA 3PO5A 1HYVA 4EZ6A 3VQPA 1VSLA 1CXUA 3TAMA 4CGDA 1HYSA 1VSDA 1L3SA 4DFKA 4FJLA 2F96A 3CM5A 4RW8A 4KHWA 1U47A 1GOBA 1N5YA 2QKBA 3TAGA 4LSNA 2BDPA 2Q3SA 3SQ2A 3AA3A 3VQ9A 2D5RA 2RKIA 3AVJA 5KI6A 3ZT3A 3SYZA 2PYLA 1KLNA 3C95A 3PUFA 1JKHA 4F8RA 2IS3A 4CE9A 3VQ6A 2ATQA 3RR8A 1VRTA 2YV0X 3T3FA 4DFPA 1RNHA 5I3UA 1FK9A 4J2EA 3MEDA 3VQ4A 4KKOA 4XIUA 5HRRA 1JXBA 2Z1GA 3QINA 3NGZA 4BE1A 2FBYA 3LP2A 1RTDA 3OS1A 3PX4A 1D8YA 2G8FA 4HCCA 1CZ9A 1R0AA 2P1JA 4FJ5A 3RWUA 4CJ4A 4Q0BA 2XY7A 1IKXA 3SUQA 3LALA 1T8EA 4FK2A 2YNGA 4M3ZA 1YVUA 4FZXC 1LWCA 4DF8A 3TARA 1RTHA 3NF8A 1DLOA 3L2UA 4CF1A 4Z0UA 2VWJA 1NK9A 3IAYA 5KGWA 4QAGA 4DS4A 3PX0A 2P5OA 4CFCA 4HUEA 2KTQA 3DRSA 1SKWA 5HRNA 3ITHA 3OYLA 1C0UA 4W5TA 4IG0A 4MFBA 3U3GA 3QEWA 4UQGA 4KV8A 1XI1A 4EZ9A 3AVMA 4CIFA 3TAPA 1I39A 4FLUA 4ID1A 3HVRA 1S6QA 4NYFA 1SUQA 4OKKA 3OYIA 3EZ5A 4KB0A 4FJ9A 4CEQA 4CESA 2G8KA 4E19A 4NCAA 1T7PA 2HHVA 3VQ7A 3ZT4A 4CEEA 3OJSA 3ZT2A 1B9FA 1I3AA 1CXQA 1RILA 1RT4A 1B9DA 2WOMA 2PY5A 3QERA 4N76A 4DQQA 2HHQA 3RMAA 1RT7A 3DYAA 5CYMA 5JS1A 2EHGA 4CJ3A 3OYDA 3K5NA 1LV5A 3VQAA 3TANA 3D0PA 3MXMA 4B9SA 2OPSA 3JYTA 3AVKA 3P1GA 4KHSA 3ZT1A 4CF8A 3QNNA 3S3NA 3OYBA 4CGIA 4LD0A 1RBUA 3KD5E 2X6NA 1JLEA 3VQDA 2KW4A 3TAFA 1UA1A 1SL2A 2AJQA 2HB5A 3DLGA 4CK2A 2Z1IA 4DSKA 1ASUA 2X78A 4FW1A 3NGIA 4CEFA 3NH0A 4KHQA 3V1RA 2D0BA 1L5UA 4F2SA 4HTUA 1NJWA 2KZZA 2ITGA 2GV9A 1Z26A 1TVRA 5JS2A 1UA0A 4J2BA 4ZTFA 3WNGA 1KVBA 2YHAA 1NK0A 3DLRA 2XHBA 3KK2A 2BGGA 2DFEA 3P5JA 5FROA 3MEEA 2O4GA 3VQEA 4DU1A 4RG8A 3AVAA 2YNHA 3V1OA 2G8VA 3L2QA 3FFIA 3SUOA 2HHUA 1Z25A 2PZSA 3OVNA 3OYGA 2DFFA 4PA1A 4E1MA 1S1VA 5J2MA 1RTJA 4CGHA 3KD1E 1QHTA 4CFBA 3I0RA 2E6LA 2F8SA 3DLKA 3NH1A 4FM0A 1S9EA 3K58A 4Z4GA 1LWFA 5SWMA 3AO5A 3F9KA 3HP6A 3F73A 3QEXA 1QS4A 2IAJA 1DTTA 1QQCA 4CGFA 1JLFA 4CJTA 3OYNA 4OKJA 4FLTA 4B9LA 4FM2A 1BIZA 4Z4FA 3HO1A 3QIPA 3SNNA 4E3SA 4PUOA 5K14A 3ZSYA 3OS2A 3KKSA 4BWMA 4OKEA 4FLYA 3JSMA 3NH2A 4K8XA 1BQMA 1J53A 3WNFA 5FRNA 1CZBA 1KTQA 3V9SA 3QETA 4DTSA 1BCMA 3U6FA 1TV6A 2XY6A 4JS4A 2BE2A 4AILC 4O4GA 3PX6A 4KFBA 3K59A 2HVHA 4E7IA 5CZ1A 3SJJA 1UOCA 3KLGA 1C0MA 4DTXA 4I7FA 2OPRA 4AHRA 3PV8A 3O3GA 1WAFA 1WSHA 1TKDA 1KVAA 3HPOA 2KFNA 1BCOA 2IC3A 3SQ1A 3CFPA 1S5JA 4N41A 1JLCA 4CHNA 3M8RA 4E7HA 2OA8A 3KLEA 3ASMA 4FLVA 4CEDA 5C25A 4CF0A 3SQ0A 4BE0A 2ZE2A 4F3OA 3QEIA 1U49A 3OYKA 3CQ8A 1NK5A 1HQEA 3K5LA 3NHGA 2OZSA 4C8LA 3DRPA 1IKYA 1JLGA 4N56A 2IOCA 3RTVA 4NYNA 3SZ2A 4DSFA 1D9FA 3RRGA 3CG7A 3DI6A 4ZHRA 4N47A 1TAUA 3NFAA 1NKEA 1IKWA 4J2AA 3C94A 3P83D 3RMDA 1A5WA 1U45A 1S1WA 4TSXA 2HW3A 4CIGA 4PY5A 3LPUA 4IDKA 3ZSVA 4W5OA 2DTUA 1HPZA 4W5NA 1S1UA 2O4IA 1RCHA 3IS9A 1X1PA 5C24A 4LSLA 3L2RA 1RBSA 3QO9A 1U4BA 1RDDA 3LAKA 1C1BA 4I2PA 1WSEA 3HPHA 1NKBA 3B6PA 5T7BA 1N6QA 1QSSA 3K5OA 3KLHA 4KRFA 4G1QA 3NAEA 1BI4A 1EKEA 4E7LA 1KFSA 4CCHA 2HVIA 1DTQA 3QEVA 1RBRA 1RDAA 3CM6A 2HHWA 4CEZA 5SZTA 4PQUA 4CGGA 3DLHA 1NJYA 3HT3A 3HK2A 3TI0A 4FJXA 4OPKA 4HCBA 5C42A 4K8ZA 3ZSQA 1J5OA 4RW9A 1Q9YA 2YKNA 2NUBA 1SKRA 4FJ7A 3OYMA 4M3WA 1C0TA 4IFYA 3K5MA 1Q9XA 5HP1A 4DFJA 3O3FA 1NJXA 2VWKA 3LDSA 1SV5A 3KLFA 2IDOA 4BDYA 4DU4A 4O0JA 4DFMA 2D0AA 1T03A 4OLAA 4Z4EA 3T19A 4B9TA 3LANA 2P5GA 3A2FA 4C8NA 3THVA 1U48A 1VSMA 1UAXA 5E41A 1NKCA 3BDPA 4Y1CA 4FJIA 1IH7A 4NCGA 2HNYA 2VG7A 4OVLA 4OLBA 4M3RA 3WNEA 4PWDA 2HHTA 4OGEA 4FJJA 3AA5X 3RMBA 1BIUA 1D9DA 4JRPA 1NK7A 1S9GA 1W0HA 3SUNA 3O3HA 5D3GA 1HMVA 2GBZA 4O0IA 4DTNA 4BDZA 4I9QA 3VQ5A 2X74A 4M45A 4HHTA 4C8MA 4CEBA 4CJQA 1RBTA 1S1XA 2QKKA 3LAMA 1IKVA 3OYJA 4CJUA 4DLGA 5J2NA 3SCXA 4FJMA 1ZBHA 4FW2A 3AO2A 3I0SA 4DTUA 1BL3A 3LZIA 4KHNA 4O55A 1BQNA 1B92A 4ID5A 1VSFA 3LP0A 1J54A 4FXDA 4EP5A 3MECA 3SQ4A 4FK0A 3MAQA 3KKRA 3AVCA 3D45A 3HYFA 4GVMA 1VSEA 1UWBA 2RPIA 5J1EA 3SPZA 2OPPA 1ZYQA 1BISA 1JXEA 2WONA 3NBPA 1LAWA 4ELVA 1XHZA 3LP1A 3TAQA 3LWMA 1RDCA 2G8HA 4KAZA 3BGRA 2XRIA 4KTWA 4E7JA 3U3YA 2HNDA 5EU7A 2DFHA 2JLEA 2OPQA 1RT5A 3VN5A 1NOYA 3AVNA 3HXMA 5HBMA 4DWIA 2G8IA 1RDBA 1U04A 4BWJA 1JLAA 4OJRA 3IRXA 3MXJA 3DLEA 3AO4A 3AVLA 4F4KA 2BANA 3L2VA 3CFOA 2A1RA 1QSLA 3ZSWA 3M8SA 2IGIA 3VQQA
chains in the Genus database with same CATH superfamily
4JI2K 4CK1A 4O44A 4GVEA 4BR5A 2R7YA 4MDBA 3QBWA 3ULEB 1D4XA 1LW2A 4IFVA 1JL2A 4AM7A 5GIPA 4RW6A 1LCUA 3K0SA 2FSNA 3CQYA 2F8TA 4CW7B 4M3TA 3AVIA 5CYQA 3OHRA 2I5JA 5FLXO 4FWPA 1HKGA 4HTLA 4RW7A 2QM1A 2QK9A 2UYTA 3SMSA 4AH9A 5A2QO 3TU5A 3EL2A 1IG9A 4CBWA 3SV3A 4OO1J 2GUPA 5J2QA 5BN9A 1TKTA 3E01A 4B3TK 2HF3A 2ZQBA 4BACA 2E88A 2P51A 1QZ5A 1KXPA 2P9PA 2HOEA 4IO8A 1KAYA 3T1AA 4GV6A 1YJWN 1J6ZA 3CIPA 4HWIA 4C8KA 4FOEA 2HNZA 2I7NA 2NRZA 1TL3A 2PFUA 4H5VA 4CGJA 1KCFA 1OKJA 3MMVA 3MN9A 1SZ2A 4FJHA 2O8BB 4X65K 3KK1A 3Q7CA 2UXBK 3TR8A 5C2FA 1D5AA 3DRRA 3VGMA 1HRHA 4QS9A 1HYZA 2OCEA 2A5XA 5AQSA 4FLWA 1LOTB 3EYZA 2QW9A 3NE6A 4CF2A 4DQPA 2ZGZA 1TKZA 3VGLA 3C6UA 3DM2A 1QVFM 4IDHA 4L8RB 4H8KA 4YOWA 4E0DA 1HKBA 4AHTA 3D6RA 2PYJA 4A59A 3OYAA 4BR9A 4BC5A 3OYEA 3KD5E 3OJUA 2XO7A 3MN5A 3I33A 1Y97A 2Z1HA 4CJPA 4CIEA 3WXIA 3VA3A 1REVA 3ZSRA 4Z94A 1X9JA 4CJFA 2LSNA 5DK5A 1VQMN 1C0FA 1SKSA 3THYB 2EWSA 3WXLA 1BA1A 1R59O 4BGAA 1WSIA 4OGCA 3HBTA 1W9HA 5KPRA 3ZSZA 4I9LA 3I8DA 1NGAA 4BR0A 3AA4A 1JL1A 4FWMA 2D1KA 4R5PA 3RMCA 3V9UA 1QE1A 3VOVA 2VGNA 1TAQA 3G25A 4FWQA 4CJ5A 3M8QA 1VRUA 4CHQA 4W5QA 5KTQA 3KLIA 2BTFA 1Q18A 1W97L 3V9ZA 4ZTJA 5HOOA 1NGBA 4C8OA 4DSIA 2JWLA 3S3OA 4JI6K 3QNOA 1NGJA 2OANA 4I6MA 4JS5A 4BVPA 1QQOA 4MO5A 2FBXA 3L2WA 1A5XA 4NLCA 4BRCA 1TUUA 1YJ9N 1NG9A 2KQ2A 4B9NA 1XC3A 3D2FA 3THWB 1CXUA 3TAMA 2QWPA 1HYSA 2PAVA 1KAZA 2F96A 4RW8A 1GOBA 3J7ZO 3ZT3A 3VQ9A 2PYLA 1NLVA 3C95A 1KLNA 1JKHA 4F8RA 4CE9A 4CZMA 4J2EA 4I6MB 5BPMA 2FBYA 5AQHA 5AQOA 2G8FA 4HCCA 2XY7A 3AGKA 3SUQA 2F4VK 2A6AA 4FK2A 2YNGA 1LWCA 3FZLA 4DF8A 1RTHA 3JXUA 2VWJA 2IVNA 4XEIA 4HUEA 3CCJN 3ITHA 4GKJK 2PBDA 1C0UA 3B8AX 2ITMA 4RCHA 1U2VA 4KV8A 3TAPA 1N36K 3OYIA 3FZKA 4NCAA 2H3GX 3VQ7A 3CCMN 4CEEA 2Q2RA 4BRAA 1I3AA 1RILA 4LF9K 4N76A 4DQQA 1RDUA 2ASMA 1XNQK 5CYMA 5JS1A 3D2EA 2EHGA 4J8FA 4CJ3A 3HSCA 3OYDA 3VQAA 3TANA 1C0GA 3OYBA 3O1WA 2GWJA 4L3QA 3M3ZA 4CGIA 1RBUA 3VQDA 1UA1A 1SL2A 2ZJQL 1NJWA 3LM9A 1Z26A 1TVRA 1UA0A 3WNGA 3TPQA 5LL6Z 1VQ4N 3KK2A 1E4GT 3MEEA 2G8VA 2YNHA 2HHUA 3FFIA 5AQJA 2P9LB 4E1MA 4V19S 1S1VA 1RTJA 3KD1E 1K9MO 4CFBA 3KHYA 2E6LA 4Z4GA 4LF8K 3BY5A 3ENOA 4B1XB 3D2EB 3AO5A 1YXQA 3TSUA 4CGFA 4B1YB 1JLFA 4FLTA 4B9LA 4FM2A 1BIZA 3QIPA 3OS2A 4BROA 1GLJO 4OKEA 5GAEP 3H3OB 1P90A 4DV5K 1CZBA 3QETA 1T6CA 4KFBA 4E7IA 5JLHA 1UOCA 2YJFA 5BPLA 4MLEA 1HLUA 2OPRA 4AHRA 3ID6A 3O3GA 1TKDA 4DQ8A 1NJIO 3DXKA 1NBWA 3KLEA 4CF0A 2ZE2A 3QEIA 4JI4K 3CQ8A 5BRHA 3NHGA 2OZSA 3DRPA 3RTVA 4DSFA 3CG7A 4ZHRA 4XH5A 1IKWA 3UE5A 4PL7A 3PLAA 3SMPA 1A5WA 3WUHA 1S1WA 4TSXA 1QQNA 1X1PA 3R6MA 4YOYA 5C24A 4JD2A 1V4SA 1RBSA 2F9TA 1U4BA 4O8KA 3CXCM 1G99A 1NMNA 3KLHA 4KRFA 4G1QA 1BI4A 4JI1K 3C7NA 1RDAA 3OBYA 2HHWA 2CGJA 2E2NA 3TI0A 5AZJB 4OPKA 4HCBA 5C42A 4K8ZA 5FPMA 3VMFB 3OYMA 4M3WA 4IFYA 3O9QA 4DFJA 1VHXA 3O3FA 3LDSA 1SV5A 4DFMA 1ZC6A 1KD1O 2D0AA 3T19A 4B9TA 4C8NA 3THVA 5AQXA 4FWRA 2HNYA 2VG7A 5AJ3K 4OLBA 4M3RA 3WNEA 2V52B 3I8BA 1IBKK 4A62A 4JD2B 5BN8A 3O3HA 2UU9K 3VQ5A 3ZX3A 2O8CA 2YI1A 4FPAA 4CJQA 1S1XA 1K8AO 4CJUA 3WXMB 3AAQA 4FJMA 3QBXA 4O55A 1JJ2M 4ID5A 3LP0A 2A40A 2O8DA 2OPPA 3NBPA 1LAWA 1XHZA 4JKGB 5AQRA 5AQYA 4U7BA 4EZ9A 2HHSA 5GAHP 4DV1K 4DWIA 3AVNA 3HM8A 3EO3A 4OJRA 3IRXA 3MXJA 1EQYA 3BF3A 4F4KA 5AZIA 4WFNL 3EY1A 3O9RA 4DMNA 5GADP 1NK4A 3RR7A 5C10A 4DSLA 1DEJA 4BRNA 5AQZA 3E9OA 2X6SA 5FRNA 4E7KA 4E89A 4WFBL 3VA0A 3QESA 1NM1A 3O5BA 3SV4A 2O8DB 2P9KB 2P9SB 4CK3A 4BC4A 4WCEL 1W7AA 1QSYA 4NCBA 1TYQB 5M1OA 4CHPA 4DTRA 1J9AA 2HMPA 1YUWA 4Z4HA 2V51B 5AQQA 3OYFA 2KLAA 3OYCA 1FKPA 3SBTA 2D0CA 5HRSA 3HM9A 1XC9A 3FGUA 2P9UB 1RTIA 3H6EA 4HUGA 3ISNC 4B3OA 2GTDA 5KRSA 4BE2A 3ULDA 3DJCA 4H5RA 2WBNA 4H4MA 2WFBA 3V9WA 1WSGA 4JLHA 3HPGA 1WSFA 4LFAK 1VSIA 1K6YA 2Q1NA 1L3TA 3QB0A 4KTQA 3MWTA 3S3MA 5KGXA 1VSJA 4LF6K 3LPTA 3RSEA 4FVUA 3CCEN 2P9NB 1VQ5N 4FPBA 4BR2A 4DUYK 3AVHA 1JLQA 2FSJA 2VQEK 4ICLA 3AA2A 4DQRA 3CFRA 4DQIA 1HQUA 4GV9A 3DOLA 2B6AA 1DKGD 1N34K 4CJWA 3CPWM 1OH6A 3O9SA 5M1KA 4NO7A 3HJFA 2QWMA 5C15A 1TK8A 2RF2A 1BUPA 4BG9A 3DAWA 4IWVA 4DLEA 3DLLL 2UUAK 3WEEA 4LH4A 4OPHA 5ELZA 3VQBA 4Z4CA 4B9MA 4CEOA 4BC3A 3WXJA 3ZETA 4IBNA 4N5SA 3AVGA 3GDQA 1EP4A 4FLZA 5AQFA 2FBVA 1LWEA 1VSKA 1X9WA 4BC2A 4YDUC 3J80O 3SPYA 3AVBA 4BRQA 1HNZK 1ZBFA 3C6TA 4KTZA 2EX3A 4KH4A 2ZJRL 4H4OA 4AHVA 5AQLA 4B3MK 3M8PA 3CCQN 1BGXT 1MU2A 3DLBA 3NF7A 4Z4IA 4CHOA 1G15A 3LP3A 1RT3A 3HSTB 2YNFA 1S3XA 1FXXA 2A1SA 2ZGYA 3ATVA 4IKFA 4OX9K 4FK4A 3P4IA 3CJCA 3AARA 4A2BA 4DTJA 1FKOA 2E2PA 1RGIA 3UKRA 4CF9A 4DTPA 1O1WA 3LZJA 1GLCG 1S6PA 2VG6A 4B8CA 3H3NO 2OTLN 4Y1DA 3G0ZA 4CJKA 1X9MA 1QTMA 2E6MA 1NJZA 3MN6A 3AY9A 5C0YA 5FPDA 3H08A 3ALYA 1SS6A 2JWKA 2VQFK 3VEWA 3ZSOA 3MXIA 1ZBIA 4I2QA 1VK0A 4GMJB 2D4WA 2YKMA 4PKIA 1YT3A 3LDOA 2UXDK 1HYVA 4EZ6A 3KWIA 5AQGA 4JAXA 1VSLA 3UKUA 3FZFA 3UKRB 3VERA 1L3SA 4FJLA 3CM5A 4KHWA 4LSNA 2BDPA 3E66A 3SQ2A 3AVJA 5GAGP 3GOIA 4QS8A 4MO4A 1ATSA 5I3UA 1FK9A 2HVIA 3MEDA 4XIUA 5HRRA 1RTDA 4DUZK 4JYAK 3PX4A 1CZ9A 4FJ5A 2P1JA 4Q0BA 3NF8A 1NK9A 4QAGA 4BRFA 1SKWA 4H0VB 3G6EN 3M1FA 4IG0A 1XI1A 3HVRA 4KB0A 4FJ9A 3EZWA 5TKYA 2HF4A 1P8ZA 5HL7L 2P9PB 3JAMO 3OJSA 3ZT2A 3J7AP 3BUZB 2HBLA 1B9DA 5FPEA 2WOMA 3DYAA 4M7YA 1N32K 1NGDA 4CZLA 1GLBG 2OPSA 3JYTA 3P1GA 3ZT1A 1QQMA 1MWKA 4LD0A 3EE9A 2UUCK 3DLGA 4C1NI 3NGIA 4K41A 4CEFA 3FZMA 2WTUA 4HTUA 2KZZA 4J2BA 2YHAA 5EY4A 2BGGA 2DFEA 3P5JA 5FROA 4DU1A 2O4GA 1VQON 3W3DA 3V1OA 4KHUA 2V7ZA 3L2QA 3SUOA 1Z25A 3L0QA 5KPTA 4YORA 1QHTA 4JN4A 4BRIA 3DLKA 5AFUA 5SWMA 3O80A 1XMQK 3PIOL 4ISFA 3QEXA 2IAJA 1BWFO 4CJTA 4OKJA 4Z4FA 4FOIA 3SNNA 3TSPA 3KK7A 5JVHL 4K8XA 1BQMA 3C65A 3WNFA 4FO0A 3BP8A 3O8MA 4H0YB 2XY6A 4DR2K 2BE2A 3FE1A 3K59A 2E8AA 1YF5L 4B1ZA 3KLGA 1C0MA 4DTXA 2UXCK 3HTVA 4H5WA 3PV8A 4IOAL 1KVAA 2KFNA 2IC3A 4M7XA 2W6LA 2E2QA 1IBLK 2F9WA 4K43A 1JLCA 4RWTA 1VQ6N 1O13A 5ADXA 4E7HA 2OA8A 3ASMA 3VEZA 3SQ0A 1N8RO 4BE0A 1U49A 3K5LA 2W41A 3FZHA 4C8LA 5DM7L 2ASOA 4N56A 3N4QA 4N47A 1TAUA 4YOVA 5AQNA 4F9OA 3C94A 3RMDA 1X3MA 3OW2M 3G4SN 4LF4K 3IDHA 4DR6K 4RTFD 4LSLA 3BEXA 1CZAN 3WT0A 1RDDA 3B6PA 4JK7A 1QSSA 3NAEA 5AQKA 1DTQA 3SBGA 3CM6A 3A0IX 4JI3K 4CGGA 1VQLN 4XH4A 3HT3A 3D2FB 4JK8A 3ZSQA 1J5OA 5CR4A 4RW9A 1Q9YA 1BDGA 1SKRA 4FJ7A 3A5NC 3VGKA 4YOTA 3IKMA 4BDYA 4OLAA 2IDOA 2NNWA 4O0JA 1T03A 3LANA 1HJOA 1QZ6A 1NKCA 5M1QA 3OA9A 5GIOA 4Y1CA 4DV4K 1Q86O 4OVLA 4B1UB 1KC8O 3PIPL 3VETA 2ASPA 4OGEA 4X64K 4H0OA 1D9DA 1W0HA 1HR0K 1SQKA 2GBZA 1WB9A 4BDZA 3MWPA 2FSKA 2QA4N 4M45A 4HHTA 1BOTO 3LAMA 1IKVA 2QWQA 4FW2A 3AO2A 1BL3A 1HPMA 1U2VB 5AQMA 1HNXK 4JHDA 1B92A 2FXUA 3MECA 5EVZA 3KKRA 3AVCA 3SPZA 5J1EA 2RHKA 4CZKA 2Q0UA 1BA0A 3FFKB 2E2OA 4ELVA 3G71N 3TAQA 4KAZA 1BO5O 1RDCA 5AQUA 1VQ8N 2G8HA 4KTWA 2YHWA 5EU7A 1NOYA 3HXMA 5HBMA 3TTDA 4BWJA 2NRHA 1JLAA 3DLEA 3AVLA 1W2BM 4E1JA 2A1RA 4DR4K 3VQQA 1CLQA 3GE1A 2NRVA 3LM2A 2J4RA 3CMEN 5F2RA 4KPYA 3AO1A 4JHDB 4FYDA 4GW6A 3J81O 4YOUA 2ZD1A 3KIOA 1HJRA 3H1VX 3C0BA 3MCAB 2BH1A 1QHAA 4CZHA 4JI5K 1C6VA 4GY2B 5M1FA 5KPZA 1ITGA 3L6QA 4FM1A 3WNHA 4NXNK 2HMIA 2IVOA 4KHPK 2G8WA 3L3UA 3S9HA 2HSTA 3R8EA 2E4LA 3HVTA 3PY8A 1FJGK 4JI0K 3BZKA 4PKGA 3CC7N 4O5BA 3AVFA 1J5EK 3I55N 2F7TA 1Q81O 3CPEA 5AQTA 3AGRA 3O4QA 4CHYA 3UIQA 3NCIA 3LL3A 4YDUA 1TK5A 1ZBUA 3ZX2A 1L3VA 1HNIA 4AF1A 3B6OA 4AM6A 1IO2A 2IIRA 4B9UA 3AO3A 2YJEA 3TAEA 4CEAA 4IO9L 2ETJA 4CJEA 4JI7K 3DXKB 2WC9A 3RVCA 1JCFA 1EXQA 3ZCMA 3QFUA 4IOCL 1NK8A 3F2KA 1EO1A 4DV2K 4FZZA 2E1ZA 3GG4A 4CJSA 1X9SA 1TGOA 4CFDA 5I9EB 3G10A 3RRHA 2G8UA 2GWKA 4CZEA 4M41A 4LH5A 4DR3K 5HRPA 3T1HK 4BRMA 3CD6N 1TKXA 4NXMK 1V4TA 2HHXA 3NGYA 4AHUA 3V4IA 4M42A 3GBTA 3TABA 2FBTA 3VEVA 4PKHA 1Q8IA 3HL8A 1YI2N 1WNSA 1A5VA 1KRPA 1BI4B 4FWNA 3C7NB 2XY5A 1S1TA 3QFPA 1ZBSA 3DOKA 1JCEA 3OY9A 4B3SK 3WQUA 4ILGB 1Z05A 1MDUB 3U9ZA 1XHXA 1N33K 1GOAA 4IJAA 2WUSA 1NGIA 3IUCA 3R1XA 5BPNA 1TL1A 4DTOA 5I42A 4M3XA 4QOZB 5FPNA 2FLOA 3SLCA 1X3NA 1YTAA 2Y1IA 2AP1A 3V81A 3CJ9A 1OH5A 2FF3B 1WAJA 4LY7A 4M3UA 2A42A 2O8CB 4DF4A 2ZWHA 2P9IA 4WQ4C 4B9VA 5AR0A 1Q82O 1F21A 2W40A 5BREA 2QWLA 1YITN 4KREA 3IG1A 5F0XA 4CFAA 3QDKA 2YCHA 4JKAA 4FJ8A 4CD1A 1RBVA 4IOXA 4LFBK 4E1NA 2VG5A 3CCSN 4CZJA 2XY8A 2YX6A 4CJLA 4ILHA 4MLHA 4DR5K 4IXCA 3CCRN 3DXMA 4WE1A 3C6AA 2GEMA 3NF6A 5AZIB 5BRFA 4CJVA 3KJVA 2V7YA 2W42A 4CERA 3L4QA 4CECA 3A5OC 4KB1A 1NK6A 3ZT0A 3V1QA 4FLXA 4KHYA 2P9IB 3T1YK 1YIJN 4AHCA 1VQKN 1YJNN 4H0PA 3VQPA 4FWOA 4LFCK 4CGDA 3HZ6A 3KZBA 4CZGA 3VTHA 4ISGA 4DFKA 3ID8A 1GLDG 1OVYA 3SAFA 2RKIA 3GL1A 4BG8A 2IS3A 3RR8A 1VRTA 2YV0X 3T3FA 3VQ4A 3NGZA 1JXBA 3QINA 3LP2A 3OS1A 5JVGL 1D8YA 1M1KO 1R0AA 3E9PA 1IKXA 4CZFA 3O4WA 5EOYA 4BRLA 3TARA 3HI0A 5AQIA 4CF1A 1VAZA 4Z0UA 1RFQA 5KGWA 3HOSA 3PX0A 2P5OA 2CGKA 4CFCA 3MX2A 4BRPA 3OYLA 1T6DA 4MFBA 3U3GA 4BRKA 3EKUA 4CIFA 4FLUA 4ID1A 1SUQA 1YAGA 4YHHK 4CESA 3O1BA 1T7PA 2HHVA 1CXQA 5JICA 1NGGA 2PY5A 3QERA 2HHQA 1VQPN 3MK6A 3K5NA 1LV5A 2QWOA 3NVKA 3D0PA 3MXMA 4X62K 4B9SA 2D0OA 3RSEB 3AVKA 5M1NA 3QNNA 5GINA 4IEIA 2X6NA 3TAFA 4BVOA 4LC9B 3QICA 3MDQA 4U67L 4DSKA 1ASUA 1T3VA 3NH0A 3ZYYX 3V1RA 4KHQA 1L5UA 4WF9L 4F2SA 2ITGA 2GV9A 4JK9A 5JS2A 2QEXN 3ULEA 4ZTFA 1KVBA 1DT9A 2AA4A 1NK0A 3DLRA 3N4PA 2PZSA 3OYGA 3WEEB 2DFFA 3CF5L 2E1YA 5J2MA 4CGHA 4B1VA 4JKHA 2F8SA 3NH1A 3U8XA 1S9EA 2Q0RA 3ZETB 1LWFA 3K58A 3UB5A 4FM0A 5C2DA 3F9KA 3HP6A 3F73A 3O08A 4KH5A 3I56N 4BREA 1NGHA 3M5RA 3CJ1A 1ILYA 3HO1A 4PUOA 3LDPA 3ZSYA 1VQ7N 4FLYA 1ATRA 2VGMA 4H03B 1J53A 3V9SA 1KTQA 4JV5K 4DTSA 3U6FA 3O9UA 2O8EA 4JS4A 3PX6A 3H46O 4I7FA 3VEOA 1WSHA 4DV7K 3SAHA 4ISEA 1EWQA 4BRHA 1BCOA 1YVNA 3SQ1A 3AAPA 3CCUN 1S5JA 3MX5A 4CEDA 5C25A 4X66K 4F3OA 1NK5A 2YHXA 5AQPA 1IKYA 1JLGA 5EXWA 1IBMK 1S22A 4NYNA 4IEEA 3TSQA 3DI6A 5H1SQ 1NNEA 1NKEA 4J2AA 1U45A 2HW3A 2O8BA 4PY5A 3O9TA 3LPUA 4IDKA 3ZSVA 1HPZA 4FWLA 5KQ8A 5IT9O 2O8EB 1S1UA 1RCHA 2CH6A 3IS9A 3QMLA 5F1XA 3KVGA 2HHHK 3FLCO 3L2RA 2QXLA 5BRDA 3QO9A 3LAKA 1WBDA 4I2PA 3LDLA 3K5OA 2OTJN 4E7LA 1KFSA 3QEVA 4BGBA 4CEZA 5SZTA 4PQUA 3DLHA 1NJYA 3HK2A 2RE2A 4GKKK 3VEYA 3CHWA 2NUBA 1IG8A 4CJ7A 4CI6A 3UKUB 3K5MA 5HP1A 1SAZA 2VWKA 5E26A 3KLFA 4DU4A 4H5TA 5TKWA 3O6WA 3U4LA 1HNWK 4A5BA 1IH7A 4PWDA 2HHTA 2Q97A 3THYA 4G9ZA 1Z6RA 3AA5X 3RMBA 2A41A 4JRPA 1NK7A 3CCLN 4O0IA 1XNRK 4I9QA 2X74A 4C8MA 2QKKA 5JMVA 3SCXA 5J2NA 3LZIA 4KHNA 2A3ZA 2YHYA 1VSFA 3ZEUA 1J54A 4FXDA 3LDQA 4FK0A 3MAQA 1XMOK 3D45A 3HYFA 4GVMA 5BR9A 4BR7A 1BISA 1K73O 2WONA 4IFEA 3LP1A 3LWMA 2XRIA 2DFHA 2JLEA 2OPQA 1RT5A 3VN5A 4WQ5C 2G8IA 1DGKN 1RDBA 1U04A 3AO4A 4FWSA 3A5MC 3L2VA 3CFOA 1QSLA 1E3MA 2IGIA 2UUBK 3BZCA 4FVMA 5CZ2A 4CHZA 2IVPA 3AV9A 3OTOK 3K57A 4B8AB 1ASWA 3THWA 4EIAA 4DQSA 3OS0A 3CERA 1OH8A 3ZEUB 3O4NA 4YFUA 4KO0A 2GELA 2VYPA 3ENBA 2QWNA 4MQ3A 5FRMA 2HBJA 3L8BA 4DHYA 3S41A 1WBBA 4JEPA 4KI4A 4IJNA 3VTIA 3LDNA 5BR8K 4J2DA 3ZX0A 4JKEA 3SUPA 4DG1A 1SL0A 2DY4A 3VF6A 1KSPA 4LF7K 3CYMA 1HKCA 3E9LA 1SL1A 4FJGA 4M3YA 3QIOA 3THXA 4Q5VA 4CD3A 3ZSXA 2B5JA 2W6KA 1T05A 5FDLA 2QWRA 1L3UA 3HRGA 4DSJA 4ELTA 4KI6A 4B3RK 3ZLJA 4CZIA 4CVNE 4BDPA 4W5RA 3HOTA 4BQZA 1KVCA 4CBUA 4YNQA 4K25A 4FJNA 2JGUA 5E84A 2NRWA 4B08A 5IWAK 4A57A 4A61A 5B8HA 4FWKA 1RT6A 5KRTA 1HNVA 1WSJA 2ZF5O 4RW4A 1VSHA 3T69A 1M90O 5J2PA 3Q7BA 1EX4A 1EETA 4CBXA 3KK3A 4DS5A 3VQCA 4WQ4A 4LF5K 1BHLA 3CJ7A 4JKDA 5M1PA 1ATNA 3V9XA 2BUPA 4AQYK 4DV0K 1RT2A 4DV3K 3THXB 1RT1A 4FCYA 1U6ZA 1XWLA 4O5FA 5CY4A 4OPJA 2NLXA 3A8YA 5DM6L 1IV0A 2P9LA 3W0LA 3FR0A 3HP9A 3TWHA 1KLMA 5HLFA 1QVGM 1KFDA 3JS6A 2FC0A 1BG3A 4DU3A 4B1WB 2QI2A 3VEXA 1NGEA 4PHTX 4HVJA 2CGLA 4EP4A 4R79A 3NDKA 3CC2N 3L3VA 3V6DA 2E5LK 3K2PA 4DTMA 3PO4A 1GOCA 1LW0A 2QXFA 1C1CA 3MEGA 3CC4N 3LWLA 4H5NA 2GUIA 3VENA 3F9MA 1WLJA 1EWRA 4EHUA 4F3TA 3DMJA 2Q36A 4EAHD 4GV3A 4ELUA 4DR7K 1WN7A 3H1QA 5HROA 1K8KA 2B4JA 1LAVA 4DSEA 1C1AA 2OYQA 4JRQA 1ASVA 2YNIA 2Y1JA 2RN2A 4B9QA 3SAGA 4F2RA 4FZYA 4BRGA 3EE8A 1NOZA 1TK0A 2KZMA 3CETA 4QCLA 4OPAA 4M63C 2ZJPL 1YTUA 1E4FT 4AHSA 2GX9A 3TTFA 4QS7A 3OYHA 4IG3A 4HUFA 3QLHA 2OZMA 4H0TB 3ATUA 2YHBA 1ZBLA 3NMUA 2O8FA 1K8KB 1ZXOA 3CQXA 3IFRA 5CE3A 2Z1JA 3VQ8A 1HUXA 3C6HA 1JCGA 4XH1A 3SI6A 3NF9A 3CI5A 2FF6A 4DV6K 3QEPA 1JLBA 1WOQA 2KFZA 5DMRA 4CJRA 4BY9C 1TUYA 5AZJA 3PO5A 2KKZA 2NRRA 3BF1A 1VSDA 1U47A 1N5YA 2QKBA 3TAGA 1OVQA 2Q3SA 5LMUK 2VCPA 3AA3A 3SYZA 2D5RA 5KI6A 3PUFA 5AQVA 3VQ6A 2ATQA 1WUAA 4DFPA 1RNHA 4NB4A 4KKOA 3KTQA 2Z1GA 4BE1A 3L4IA 4WYBA 1XQSC 1MWMA 1KQSM 2O8FB 4C1NK 3RWUA 4CJ4A 4DR1K 3LALA 5LJWA 1T8EA 4M3ZA 1YVUA 4FZXC 2NZTA 1DLOA 3L2UA 4DS4A 2KTQA 3DRSA 1BU6O 5EX5A 3P38A 1NGCA 5HRNA 3R3LA 4W5TA 4NLBA 3QEWA 1KAXA 4UQGA 3AVMA 1I39A 5AFUH 1S6QA 3J8AA 4NYFA 4OKKA 3EZ5A 4CEQA 3D7EO 2G8KA 4E19A 3ZT4A 5AQWA 3PSFA 1B9FA 1RT4A 4JKGA 3RMAA 1RT7A 3ENHA 4WFAL 1GLFO 4ILJA 1I94K 3VF2A 2CH5A 4KHSA 5MLCQ 4CF8A 3S3NA 3CMAN 2AJQA 1JLEA 3OBWA 2HBMA 2KW4A 4EFHA 3T7ZA 2HB5A 4CK2A 1NMDA 2Z1IA 5LMNK 1GLEG 2X78A 1VQNN 4FW1A 4PL8A 2D0BA 4H0XB 4BQLA 4JKFA 5ADXH 4EHTA 2XHBA 3J7YP 3VQEA 3IAYA 4RG8A 3AVAA 2P9KA 2P9SA 3OVNA 3P31A 4PA1A 1S72N 2Q31A 3I0RA 1HX1A 4FL9A 1TYQA 4KBOA 3NVMA 1RDWX 1QS4A 1DTTA 1QQCA 1NGFA 3K9JA 3WXKA 3OYNA 3A5LC 3WQTA 4E3SA 3DWLA 3CJBA 5K14A 3KKSA 4BWMA 4JI8K 2P9UA 3JSMA 3NH2A 4DKWA 5C12A 1BCMA 3R9PA 1TV6A 2HVHA 4AILC 1NWKA 4O4GA 3PSIA 3SJJA 5CZ1A 4BR4A 1H1VA 3TTCA 2QTDA 1WAFA 4DB3A 1T44A 3HPOA 1VQ9N 3CFPA 4N41A 4CHNA 3M8RA 4FLVA 3IMXA 1FW6A 3K9KA 3OYKA 4JNEA 1HQEA 2D0PA 2IOCA 3SZ2A 3RRGA 3M6GA 1D9FA 2P9NA 3NFAA 3MCPA 1YHQN 3P83D 4IZ9A 4K42A 4CIGA 2DPNA 4BRDA 4W5OA 2DTUA 3VPZA 4W5NA 2E20A 3DXMB 2O4IA 4O8UA 1GLLO 3SJHA 3SK3A 1C1BA 1WSEA 3HPHA 1NKBA 3EEQA 5T7BA 4DCHA 1N6QA 2ZM6K 3F5TA 1EKEA 4CCHA 1RBRA 2HBKA 4WQ5A 4FJXA 1IJJA 1XUPO 2YKNA 4KH6A 3E1YA 3CJAA 1C0TA 1ESVA 1Q9XA 1NU0A 1NJXA 1MA9B 3VF4A 2KHOA 4JKCA 4Z4EA 4K0KK 4A5AA 2VWBA 2P5GA 3A2FA 4YOXA 4MDAA 1U48A 1VSMA 1UAXA 3MN7A 5E41A 3BDPA 4FJIA 1Y64A 4NCGA 3CCVN 4FJJA 4A2AA 3VESA 1BIUA 4FSVA 1GLAG 1S9GA 3SUNA 5D3GA 3KWGA 1HMVA 4DTNA 2NRXA 5JLFA 3P39A 2I7PA 4CEBA 1RBTA 3OYJA 4DLGA 1ZBHA 4C23A 3I0SA 4DTUA 1BQNA 4GNIA 4Y0WA 4EP5A 3SQ4A 3EN9A 3H45C 3U9DA 4JKBA 1VSEA 1UWBA 2RPIA 4YY3K 5KQDA 1ZYQA 1Q7YO 1JXEA 5CHIA 5LY3A 3EKSA 3BGRA 5LJVA 4E7JA 3U3YA 2HNDA 4UY8O 2BANA 1OH7A 3ZSWA 3M8SA 2NRTA 4FJKA
chains in the Genus database with same CATH topology
3EY1A 4DMNA 1NK4A 4CK1A 4FVMA 5CZ2A 4CHZA 4O44A 3RR7A 4DSLA 2R7YA 3AV9A 3K57A 4B8AB 1ASWA 4DQSA 4KPYA 3AO1A 3OS0A 4FYDA 2X6SA 4GW6A 1LW2A 4IFVA 3O4NA 4E89A 4YFUA 3VA0A 4KO0A 4E7KA 1JL2A 2ZD1A 3SV4A 3QESA 2HHSA 3KIOA 1HJRA 4RW6A 4CK3A 1C6VA 4MQ3A 5FRMA 1ITGA 4FM1A 3WNHA 1QSYA 2F8TA 2HMIA 4M3TA 4NCBA 3AVIA 5CYQA 4CHPA 4DTRA 1J9AA 3L8BA 2I5JA 4KHUA 2G8WA 4Z4HA 4KI4A 3L3UA 4RW7A 3S9HA 4J2DA 2DY4A 3OYFA 2E4LA 3HVTA 4DG1A 3SUPA 3OYCA 1SL0A 3PY8A 2QK9A 1FKPA 2D0CA 1KSPA 5HRSA 4O5BA 3CYMA 3AVFA 4AH9A 3HM9A 1XC9A 1SL1A 4FJGA 4M3YA 1RTIA 3QIOA 4HUGA 3ISNC 4CHYA 4B3OA 3O4QA 4Q5VA 3ZSXA 1IG9A 2B5JA 3UIQA 5KRSA 3SV3A 1T05A 4BE2A 5FDLA 3ULDA 1L3UA 3NCIA 5J2QA 4DSJA 1TK5A 4ELTA 4KI6A 1ZBUA 4H4MA 1TKTA 1L3VA 1HNIA 3E01A 4BDPA 4W5RA 3B6OA 1IO2A 2ZQBA 1KVCA 3AO3A 4BACA 4YNQA 3V9WA 3TAEA 2P51A 4B9UA 4FJNA 2JGUA 4B08A 1WSGA 2ETJA 4CEAA 4CJEA 4JLHA 3T1AA 3HPGA 1WSFA 1EXQA 1RT6A 3ZCMA 5KRTA 1HNVA 1VSIA 1K6YA 1WSJA 1NK8A 1L3TA 4KTQA 3S3MA 4RW4A 5KGXA 1VSJA 1VSHA 4FZZA 4C8KA 4CJSA 3LPTA 5J2PA 2HNZA 1TGOA 4CFDA 1TL3A 1X9SA 1EX4A 1EETA 3G10A 4CGJA 3KK3A 3RRHA 4DS5A 2G8UA 1KCFA 3VQCA 3AVHA 4M41A 4LH5A 1JLQA 1BHLA 5HRPA 3V9XA 4FJHA 1TKXA 3AA2A 4ICLA 4DQRA 3KK1A 1RT2A 1HQUA 3CFRA 3TR8A 1RT1A 3DOLA 2B6AA 3NGYA 4DQIA 2HHXA 4AHUA 1D5AA 3DRRA 3V4IA 4M42A 4FCYA 4CJWA 3TABA 1HRHA 1XWLA 2FBTA 1HYZA 1Q8IA 3HL8A 3HJFA 4FLWA 1TK8A 2RF2A 4OPJA 5CY4A 3EYZA 1WNSA 1A5VA 1KRPA 3NE6A 4DLEA 1BI4B 4CF2A 4DQPA 1TKZA 2XY5A 1S1TA 3HP9A 4LH4A 3TWHA 1KLMA 3DOKA 5HLFA 1KFDA 3VQBA 4Z4CA 3C6UA 3OY9A 2FC0A 3DM2A 4B9MA 4DU3A 4CEOA 4L8RB 4H8KA 4FJKA 4IBNA 4N5SA 3AVGA 4AHTA 1EP4A 4FLZA 4E0DA 1XHXA 4HVJA 1GOAA 2PYJA 4EP4A 3NDKA 2FBVA 1LWEA 3L3VA 1VSKA 3OYAA 3V6DA 1X9WA 3K2PA 4DTMA 3OYEA 3PO4A 1GOCA 1LW0A 3OJUA 3KTQA 2QXFA 3SPYA 1C1CA 3AVBA 3MEGA 2XO7A 3LWLA 1Y97A 2Z1HA 1ZBFA 4CJPA 2GUIA 1TL1A 4CIEA 3C6TA 4KTZA 2EX3A 3VA3A 4DTOA 1REVA 1WLJA 3ZSRA 5I42A 4H4OA 4CJFA 4AHVA 4M3XA 4QOZB 4F3TA 3DMJA 2LSNA 5DK5A 3M8PA 1SKSA 4ELUA 1BGXT 1MU2A 1YTAA 2Y1IA 3DLBA 3NF7A 1WN7A 3V81A 5HROA 2B4JA 4Z4IA 1LAVA 4CHOA 1CLQA 1G15A 4DSEA 3LP3A 1RT3A 1WAJA 1C1AA 1WSIA 4LY7A 4OGCA 4M3UA 1W9HA 2OYQA 3HSTB 4I9LA 3ZSZA 3I8DA 2YNFA 4DF4A 3AA4A 1JL1A 4JRQA 4R5PA 1ASVA 3RMCA 3V9UA 4B9VA 2YNIA 1QE1A 2Y1JA 1FXXA 2RN2A 2A1SA 1TAQA 1F21A 4F2RA 4FZYA 4IKFA 4FK4A 4KREA 3IG1A 4CJ5A 3M8QA 1NOZA 4CFAA 1TK0A 4DTJA 1VRUA 1FKOA 2KZMA 4CHQA 4FJ8A 4W5QA 4CF9A 5KTQA 1RBVA 4DTPA 3KLIA 4QCLA 4E1NA 1O1WA 3V9ZA 3LZJA 4ZTJA 1YTUA 2VG5A 1S6PA 2VG6A 4AHSA 4B8CA 2XY8A 4C8OA 4CJLA 4DSIA 4Y1DA 3G0ZA 3OYHA 4IG3A 4CJKA 1X9MA 3S3OA 1QTMA 4HUFA 2E6MA 3QLHA 4WE1A 3QNOA 1NJZA 2OZMA 4JS5A 2YHBA 3H08A 3ALYA 1ZBLA 3NF6A 3L2WA 2FBXA 1A5XA 4CJVA 2Z1JA 3KJVA 2W42A 4CERA 3ZSOA 4CECA 3MXIA 4KB1A 3VQ8A 1NK6A 1ZBIA 3ZT0A 2KQ2A 4B9NA 3V1QA 4I2QA 1VK0A 3NF9A 4FLXA 4GMJB 3SI6A 4KHYA 3QEPA 1JLBA 2YKMA 2KFZA 4AHCA 1YT3A 5DMRA 4CJRA 3PO5A 1HYVA 4EZ6A 3VQPA 1VSLA 1CXUA 3TAMA 4CGDA 1HYSA 1VSDA 1L3SA 4DFKA 4FJLA 2F96A 3CM5A 4RW8A 4KHWA 1U47A 1GOBA 1N5YA 2QKBA 3TAGA 4LSNA 2BDPA 2Q3SA 3SQ2A 3AA3A 3VQ9A 2D5RA 2RKIA 3AVJA 5KI6A 3ZT3A 3SYZA 2PYLA 1KLNA 3C95A 3PUFA 1JKHA 4F8RA 2IS3A 4CE9A 3VQ6A 2ATQA 3RR8A 1VRTA 2YV0X 3T3FA 4DFPA 1RNHA 5I3UA 1FK9A 4J2EA 3MEDA 3VQ4A 4KKOA 4XIUA 5HRRA 1JXBA 2Z1GA 3QINA 3NGZA 4BE1A 2FBYA 3LP2A 1RTDA 3OS1A 3PX4A 1D8YA 2G8FA 4HCCA 1CZ9A 1R0AA 2P1JA 4FJ5A 3RWUA 4CJ4A 4Q0BA 2XY7A 1IKXA 3SUQA 3LALA 1T8EA 4FK2A 2YNGA 4M3ZA 1YVUA 4FZXC 1LWCA 4DF8A 3TARA 1RTHA 3NF8A 1DLOA 3L2UA 4CF1A 4Z0UA 2VWJA 1NK9A 3IAYA 5KGWA 4QAGA 4DS4A 3PX0A 2P5OA 4CFCA 4HUEA 2KTQA 3DRSA 1SKWA 5HRNA 3ITHA 3OYLA 1C0UA 4W5TA 4IG0A 4MFBA 3U3GA 3QEWA 4UQGA 4KV8A 1XI1A 4EZ9A 3AVMA 4CIFA 3TAPA 1I39A 4FLUA 4ID1A 3HVRA 1S6QA 4NYFA 1SUQA 4OKKA 3OYIA 3EZ5A 4KB0A 4FJ9A 4CEQA 4CESA 2G8KA 4E19A 4NCAA 1T7PA 2HHVA 3VQ7A 3ZT4A 4CEEA 3OJSA 3ZT2A 1B9FA 1I3AA 1CXQA 1RILA 1RT4A 1B9DA 2WOMA 2PY5A 3QERA 4N76A 4DQQA 2HHQA 3RMAA 1RT7A 3DYAA 5CYMA 5JS1A 2EHGA 4CJ3A 3OYDA 3K5NA 1LV5A 3VQAA 3TANA 3D0PA 3MXMA 4B9SA 2OPSA 3JYTA 3AVKA 3P1GA 4KHSA 3ZT1A 4CF8A 3QNNA 3S3NA 3OYBA 4CGIA 4LD0A 1RBUA 3KD5E 2X6NA 1JLEA 3VQDA 2KW4A 3TAFA 1UA1A 1SL2A 2AJQA 2HB5A 3DLGA 4CK2A 2Z1IA 4DSKA 1ASUA 2X78A 4FW1A 3NGIA 4CEFA 3NH0A 4KHQA 3V1RA 2D0BA 1L5UA 4F2SA 4HTUA 1NJWA 2KZZA 2ITGA 2GV9A 1Z26A 1TVRA 5JS2A 1UA0A 4J2BA 4ZTFA 3WNGA 1KVBA 2YHAA 1NK0A 3DLRA 2XHBA 3KK2A 2BGGA 2DFEA 3P5JA 5FROA 3MEEA 2O4GA 3VQEA 4DU1A 4RG8A 3AVAA 2YNHA 3V1OA 2G8VA 3L2QA 3FFIA 3SUOA 2HHUA 1Z25A 2PZSA 3OVNA 3OYGA 2DFFA 4PA1A 4E1MA 1S1VA 5J2MA 1RTJA 4CGHA 3KD1E 1QHTA 4CFBA 3I0RA 2E6LA 2F8SA 3DLKA 3NH1A 4FM0A 1S9EA 3K58A 4Z4GA 1LWFA 5SWMA 3AO5A 3F9KA 3HP6A 3F73A 3QEXA 1QS4A 2IAJA 1DTTA 1QQCA 4CGFA 1JLFA 4CJTA 3OYNA 4OKJA 4FLTA 4B9LA 4FM2A 1BIZA 4Z4FA 3HO1A 3QIPA 3SNNA 4E3SA 4PUOA 5K14A 3ZSYA 3OS2A 3KKSA 4BWMA 4OKEA 4FLYA 3JSMA 3NH2A 4K8XA 1BQMA 1J53A 3WNFA 5FRNA 1CZBA 1KTQA 3V9SA 3QETA 4DTSA 1BCMA 3U6FA 1TV6A 2XY6A 4JS4A 2BE2A 4AILC 4O4GA 3PX6A 4KFBA 3K59A 2HVHA 4E7IA 5CZ1A 3SJJA 1UOCA 3KLGA 1C0MA 4DTXA 4I7FA 2OPRA 4AHRA 3PV8A 3O3GA 1WAFA 1WSHA 1TKDA 1KVAA 3HPOA 2KFNA 1BCOA 2IC3A 3SQ1A 3CFPA 1S5JA 4N41A 1JLCA 4CHNA 3M8RA 4E7HA 2OA8A 3KLEA 3ASMA 4FLVA 4CEDA 5C25A 4CF0A 3SQ0A 4BE0A 2ZE2A 4F3OA 3QEIA 1U49A 3OYKA 3CQ8A 1NK5A 1HQEA 3K5LA 3NHGA 2OZSA 4C8LA 3DRPA 1IKYA 1JLGA 4N56A 2IOCA 3RTVA 4NYNA 3SZ2A 4DSFA 1D9FA 3RRGA 3CG7A 3DI6A 4ZHRA 4N47A 1TAUA 3NFAA 1NKEA 1IKWA 4J2AA 3C94A 3P83D 3RMDA 1A5WA 1U45A 1S1WA 4TSXA 2HW3A 4CIGA 4PY5A 3LPUA 4IDKA 3ZSVA 4W5OA 2DTUA 1HPZA 4W5NA 1S1UA 2O4IA 1RCHA 3IS9A 1X1PA 5C24A 4LSLA 3L2RA 1RBSA 3QO9A 1U4BA 1RDDA 3LAKA 1C1BA 4I2PA 1WSEA 3HPHA 1NKBA 3B6PA 5T7BA 1N6QA 1QSSA 3K5OA 3KLHA 4KRFA 4G1QA 3NAEA 1BI4A 1EKEA 4E7LA 1KFSA 4CCHA 2HVIA 1DTQA 3QEVA 1RBRA 1RDAA 3CM6A 2HHWA 4CEZA 5SZTA 4PQUA 4CGGA 3DLHA 1NJYA 3HT3A 3HK2A 3TI0A 4FJXA 4OPKA 4HCBA 5C42A 4K8ZA 3ZSQA 1J5OA 4RW9A 1Q9YA 2YKNA 2NUBA 1SKRA 4FJ7A 3OYMA 4M3WA 1C0TA 4IFYA 3K5MA 1Q9XA 5HP1A 4DFJA 3O3FA 1NJXA 2VWKA 3LDSA 1SV5A 3KLFA 2IDOA 4BDYA 4DU4A 4O0JA 4DFMA 2D0AA 1T03A 4OLAA 4Z4EA 3T19A 4B9TA 3LANA 2P5GA 3A2FA 4C8NA 3THVA 1U48A 1VSMA 1UAXA 5E41A 1NKCA 3BDPA 4Y1CA 4FJIA 1IH7A 4NCGA 2HNYA 2VG7A 4OVLA 4OLBA 4M3RA 3WNEA 4PWDA 2HHTA 4OGEA 4FJJA 3AA5X 3RMBA 1BIUA 1D9DA 4JRPA 1NK7A 1S9GA 1W0HA 3SUNA 3O3HA 5D3GA 1HMVA 2GBZA 4O0IA 4DTNA 4BDZA 4I9QA 3VQ5A 2X74A 4M45A 4HHTA 4C8MA 4CEBA 4CJQA 1RBTA 1S1XA 2QKKA 3LAMA 1IKVA 3OYJA 4CJUA 4DLGA 5J2NA 3SCXA 4FJMA 1ZBHA 4FW2A 3AO2A 3I0SA 4DTUA 1BL3A 3LZIA 4KHNA 4O55A 1BQNA 1B92A 4ID5A 1VSFA 3LP0A 1J54A 4FXDA 4EP5A 3MECA 3SQ4A 4FK0A 3MAQA 3KKRA 3AVCA 3D45A 3HYFA 4GVMA 1VSEA 1UWBA 2RPIA 5J1EA 3SPZA 2OPPA 1ZYQA 1BISA 1JXEA 2WONA 3NBPA 1LAWA 4ELVA 1XHZA 3LP1A 3TAQA 3LWMA 1RDCA 2G8HA 4KAZA 3BGRA 2XRIA 4KTWA 4E7JA 3U3YA 2HNDA 5EU7A 2DFHA 2JLEA 2OPQA 1RT5A 3VN5A 1NOYA 3AVNA 3HXMA 5HBMA 4DWIA 2G8IA 1RDBA 1U04A 4BWJA 1JLAA 4OJRA 3IRXA 3MXJA 3DLEA 3AO4A 3AVLA 4F4KA 2BANA 3L2VA 3CFOA 2A1RA 1QSLA 3ZSWA 3M8SA 2IGIA 3VQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY1 A;  4DMN A;  1NK4 A;  4CK1 A;  4FVM A;  5CZ2 A;  4CHZ A;  4O44 A;  3RR7 A;  4DSL A;  2R7Y A;  3AV9 A;  3K57 A;  4B8A B;  1ASW A;  4DQS A;  4KPY A;  3AO1 A;  3OS0 A;  4FYD A;  2X6S A;  4GW6 A;  1LW2 A;  4IFV A;  3O4N A;  4E89 A;  4YFU A;  3VA0 A;  4KO0 A;  4E7K A;  1JL2 A;  2ZD1 A;  3SV4 A;  3QES A;  2HHS A;  3KIO A;  1HJR A;  4RW6 A;  4CK3 A;  1C6V A;  4MQ3 A;  5FRM A;  1ITG A;  4FM1 A;  3WNH A;  1QSY A;  2F8T A;  2HMI A;  4M3T A;  4NCB A;  3AVI A;  5CYQ A;  4CHP A;  4DTR A;  1J9A A;  3L8B A;  2I5J A;  4KHU A;  2G8W A;  4Z4H A;  4KI4 A;  3L3U A;  4RW7 A;  3S9H A;  4J2D A;  2DY4 A;  3OYF A;  2E4L A;  3HVT A;  4DG1 A;  3SUP A;  3OYC A;  1SL0 A;  3PY8 A;  2QK9 A;  1FKP A;  2D0C A;  1KSP A;  5HRS A;  4O5B A;  3CYM A;  3AVF A;  4AH9 A;  3HM9 A;  1XC9 A;  1SL1 A;  4FJG A;  4M3Y A;  1RTI A;  3QIO A;  4HUG A;  3ISN C;  4CHY A;  4B3O A;  3O4Q A;  4Q5V A;  3ZSX A;  1IG9 A;  2B5J A;  3UIQ A;  5KRS A;  3SV3 A;  1T05 A;  4BE2 A;  5FDL A;  3ULD A;  1L3U A;  3NCI A;  5J2Q A;  4DSJ A;  1TK5 A;  4ELT A;  4KI6 A;  1ZBU A;  4H4M A;  1TKT A;  1L3V A;  1HNI A;  3E01 A;  4BDP A;  4W5R A;  3B6O A;  1IO2 A;  2ZQB A;  1KVC A;  3AO3 A;  4BAC A;  4YNQ A;  3V9W A;  3TAE A;  2P51 A;  4B9U A;  4FJN A;  2JGU A;  4B08 A;  1WSG A;  2ETJ A;  4CEA A;  4CJE A;  4JLH A;  3T1A A;  3HPG A;  1WSF A;  1EXQ A;  1RT6 A;  3ZCM A;  5KRT A;  1HNV A;  1VSI A;  1K6Y A;  1WSJ A;  1NK8 A;  1L3T A;  4KTQ A;  3S3M A;  4RW4 A;  5KGX A;  1VSJ A;  1VSH A;  4FZZ A;  4C8K A;  4CJS A;  3LPT A;  5J2P A;  2HNZ A;  1TGO A;  4CFD A;  1TL3 A;  1X9S A;  1EX4 A;  1EET A;  3G10 A;  4CGJ A;  3KK3 A;  3RRH A;  4DS5 A;  2G8U A;  1KCF A;  3VQC A;  3AVH A;  4M41 A;  4LH5 A;  1JLQ A;  1BHL A;  5HRP A;  3V9X A;  4FJH A;  1TKX A;  3AA2 A;  4ICL A;  4DQR A;  3KK1 A;  1RT2 A;  1HQU A;  3CFR A;  3TR8 A;  1RT1 A;  3DOL A;  2B6A A;  3NGY A;  4DQI A;  2HHX A;  4AHU A;  1D5A A;  3DRR A;  3V4I A;  4M42 A;  4FCY A;  4CJW A;  3TAB A;  1HRH A;  1XWL A;  2FBT A;  1HYZ A;  1Q8I A;  3HL8 A;  3HJF A;  4FLW A;  1TK8 A;  2RF2 A;  4OPJ A;  5CY4 A;  3EYZ A;  1WNS A;  1A5V A;  1KRP A;  3NE6 A;  4DLE A;  1BI4 B;  4CF2 A;  4DQP A;  1TKZ A;  2XY5 A;  1S1T A;  3HP9 A;  4LH4 A;  3TWH A;  1KLM A;  3DOK A;  5HLF A;  1KFD A;  3VQB A;  4Z4C A;  3C6U A;  3OY9 A;  2FC0 A;  3DM2 A;  4B9M A;  4DU3 A;  4CEO A;  4L8R B;  4H8K A;  4FJK A;  4IBN A;  4N5S A;  3AVG A;  4AHT A;  1EP4 A;  4FLZ A;  4E0D A;  1XHX A;  4HVJ A;  1GOA A;  2PYJ A;  4EP4 A;  3NDK A;  2FBV A;  1LWE A;  3L3V A;  1VSK A;  3OYA A;  3V6D A;  1X9W A;  3K2P A;  4DTM A;  3OYE A;  3PO4 A;  1GOC A;  1LW0 A;  3OJU A;  3KTQ A;  2QXF A;  3SPY A;  1C1C A;  3AVB A;  3MEG A;  2XO7 A;  3LWL A;  1Y97 A;  2Z1H A;  1ZBF A;  4CJP A;  2GUI A;  1TL1 A;  4CIE A;  3C6T A;  4KTZ A;  2EX3 A;  3VA3 A;  4DTO A;  1REV A;  1WLJ A;  3ZSR A;  5I42 A;  4H4O A;  4CJF A;  4AHV A;  4M3X A;  4QOZ B;  4F3T A;  3DMJ A;  2LSN A;  5DK5 A;  3M8P A;  1SKS A;  4ELU A;  1BGX T;  1MU2 A;  1YTA A;  2Y1I A;  3DLB A;  3NF7 A;  1WN7 A;  3V81 A;  5HRO A;  2B4J A;  4Z4I A;  1LAV A;  4CHO A;  1CLQ A;  1G15 A;  4DSE A;  3LP3 A;  1RT3 A;  1WAJ A;  1C1A A;  1WSI A;  4LY7 A;  4OGC A;  4M3U A;  1W9H A;  2OYQ A;  3HST B;  4I9L A;  3ZSZ A;  3I8D A;  2YNF A;  4DF4 A;  3AA4 A;  1JL1 A;  4JRQ A;  4R5P A;  1ASV A;  3RMC A;  3V9U A;  4B9V A;  2YNI A;  1QE1 A;  2Y1J A;  1FXX A;  2RN2 A;  2A1S A;  1TAQ A;  1F21 A;  4F2R A;  4FZY A;  4IKF A;  4FK4 A;  4KRE A;  3IG1 A;  4CJ5 A;  3M8Q A;  1NOZ A;  4CFA A;  1TK0 A;  4DTJ A;  1VRU A;  1FKO A;  2KZM A;  4CHQ A;  4FJ8 A;  4W5Q A;  4CF9 A;  5KTQ A;  1RBV A;  4DTP A;  3KLI A;  4QCL A;  4E1N A;  1O1W A;  3V9Z A;  3LZJ A;  4ZTJ A;  1YTU A;  2VG5 A;  1S6P A;  2VG6 A;  4AHS A;  4B8C A;  2XY8 A;  4C8O A;  4CJL A;  4DSI A;  4Y1D A;  3G0Z A;  3OYH A;  4IG3 A;  4CJK A;  1X9M A;  3S3O A;  1QTM A;  4HUF A;  2E6M A;  3QLH A;  4WE1 A;  3QNO A;  1NJZ A;  2OZM A;  4JS5 A;  2YHB A;  3H08 A;  3ALY A;  1ZBL A;  3NF6 A;  3L2W A;  2FBX A;  1A5X A;  4CJV A;  2Z1J A;  3KJV A;  2W42 A;  4CER A;  3ZSO A;  4CEC A;  3MXI A;  4KB1 A;  3VQ8 A;  1NK6 A;  1ZBI A;  3ZT0 A;  2KQ2 A;  4B9N A;  3V1Q A;  4I2Q A;  1VK0 A;  3NF9 A;  4FLX A;  4GMJ B;  3SI6 A;  4KHY A;  3QEP A;  1JLB A;  2YKM A;  2KFZ A;  4AHC A;  1YT3 A;  5DMR A;  4CJR A;  3PO5 A;  1HYV A;  4EZ6 A;  3VQP A;  1VSL A;  1CXU A;  3TAM A;  4CGD A;  1HYS A;  1VSD A;  1L3S A;  4DFK A;  4FJL A;  2F96 A;  3CM5 A;  4RW8 A;  4KHW A;  1U47 A;  1GOB A;  1N5Y A;  2QKB A;  3TAG A;  4LSN A;  2BDP A;  2Q3S A;  3SQ2 A;  3AA3 A;  3VQ9 A;  2D5R A;  2RKI A;  3AVJ A;  5KI6 A;  3ZT3 A;  3SYZ A;  2PYL A;  1KLN A;  3C95 A;  3PUF A;  1JKH A;  4F8R A;  2IS3 A;  4CE9 A;  3VQ6 A;  2ATQ A;  3RR8 A;  1VRT A;  2YV0 X;  3T3F A;  4DFP A;  1RNH A;  5I3U A;  1FK9 A;  4J2E A;  3MED A;  3VQ4 A;  4KKO A;  4XIU A;  5HRR A;  1JXB A;  2Z1G A;  3QIN A;  3NGZ A;  4BE1 A;  2FBY A;  3LP2 A;  1RTD A;  3OS1 A;  3PX4 A;  1D8Y A;  2G8F A;  4HCC A;  1CZ9 A;  1R0A A;  2P1J A;  4FJ5 A;  3RWU A;  4CJ4 A;  4Q0B A;  2XY7 A;  1IKX A;  3SUQ A;  3LAL A;  1T8E A;  4FK2 A;  2YNG A;  4M3Z A;  1YVU A;  4FZX C;  1LWC A;  4DF8 A;  3TAR A;  1RTH A;  3NF8 A;  1DLO A;  3L2U A;  4CF1 A;  4Z0U A;  2VWJ A;  1NK9 A;  3IAY A;  5KGW A;  4QAG A;  4DS4 A;  3PX0 A;  2P5O A;  4CFC A;  4HUE A;  2KTQ A;  3DRS A;  1SKW A;  5HRN A;  3ITH A;  3OYL A;  1C0U A;  4W5T A;  4IG0 A;  4MFB A;  3U3G A;  3QEW A;  4UQG A;  4KV8 A;  1XI1 A;  4EZ9 A;  3AVM A;  4CIF A;  3TAP A;  1I39 A;  4FLU A;  4ID1 A;  3HVR A;  1S6Q A;  4NYF A;  1SUQ A;  4OKK A;  3OYI A;  3EZ5 A;  4KB0 A;  4FJ9 A;  4CEQ A;  4CES A;  2G8K A;  4E19 A;  4NCA A;  1T7P A;  2HHV A;  3VQ7 A;  3ZT4 A;  4CEE A;  3OJS A;  3ZT2 A;  1B9F A;  1I3A A;  1CXQ A;  1RIL A;  1RT4 A;  1B9D A;  2WOM A;  2PY5 A;  3QER A;  4N76 A;  4DQQ A;  2HHQ A;  3RMA A;  1RT7 A;  3DYA A;  5CYM A;  5JS1 A;  2EHG A;  4CJ3 A;  3OYD A;  3K5N A;  1LV5 A;  3VQA A;  3TAN A;  3D0P A;  3MXM A;  4B9S A;  2OPS A;  3JYT A;  3AVK A;  3P1G A;  4KHS A;  3ZT1 A;  4CF8 A;  3QNN A;  3S3N A;  3OYB A;  4CGI A;  4LD0 A;  1RBU A;  3KD5 E;  2X6N A;  1JLE A;  3VQD A;  2KW4 A;  3TAF A;  1UA1 A;  1SL2 A;  2AJQ A;  2HB5 A;  3DLG A;  4CK2 A;  2Z1I A;  4DSK A;  1ASU A;  2X78 A;  4FW1 A;  3NGI A;  4CEF A;  3NH0 A;  4KHQ A;  3V1R A;  2D0B A;  1L5U A;  4F2S A;  4HTU A;  1NJW A;  2KZZ A;  2ITG A;  2GV9 A;  1Z26 A;  1TVR A;  5JS2 A;  1UA0 A;  4J2B A;  4ZTF A;  3WNG A;  1KVB A;  2YHA A;  1NK0 A;  3DLR A;  2XHB A;  3KK2 A;  2BGG A;  2DFE A;  3P5J A;  5FRO A;  3MEE A;  2O4G A;  3VQE A;  4DU1 A;  4RG8 A;  3AVA A;  2YNH A;  3V1O A;  2G8V A;  3L2Q A;  3FFI A;  3SUO A;  2HHU A;  1Z25 A;  2PZS A;  3OVN A;  3OYG A;  2DFF A;  4PA1 A;  4E1M A;  1S1V A;  5J2M A;  1RTJ A;  4CGH A;  3KD1 E;  1QHT A;  4CFB A;  3I0R A;  2E6L A;  2F8S A;  3DLK A;  3NH1 A;  4FM0 A;  1S9E A;  3K58 A;  4Z4G A;  1LWF A;  5SWM A;  3AO5 A;  3F9K A;  3HP6 A;  3F73 A;  3QEX A;  1QS4 A;  2IAJ A;  1DTT A;  1QQC A;  4CGF A;  1JLF A;  4CJT A;  3OYN A;  4OKJ A;  4FLT A;  4B9L A;  4FM2 A;  1BIZ A;  4Z4F A;  3HO1 A;  3QIP A;  3SNN A;  4E3S A;  4PUO A;  5K14 A;  3ZSY A;  3OS2 A;  3KKS A;  4BWM A;  4OKE A;  4FLY A;  3JSM A;  3NH2 A;  4K8X A;  1BQM A;  1J53 A;  3WNF A;  5FRN A;  1CZB A;  1KTQ A;  3V9S A;  3QET A;  4DTS A;  1BCM A;  3U6F A;  1TV6 A;  2XY6 A;  4JS4 A;  2BE2 A;  4AIL C;  4O4G A;  3PX6 A;  4KFB A;  3K59 A;  2HVH A;  4E7I A;  5CZ1 A;  3SJJ A;  1UOC A;  3KLG A;  1C0M A;  4DTX A;  4I7F A;  2OPR A;  4AHR A;  3PV8 A;  3O3G A;  1WAF A;  1WSH A;  1TKD A;  1KVA A;  3HPO A;  2KFN A;  1BCO A;  2IC3 A;  3SQ1 A;  3CFP A;  1S5J A;  4N41 A;  1JLC A;  4CHN A;  3M8R A;  4E7H A;  2OA8 A;  3KLE A;  3ASM A;  4FLV A;  4CED A;  5C25 A;  4CF0 A;  3SQ0 A;  4BE0 A;  2ZE2 A;  4F3O A;  3QEI A;  1U49 A;  3OYK A;  3CQ8 A;  1NK5 A;  1HQE A;  3K5L A;  3NHG A;  2OZS A;  4C8L A;  3DRP A;  1IKY A;  1JLG A;  4N56 A;  2IOC A;  3RTV A;  4NYN A;  3SZ2 A;  4DSF A;  1D9F A;  3RRG A;  3CG7 A;  3DI6 A;  4ZHR A;  4N47 A;  1TAU A;  3NFA A;  1NKE A;  1IKW A;  4J2A A;  3C94 A;  3P83 D;  3RMD A;  1A5W A;  1U45 A;  1S1W A;  4TSX A;  2HW3 A;  4CIG A;  4PY5 A;  3LPU A;  4IDK A;  3ZSV A;  4W5O A;  2DTU A;  1HPZ A;  4W5N A;  1S1U A;  2O4I A;  1RCH A;  3IS9 A;  1X1P A;  5C24 A;  4LSL A;  3L2R A;  1RBS A;  3QO9 A;  1U4B A;  1RDD A;  3LAK A;  1C1B A;  4I2P A;  1WSE A;  3HPH A;  1NKB A;  3B6P A;  5T7B A;  1N6Q A;  1QSS A;  3K5O A;  3KLH A;  4KRF A;  4G1Q A;  3NAE A;  1BI4 A;  1EKE A;  4E7L A;  1KFS A;  4CCH A;  2HVI A;  1DTQ A;  3QEV A;  1RBR A;  1RDA A;  3CM6 A;  2HHW A;  4CEZ A;  5SZT A;  4PQU A;  4CGG A;  3DLH A;  1NJY A;  3HT3 A;  3HK2 A;  3TI0 A;  4FJX A;  4OPK A;  4HCB A;  5C42 A;  4K8Z A;  3ZSQ A;  1J5O A;  4RW9 A;  1Q9Y A;  2YKN A;  2NUB A;  1SKR A;  4FJ7 A;  3OYM A;  4M3W A;  1C0T A;  4IFY A;  3K5M A;  1Q9X A;  5HP1 A;  4DFJ A;  3O3F A;  1NJX A;  2VWK A;  3LDS A;  1SV5 A;  3KLF A;  2IDO A;  4BDY A;  4DU4 A;  4O0J A;  4DFM A;  2D0A A;  1T03 A;  4OLA A;  4Z4E A;  3T19 A;  4B9T A;  3LAN A;  2P5G A;  3A2F A;  4C8N A;  3THV A;  1U48 A;  1VSM A;  1UAX A;  5E41 A;  1NKC A;  3BDP A;  4Y1C A;  4FJI A;  1IH7 A;  4NCG A;  2HNY A;  2VG7 A;  4OVL A;  4OLB A;  4M3R A;  3WNE A;  4PWD A;  2HHT A;  4OGE A;  4FJJ A;  3AA5 X;  3RMB A;  1BIU A;  1D9D A;  4JRP A;  1NK7 A;  1S9G A;  1W0H A;  3SUN A;  3O3H A;  5D3G A;  1HMV A;  2GBZ A;  4O0I A;  4DTN A;  4BDZ A;  4I9Q A;  3VQ5 A;  2X74 A;  4M45 A;  4HHT A;  4C8M A;  4CEB A;  4CJQ A;  1RBT A;  1S1X A;  2QKK A;  3LAM A;  1IKV A;  3OYJ A;  4CJU A;  4DLG A;  5J2N A;  3SCX A;  4FJM A;  1ZBH A;  4FW2 A;  3AO2 A;  3I0S A;  4DTU A;  1BL3 A;  3LZI A;  4KHN A;  4O55 A;  1BQN A;  1B92 A;  4ID5 A;  1VSF A;  3LP0 A;  1J54 A;  4FXD A;  4EP5 A;  3MEC A;  3SQ4 A;  4FK0 A;  3MAQ A;  3KKR A;  3AVC A;  3D45 A;  3HYF A;  4GVM A;  1VSE A;  1UWB A;  2RPI A;  5J1E A;  3SPZ A;  2OPP A;  1ZYQ A;  1BIS A;  1JXE A;  2WON A;  3NBP A;  1LAW A;  4ELV A;  1XHZ A;  3LP1 A;  3TAQ A;  3LWM A;  1RDC A;  2G8H A;  4KAZ A;  3BGR A;  2XRI A;  4KTW A;  4E7J A;  3U3Y A;  2HND A;  5EU7 A;  2DFH A;  2JLE A;  2OPQ A;  1RT5 A;  3VN5 A;  1NOY A;  3AVN A;  3HXM A;  5HBM A;  4DWI A;  2G8I A;  1RDB A;  1U04 A;  4BWJ A;  1JLA A;  4OJR A;  3IRX A;  3MXJ A;  3DLE A;  3AO4 A;  3AVL A;  4F4K A;  2BAN A;  3L2V A;  3CFO A;  2A1R A;  1QSL A;  3ZSW A;  3M8S A;  2IGI A;  3VQQ A; 
#chains in the Genus database with same CATH topology
 4JI2 K;  4CK1 A;  4O44 A;  4GVE A;  4BR5 A;  2R7Y A;  4MDB A;  3QBW A;  3ULE B;  1D4X A;  1LW2 A;  4IFV A;  1JL2 A;  4AM7 A;  5GIP A;  4RW6 A;  1LCU A;  3K0S A;  2FSN A;  3CQY A;  2F8T A;  4CW7 B;  4M3T A;  3AVI A;  5CYQ A;  3OHR A;  2I5J A;  5FLX O;  4FWP A;  1HKG A;  4HTL A;  4RW7 A;  2QM1 A;  2QK9 A;  2UYT A;  3SMS A;  4AH9 A;  5A2Q O;  3TU5 A;  3EL2 A;  1IG9 A;  4CBW A;  3SV3 A;  4OO1 J;  2GUP A;  5J2Q A;  5BN9 A;  1TKT A;  3E01 A;  4B3T K;  2HF3 A;  2ZQB A;  4BAC A;  2E88 A;  2P51 A;  1QZ5 A;  1KXP A;  2P9P A;  2HOE A;  4IO8 A;  1KAY A;  3T1A A;  4GV6 A;  1YJW N;  1J6Z A;  3CIP A;  4HWI A;  4C8K A;  4FOE A;  2HNZ A;  2I7N A;  2NRZ A;  1TL3 A;  2PFU A;  4H5V A;  4CGJ A;  1KCF A;  1OKJ A;  3MMV A;  3MN9 A;  1SZ2 A;  4FJH A;  2O8B B;  4X65 K;  3KK1 A;  3Q7C A;  2UXB K;  3TR8 A;  5C2F A;  1D5A A;  3DRR A;  3VGM A;  1HRH A;  4QS9 A;  1HYZ A;  2OCE A;  2A5X A;  5AQS A;  4FLW A;  1LOT B;  3EYZ A;  2QW9 A;  3NE6 A;  4CF2 A;  4DQP A;  2ZGZ A;  1TKZ A;  3VGL A;  3C6U A;  3DM2 A;  1QVF M;  4IDH A;  4L8R B;  4H8K A;  4YOW A;  4E0D A;  1HKB A;  4AHT A;  3D6R A;  2PYJ A;  4A59 A;  3OYA A;  4BR9 A;  4BC5 A;  3OYE A;  3KD5 E;  3OJU A;  2XO7 A;  3MN5 A;  3I33 A;  1Y97 A;  2Z1H A;  4CJP A;  4CIE A;  3WXI A;  3VA3 A;  1REV A;  3ZSR A;  4Z94 A;  1X9J A;  4CJF A;  2LSN A;  5DK5 A;  1VQM N;  1C0F A;  1SKS A;  3THY B;  2EWS A;  3WXL A;  1BA1 A;  1R59 O;  4BGA A;  1WSI A;  4OGC A;  3HBT A;  1W9H A;  5KPR A;  3ZSZ A;  4I9L A;  3I8D A;  1NGA A;  4BR0 A;  3AA4 A;  1JL1 A;  4FWM A;  2D1K A;  4R5P A;  3RMC A;  3V9U A;  1QE1 A;  3VOV A;  2VGN A;  1TAQ A;  3G25 A;  4FWQ A;  4CJ5 A;  3M8Q A;  1VRU A;  4CHQ A;  4W5Q A;  5KTQ A;  3KLI A;  2BTF A;  1Q18 A;  1W97 L;  3V9Z A;  4ZTJ A;  5HOO A;  1NGB A;  4C8O A;  4DSI A;  2JWL A;  3S3O A;  4JI6 K;  3QNO A;  1NGJ A;  2OAN A;  4I6M A;  4JS5 A;  4BVP A;  1QQO A;  4MO5 A;  2FBX A;  3L2W A;  1A5X A;  4NLC A;  4BRC A;  1TUU A;  1YJ9 N;  1NG9 A;  2KQ2 A;  4B9N A;  1XC3 A;  3D2F A;  3THW B;  1CXU A;  3TAM A;  2QWP A;  1HYS A;  2PAV A;  1KAZ A;  2F96 A;  4RW8 A;  1GOB A;  3J7Z O;  3ZT3 A;  3VQ9 A;  2PYL A;  1NLV A;  3C95 A;  1KLN A;  1JKH A;  4F8R A;  4CE9 A;  4CZM A;  4J2E A;  4I6M B;  5BPM A;  2FBY A;  5AQH A;  5AQO A;  2G8F A;  4HCC A;  2XY7 A;  3AGK A;  3SUQ A;  2F4V K;  2A6A A;  4FK2 A;  2YNG A;  1LWC A;  3FZL A;  4DF8 A;  1RTH A;  3JXU A;  2VWJ A;  2IVN A;  4XEI A;  4HUE A;  3CCJ N;  3ITH A;  4GKJ K;  2PBD A;  1C0U A;  3B8A X;  2ITM A;  4RCH A;  1U2V A;  4KV8 A;  3TAP A;  1N36 K;  3OYI A;  3FZK A;  4NCA A;  2H3G X;  3VQ7 A;  3CCM N;  4CEE A;  2Q2R A;  4BRA A;  1I3A A;  1RIL A;  4LF9 K;  4N76 A;  4DQQ A;  1RDU A;  2ASM A;  1XNQ K;  5CYM A;  5JS1 A;  3D2E A;  2EHG A;  4J8F A;  4CJ3 A;  3HSC A;  3OYD A;  3VQA A;  3TAN A;  1C0G A;  3OYB A;  3O1W A;  2GWJ A;  4L3Q A;  3M3Z A;  4CGI A;  1RBU A;  3VQD A;  1UA1 A;  1SL2 A;  2ZJQ L;  1NJW A;  3LM9 A;  1Z26 A;  1TVR A;  1UA0 A;  3WNG A;  3TPQ A;  5LL6 Z;  1VQ4 N;  3KK2 A;  1E4G T;  3MEE A;  2G8V A;  2YNH A;  2HHU A;  3FFI A;  5AQJ A;  2P9L B;  4E1M A;  4V19 S;  1S1V A;  1RTJ A;  3KD1 E;  1K9M O;  4CFB A;  3KHY A;  2E6L A;  4Z4G A;  4LF8 K;  3BY5 A;  3ENO A;  4B1X B;  3D2E B;  3AO5 A;  1YXQ A;  3TSU A;  4CGF A;  4B1Y B;  1JLF A;  4FLT A;  4B9L A;  4FM2 A;  1BIZ A;  3QIP A;  3OS2 A;  4BRO A;  1GLJ O;  4OKE A;  5GAE P;  3H3O B;  1P90 A;  4DV5 K;  1CZB A;  3QET A;  1T6C A;  4KFB A;  4E7I A;  5JLH A;  1UOC A;  2YJF A;  5BPL A;  4MLE A;  1HLU A;  2OPR A;  4AHR A;  3ID6 A;  3O3G A;  1TKD A;  4DQ8 A;  1NJI O;  3DXK A;  1NBW A;  3KLE A;  4CF0 A;  2ZE2 A;  3QEI A;  4JI4 K;  3CQ8 A;  5BRH A;  3NHG A;  2OZS A;  3DRP A;  3RTV A;  4DSF A;  3CG7 A;  4ZHR A;  4XH5 A;  1IKW A;  3UE5 A;  4PL7 A;  3PLA A;  3SMP A;  1A5W A;  3WUH A;  1S1W A;  4TSX A;  1QQN A;  1X1P A;  3R6M A;  4YOY A;  5C24 A;  4JD2 A;  1V4S A;  1RBS A;  2F9T A;  1U4B A;  4O8K A;  3CXC M;  1G99 A;  1NMN A;  3KLH A;  4KRF A;  4G1Q A;  1BI4 A;  4JI1 K;  3C7N A;  1RDA A;  3OBY A;  2HHW A;  2CGJ A;  2E2N A;  3TI0 A;  5AZJ B;  4OPK A;  4HCB A;  5C42 A;  4K8Z A;  5FPM A;  3VMF B;  3OYM A;  4M3W A;  4IFY A;  3O9Q A;  4DFJ A;  1VHX A;  3O3F A;  3LDS A;  1SV5 A;  4DFM A;  1ZC6 A;  1KD1 O;  2D0A A;  3T19 A;  4B9T A;  4C8N A;  3THV A;  5AQX A;  4FWR A;  2HNY A;  2VG7 A;  5AJ3 K;  4OLB A;  4M3R A;  3WNE A;  2V52 B;  3I8B A;  1IBK K;  4A62 A;  4JD2 B;  5BN8 A;  3O3H A;  2UU9 K;  3VQ5 A;  3ZX3 A;  2O8C A;  2YI1 A;  4FPA A;  4CJQ A;  1S1X A;  1K8A O;  4CJU A;  3WXM B;  3AAQ A;  4FJM A;  3QBX A;  4O55 A;  1JJ2 M;  4ID5 A;  3LP0 A;  2A40 A;  2O8D A;  2OPP A;  3NBP A;  1LAW A;  1XHZ A;  4JKG B;  5AQR A;  5AQY A;  4U7B A;  4EZ9 A;  2HHS A;  5GAH P;  4DV1 K;  4DWI A;  3AVN A;  3HM8 A;  3EO3 A;  4OJR A;  3IRX A;  3MXJ A;  1EQY A;  3BF3 A;  4F4K A;  5AZI A;  4WFN L;  3EY1 A;  3O9R A;  4DMN A;  5GAD P;  1NK4 A;  3RR7 A;  5C10 A;  4DSL A;  1DEJ A;  4BRN A;  5AQZ A;  3E9O A;  2X6S A;  5FRN A;  4E7K A;  4E89 A;  4WFB L;  3VA0 A;  3QES A;  1NM1 A;  3O5B A;  3SV4 A;  2O8D B;  2P9K B;  2P9S B;  4CK3 A;  4BC4 A;  4WCE L;  1W7A A;  1QSY A;  4NCB A;  1TYQ B;  5M1O A;  4CHP A;  4DTR A;  1J9A A;  2HMP A;  1YUW A;  4Z4H A;  2V51 B;  5AQQ A;  3OYF A;  2KLA A;  3OYC A;  1FKP A;  3SBT A;  2D0C A;  5HRS A;  3HM9 A;  1XC9 A;  3FGU A;  2P9U B;  1RTI A;  3H6E A;  4HUG A;  3ISN C;  4B3O A;  2GTD A;  5KRS A;  4BE2 A;  3ULD A;  3DJC A;  4H5R A;  2WBN A;  4H4M A;  2WFB A;  3V9W A;  1WSG A;  4JLH A;  3HPG A;  1WSF A;  4LFA K;  1VSI A;  1K6Y A;  2Q1N A;  1L3T A;  3QB0 A;  4KTQ A;  3MWT A;  3S3M A;  5KGX A;  1VSJ A;  4LF6 K;  3LPT A;  3RSE A;  4FVU A;  3CCE N;  2P9N B;  1VQ5 N;  4FPB A;  4BR2 A;  4DUY K;  3AVH A;  1JLQ A;  2FSJ A;  2VQE K;  4ICL A;  3AA2 A;  4DQR A;  3CFR A;  4DQI A;  1HQU A;  4GV9 A;  3DOL A;  2B6A A;  1DKG D;  1N34 K;  4CJW A;  3CPW M;  1OH6 A;  3O9S A;  5M1K A;  4NO7 A;  3HJF A;  2QWM A;  5C15 A;  1TK8 A;  2RF2 A;  1BUP A;  4BG9 A;  3DAW A;  4IWV A;  4DLE A;  3DLL L;  2UUA K;  3WEE A;  4LH4 A;  4OPH A;  5ELZ A;  3VQB A;  4Z4C A;  4B9M A;  4CEO A;  4BC3 A;  3WXJ A;  3ZET A;  4IBN A;  4N5S A;  3AVG A;  3GDQ A;  1EP4 A;  4FLZ A;  5AQF A;  2FBV A;  1LWE A;  1VSK A;  1X9W A;  4BC2 A;  4YDU C;  3J80 O;  3SPY A;  3AVB A;  4BRQ A;  1HNZ K;  1ZBF A;  3C6T A;  4KTZ A;  2EX3 A;  4KH4 A;  2ZJR L;  4H4O A;  4AHV A;  5AQL A;  4B3M K;  3M8P A;  3CCQ N;  1BGX T;  1MU2 A;  3DLB A;  3NF7 A;  4Z4I A;  4CHO A;  1G15 A;  3LP3 A;  1RT3 A;  3HST B;  2YNF A;  1S3X A;  1FXX A;  2A1S A;  2ZGY A;  3ATV A;  4IKF A;  4OX9 K;  4FK4 A;  3P4I A;  3CJC A;  3AAR A;  4A2B A;  4DTJ A;  1FKO A;  2E2P A;  1RGI A;  3UKR A;  4CF9 A;  4DTP A;  1O1W A;  3LZJ A;  1GLC G;  1S6P A;  2VG6 A;  4B8C A;  3H3N O;  2OTL N;  4Y1D A;  3G0Z A;  4CJK A;  1X9M A;  1QTM A;  2E6M A;  1NJZ A;  3MN6 A;  3AY9 A;  5C0Y A;  5FPD A;  3H08 A;  3ALY A;  1SS6 A;  2JWK A;  2VQF K;  3VEW A;  3ZSO A;  3MXI A;  1ZBI A;  4I2Q A;  1VK0 A;  4GMJ B;  2D4W A;  2YKM A;  4PKI A;  1YT3 A;  3LDO A;  2UXD K;  1HYV A;  4EZ6 A;  3KWI A;  5AQG A;  4JAX A;  1VSL A;  3UKU A;  3FZF A;  3UKR B;  3VER A;  1L3S A;  4FJL A;  3CM5 A;  4KHW A;  4LSN A;  2BDP A;  3E66 A;  3SQ2 A;  3AVJ A;  5GAG P;  3GOI A;  4QS8 A;  4MO4 A;  1ATS A;  5I3U A;  1FK9 A;  2HVI A;  3MED A;  4XIU A;  5HRR A;  1RTD A;  4DUZ K;  4JYA K;  3PX4 A;  1CZ9 A;  4FJ5 A;  2P1J A;  4Q0B A;  3NF8 A;  1NK9 A;  4QAG A;  4BRF A;  1SKW A;  4H0V B;  3G6E N;  3M1F A;  4IG0 A;  1XI1 A;  3HVR A;  4KB0 A;  4FJ9 A;  3EZW A;  5TKY A;  2HF4 A;  1P8Z A;  5HL7 L;  2P9P B;  3JAM O;  3OJS A;  3ZT2 A;  3J7A P;  3BUZ B;  2HBL A;  1B9D A;  5FPE A;  2WOM A;  3DYA A;  4M7Y A;  1N32 K;  1NGD A;  4CZL A;  1GLB G;  2OPS A;  3JYT A;  3P1G A;  3ZT1 A;  1QQM A;  1MWK A;  4LD0 A;  3EE9 A;  2UUC K;  3DLG A;  4C1N I;  3NGI A;  4K41 A;  4CEF A;  3FZM A;  2WTU A;  4HTU A;  2KZZ A;  4J2B A;  2YHA A;  5EY4 A;  2BGG A;  2DFE A;  3P5J A;  5FRO A;  4DU1 A;  2O4G A;  1VQO N;  3W3D A;  3V1O A;  4KHU A;  2V7Z A;  3L2Q A;  3SUO A;  1Z25 A;  3L0Q A;  5KPT A;  4YOR A;  1QHT A;  4JN4 A;  4BRI A;  3DLK A;  5AFU A;  5SWM A;  3O80 A;  1XMQ K;  3PIO L;  4ISF A;  3QEX A;  2IAJ A;  1BWF O;  4CJT A;  4OKJ A;  4Z4F A;  4FOI A;  3SNN A;  3TSP A;  3KK7 A;  5JVH L;  4K8X A;  1BQM A;  3C65 A;  3WNF A;  4FO0 A;  3BP8 A;  3O8M A;  4H0Y B;  2XY6 A;  4DR2 K;  2BE2 A;  3FE1 A;  3K59 A;  2E8A A;  1YF5 L;  4B1Z A;  3KLG A;  1C0M A;  4DTX A;  2UXC K;  3HTV A;  4H5W A;  3PV8 A;  4IOA L;  1KVA A;  2KFN A;  2IC3 A;  4M7X A;  2W6L A;  2E2Q A;  1IBL K;  2F9W A;  4K43 A;  1JLC A;  4RWT A;  1VQ6 N;  1O13 A;  5ADX A;  4E7H A;  2OA8 A;  3ASM A;  3VEZ A;  3SQ0 A;  1N8R O;  4BE0 A;  1U49 A;  3K5L A;  2W41 A;  3FZH A;  4C8L A;  5DM7 L;  2ASO A;  4N56 A;  3N4Q A;  4N47 A;  1TAU A;  4YOV A;  5AQN A;  4F9O A;  3C94 A;  3RMD A;  1X3M A;  3OW2 M;  3G4S N;  4LF4 K;  3IDH A;  4DR6 K;  4RTF D;  4LSL A;  3BEX A;  1CZA N;  3WT0 A;  1RDD A;  3B6P A;  4JK7 A;  1QSS A;  3NAE A;  5AQK A;  1DTQ A;  3SBG A;  3CM6 A;  3A0I X;  4JI3 K;  4CGG A;  1VQL N;  4XH4 A;  3HT3 A;  3D2F B;  4JK8 A;  3ZSQ A;  1J5O A;  5CR4 A;  4RW9 A;  1Q9Y A;  1BDG A;  1SKR A;  4FJ7 A;  3A5N C;  3VGK A;  4YOT A;  3IKM A;  4BDY A;  4OLA A;  2IDO A;  2NNW A;  4O0J A;  1T03 A;  3LAN A;  1HJO A;  1QZ6 A;  1NKC A;  5M1Q A;  3OA9 A;  5GIO A;  4Y1C A;  4DV4 K;  1Q86 O;  4OVL A;  4B1U B;  1KC8 O;  3PIP L;  3VET A;  2ASP A;  4OGE A;  4X64 K;  4H0O A;  1D9D A;  1W0H A;  1HR0 K;  1SQK A;  2GBZ A;  1WB9 A;  4BDZ A;  3MWP A;  2FSK A;  2QA4 N;  4M45 A;  4HHT A;  1BOT O;  3LAM A;  1IKV A;  2QWQ A;  4FW2 A;  3AO2 A;  1BL3 A;  1HPM A;  1U2V B;  5AQM A;  1HNX K;  4JHD A;  1B92 A;  2FXU A;  3MEC A;  5EVZ A;  3KKR A;  3AVC A;  3SPZ A;  5J1E A;  2RHK A;  4CZK A;  2Q0U A;  1BA0 A;  3FFK B;  2E2O A;  4ELV A;  3G71 N;  3TAQ A;  4KAZ A;  1BO5 O;  1RDC A;  5AQU A;  1VQ8 N;  2G8H A;  4KTW A;  2YHW A;  5EU7 A;  1NOY A;  3HXM A;  5HBM A;  3TTD A;  4BWJ A;  2NRH A;  1JLA A;  3DLE A;  3AVL A;  1W2B M;  4E1J A;  2A1R A;  4DR4 K;  3VQQ A;  1CLQ A;  3GE1 A;  2NRV A;  3LM2 A;  2J4R A;  3CME N;  5F2R A;  4KPY A;  3AO1 A;  4JHD B;  4FYD A;  4GW6 A;  3J81 O;  4YOU A;  2ZD1 A;  3KIO A;  1HJR A;  3H1V X;  3C0B A;  3MCA B;  2BH1 A;  1QHA A;  4CZH A;  4JI5 K;  1C6V A;  4GY2 B;  5M1F A;  5KPZ A;  1ITG A;  3L6Q A;  4FM1 A;  3WNH A;  4NXN K;  2HMI A;  2IVO A;  4KHP K;  2G8W A;  3L3U A;  3S9H A;  2HST A;  3R8E A;  2E4L A;  3HVT A;  3PY8 A;  1FJG K;  4JI0 K;  3BZK A;  4PKG A;  3CC7 N;  4O5B A;  3AVF A;  1J5E K;  3I55 N;  2F7T A;  1Q81 O;  3CPE A;  5AQT A;  3AGR A;  3O4Q A;  4CHY A;  3UIQ A;  3NCI A;  3LL3 A;  4YDU A;  1TK5 A;  1ZBU A;  3ZX2 A;  1L3V A;  1HNI A;  4AF1 A;  3B6O A;  4AM6 A;  1IO2 A;  2IIR A;  4B9U A;  3AO3 A;  2YJE A;  3TAE A;  4CEA A;  4IO9 L;  2ETJ A;  4CJE A;  4JI7 K;  3DXK B;  2WC9 A;  3RVC A;  1JCF A;  1EXQ A;  3ZCM A;  3QFU A;  4IOC L;  1NK8 A;  3F2K A;  1EO1 A;  4DV2 K;  4FZZ A;  2E1Z A;  3GG4 A;  4CJS A;  1X9S A;  1TGO A;  4CFD A;  5I9E B;  3G10 A;  3RRH A;  2G8U A;  2GWK A;  4CZE A;  4M41 A;  4LH5 A;  4DR3 K;  5HRP A;  3T1H K;  4BRM A;  3CD6 N;  1TKX A;  4NXM K;  1V4T A;  2HHX A;  3NGY A;  4AHU A;  3V4I A;  4M42 A;  3GBT A;  3TAB A;  2FBT A;  3VEV A;  4PKH A;  1Q8I A;  3HL8 A;  1YI2 N;  1WNS A;  1A5V A;  1KRP A;  1BI4 B;  4FWN A;  3C7N B;  2XY5 A;  1S1T A;  3QFP A;  1ZBS A;  3DOK A;  1JCE A;  3OY9 A;  4B3S K;  3WQU A;  4ILG B;  1Z05 A;  1MDU B;  3U9Z A;  1XHX A;  1N33 K;  1GOA A;  4IJA A;  2WUS A;  1NGI A;  3IUC A;  3R1X A;  5BPN A;  1TL1 A;  4DTO A;  5I42 A;  4M3X A;  4QOZ B;  5FPN A;  2FLO A;  3SLC A;  1X3N A;  1YTA A;  2Y1I A;  2AP1 A;  3V81 A;  3CJ9 A;  1OH5 A;  2FF3 B;  1WAJ A;  4LY7 A;  4M3U A;  2A42 A;  2O8C B;  4DF4 A;  2ZWH A;  2P9I A;  4WQ4 C;  4B9V A;  5AR0 A;  1Q82 O;  1F21 A;  2W40 A;  5BRE A;  2QWL A;  1YIT N;  4KRE A;  3IG1 A;  5F0X A;  4CFA A;  3QDK A;  2YCH A;  4JKA A;  4FJ8 A;  4CD1 A;  1RBV A;  4IOX A;  4LFB K;  4E1N A;  2VG5 A;  3CCS N;  4CZJ A;  2XY8 A;  2YX6 A;  4CJL A;  4ILH A;  4MLH A;  4DR5 K;  4IXC A;  3CCR N;  3DXM A;  4WE1 A;  3C6A A;  2GEM A;  3NF6 A;  5AZI B;  5BRF A;  4CJV A;  3KJV A;  2V7Y A;  2W42 A;  4CER A;  3L4Q A;  4CEC A;  3A5O C;  4KB1 A;  1NK6 A;  3ZT0 A;  3V1Q A;  4FLX A;  4KHY A;  2P9I B;  3T1Y K;  1YIJ N;  4AHC A;  1VQK N;  1YJN N;  4H0P A;  3VQP A;  4FWO A;  4LFC K;  4CGD A;  3HZ6 A;  3KZB A;  4CZG A;  3VTH A;  4ISG A;  4DFK A;  3ID8 A;  1GLD G;  1OVY A;  3SAF A;  2RKI A;  3GL1 A;  4BG8 A;  2IS3 A;  3RR8 A;  1VRT A;  2YV0 X;  3T3F A;  3VQ4 A;  3NGZ A;  1JXB A;  3QIN A;  3LP2 A;  3OS1 A;  5JVG L;  1D8Y A;  1M1K O;  1R0A A;  3E9P A;  1IKX A;  4CZF A;  3O4W A;  5EOY A;  4BRL A;  3TAR A;  3HI0 A;  5AQI A;  4CF1 A;  1VAZ A;  4Z0U A;  1RFQ A;  5KGW A;  3HOS A;  3PX0 A;  2P5O A;  2CGK A;  4CFC A;  3MX2 A;  4BRP A;  3OYL A;  1T6D A;  4MFB A;  3U3G A;  4BRK A;  3EKU A;  4CIF A;  4FLU A;  4ID1 A;  1SUQ A;  1YAG A;  4YHH K;  4CES A;  3O1B A;  1T7P A;  2HHV A;  1CXQ A;  5JIC A;  1NGG A;  2PY5 A;  3QER A;  2HHQ A;  1VQP N;  3MK6 A;  3K5N A;  1LV5 A;  2QWO A;  3NVK A;  3D0P A;  3MXM A;  4X62 K;  4B9S A;  2D0O A;  3RSE B;  3AVK A;  5M1N A;  3QNN A;  5GIN A;  4IEI A;  2X6N A;  3TAF A;  4BVO A;  4LC9 B;  3QIC A;  3MDQ A;  4U67 L;  4DSK A;  1ASU A;  1T3V A;  3NH0 A;  3ZYY X;  3V1R A;  4KHQ A;  1L5U A;  4WF9 L;  4F2S A;  2ITG A;  2GV9 A;  4JK9 A;  5JS2 A;  2QEX N;  3ULE A;  4ZTF A;  1KVB A;  1DT9 A;  2AA4 A;  1NK0 A;  3DLR A;  3N4P A;  2PZS A;  3OYG A;  3WEE B;  2DFF A;  3CF5 L;  2E1Y A;  5J2M A;  4CGH A;  4B1V A;  4JKH A;  2F8S A;  3NH1 A;  3U8X A;  1S9E A;  2Q0R A;  3ZET B;  1LWF A;  3K58 A;  3UB5 A;  4FM0 A;  5C2D A;  3F9K A;  3HP6 A;  3F73 A;  3O08 A;  4KH5 A;  3I56 N;  4BRE A;  1NGH A;  3M5R A;  3CJ1 A;  1ILY A;  3HO1 A;  4PUO A;  3LDP A;  3ZSY A;  1VQ7 N;  4FLY A;  1ATR A;  2VGM A;  4H03 B;  1J53 A;  3V9S A;  1KTQ A;  4JV5 K;  4DTS A;  3U6F A;  3O9U A;  2O8E A;  4JS4 A;  3PX6 A;  3H46 O;  4I7F A;  3VEO A;  1WSH A;  4DV7 K;  3SAH A;  4ISE A;  1EWQ A;  4BRH A;  1BCO A;  1YVN A;  3SQ1 A;  3AAP A;  3CCU N;  1S5J A;  3MX5 A;  4CED A;  5C25 A;  4X66 K;  4F3O A;  1NK5 A;  2YHX A;  5AQP A;  1IKY A;  1JLG A;  5EXW A;  1IBM K;  1S22 A;  4NYN A;  4IEE A;  3TSQ A;  3DI6 A;  5H1S Q;  1NNE A;  1NKE A;  4J2A A;  1U45 A;  2HW3 A;  2O8B A;  4PY5 A;  3O9T A;  3LPU A;  4IDK A;  3ZSV A;  1HPZ A;  4FWL A;  5KQ8 A;  5IT9 O;  2O8E B;  1S1U A;  1RCH A;  2CH6 A;  3IS9 A;  3QML A;  5F1X A;  3KVG A;  2HHH K;  3FLC O;  3L2R A;  2QXL A;  5BRD A;  3QO9 A;  3LAK A;  1WBD A;  4I2P A;  3LDL A;  3K5O A;  2OTJ N;  4E7L A;  1KFS A;  3QEV A;  4BGB A;  4CEZ A;  5SZT A;  4PQU A;  3DLH A;  1NJY A;  3HK2 A;  2RE2 A;  4GKK K;  3VEY A;  3CHW A;  2NUB A;  1IG8 A;  4CJ7 A;  4CI6 A;  3UKU B;  3K5M A;  5HP1 A;  1SAZ A;  2VWK A;  5E26 A;  3KLF A;  4DU4 A;  4H5T A;  5TKW A;  3O6W A;  3U4L A;  1HNW K;  4A5B A;  1IH7 A;  4PWD A;  2HHT A;  2Q97 A;  3THY A;  4G9Z A;  1Z6R A;  3AA5 X;  3RMB A;  2A41 A;  4JRP A;  1NK7 A;  3CCL N;  4O0I A;  1XNR K;  4I9Q A;  2X74 A;  4C8M A;  2QKK A;  5JMV A;  3SCX A;  5J2N A;  3LZI A;  4KHN A;  2A3Z A;  2YHY A;  1VSF A;  3ZEU A;  1J54 A;  4FXD A;  3LDQ A;  4FK0 A;  3MAQ A;  1XMO K;  3D45 A;  3HYF A;  4GVM A;  5BR9 A;  4BR7 A;  1BIS A;  1K73 O;  2WON A;  4IFE A;  3LP1 A;  3LWM A;  2XRI A;  2DFH A;  2JLE A;  2OPQ A;  1RT5 A;  3VN5 A;  4WQ5 C;  2G8I A;  1DGK N;  1RDB A;  1U04 A;  3AO4 A;  4FWS A;  3A5M C;  3L2V A;  3CFO A;  1QSL A;  1E3M A;  2IGI A;  2UUB K;  3BZC A;  4FVM A;  5CZ2 A;  4CHZ A;  2IVP A;  3AV9 A;  3OTO K;  3K57 A;  4B8A B;  1ASW A;  3THW A;  4EIA A;  4DQS A;  3OS0 A;  3CER A;  1OH8 A;  3ZEU B;  3O4N A;  4YFU A;  4KO0 A;  2GEL A;  2VYP A;  3ENB A;  2QWN A;  4MQ3 A;  5FRM A;  2HBJ A;  3L8B A;  4DHY A;  3S41 A;  1WBB A;  4JEP A;  4KI4 A;  4IJN A;  3VTI A;  3LDN A;  5BR8 K;  4J2D A;  3ZX0 A;  4JKE A;  3SUP A;  4DG1 A;  1SL0 A;  2DY4 A;  3VF6 A;  1KSP A;  4LF7 K;  3CYM A;  1HKC A;  3E9L A;  1SL1 A;  4FJG A;  4M3Y A;  3QIO A;  3THX A;  4Q5V A;  4CD3 A;  3ZSX A;  2B5J A;  2W6K A;  1T05 A;  5FDL A;  2QWR A;  1L3U A;  3HRG A;  4DSJ A;  4ELT A;  4KI6 A;  4B3R K;  3ZLJ A;  4CZI A;  4CVN E;  4BDP A;  4W5R A;  3HOT A;  4BQZ A;  1KVC A;  4CBU A;  4YNQ A;  4K25 A;  4FJN A;  2JGU A;  5E84 A;  2NRW A;  4B08 A;  5IWA K;  4A57 A;  4A61 A;  5B8H A;  4FWK A;  1RT6 A;  5KRT A;  1HNV A;  1WSJ A;  2ZF5 O;  4RW4 A;  1VSH A;  3T69 A;  1M90 O;  5J2P A;  3Q7B A;  1EX4 A;  1EET A;  4CBX A;  3KK3 A;  4DS5 A;  3VQC A;  4WQ4 A;  4LF5 K;  1BHL A;  3CJ7 A;  4JKD A;  5M1P A;  1ATN A;  3V9X A;  2BUP A;  4AQY K;  4DV0 K;  1RT2 A;  4DV3 K;  3THX B;  1RT1 A;  4FCY A;  1U6Z A;  1XWL A;  4O5F A;  5CY4 A;  4OPJ A;  2NLX A;  3A8Y A;  5DM6 L;  1IV0 A;  2P9L A;  3W0L A;  3FR0 A;  3HP9 A;  3TWH A;  1KLM A;  5HLF A;  1QVG M;  1KFD A;  3JS6 A;  2FC0 A;  1BG3 A;  4DU3 A;  4B1W B;  2QI2 A;  3VEX A;  1NGE A;  4PHT X;  4HVJ A;  2CGL A;  4EP4 A;  4R79 A;  3NDK A;  3CC2 N;  3L3V A;  3V6D A;  2E5L K;  3K2P A;  4DTM A;  3PO4 A;  1GOC A;  1LW0 A;  2QXF A;  1C1C A;  3MEG A;  3CC4 N;  3LWL A;  4H5N A;  2GUI A;  3VEN A;  3F9M A;  1WLJ A;  1EWR A;  4EHU A;  4F3T A;  3DMJ A;  2Q36 A;  4EAH D;  4GV3 A;  4ELU A;  4DR7 K;  1WN7 A;  3H1Q A;  5HRO A;  1K8K A;  2B4J A;  1LAV A;  4DSE A;  1C1A A;  2OYQ A;  4JRQ A;  1ASV A;  2YNI A;  2Y1J A;  2RN2 A;  4B9Q A;  3SAG A;  4F2R A;  4FZY A;  4BRG A;  3EE8 A;  1NOZ A;  1TK0 A;  2KZM A;  3CET A;  4QCL A;  4OPA A;  4M63 C;  2ZJP L;  1YTU A;  1E4F T;  4AHS A;  2GX9 A;  3TTF A;  4QS7 A;  3OYH A;  4IG3 A;  4HUF A;  3QLH A;  2OZM A;  4H0T B;  3ATU A;  2YHB A;  1ZBL A;  3NMU A;  2O8F A;  1K8K B;  1ZXO A;  3CQX A;  3IFR A;  5CE3 A;  2Z1J A;  3VQ8 A;  1HUX A;  3C6H A;  1JCG A;  4XH1 A;  3SI6 A;  3NF9 A;  3CI5 A;  2FF6 A;  4DV6 K;  3QEP A;  1JLB A;  1WOQ A;  2KFZ A;  5DMR A;  4CJR A;  4BY9 C;  1TUY A;  5AZJ A;  3PO5 A;  2KKZ A;  2NRR A;  3BF1 A;  1VSD A;  1U47 A;  1N5Y A;  2QKB A;  3TAG A;  1OVQ A;  2Q3S A;  5LMU K;  2VCP A;  3AA3 A;  3SYZ A;  2D5R A;  5KI6 A;  3PUF A;  5AQV A;  3VQ6 A;  2ATQ A;  1WUA A;  4DFP A;  1RNH A;  4NB4 A;  4KKO A;  3KTQ A;  2Z1G A;  4BE1 A;  3L4I A;  4WYB A;  1XQS C;  1MWM A;  1KQS M;  2O8F B;  4C1N K;  3RWU A;  4CJ4 A;  4DR1 K;  3LAL A;  5LJW A;  1T8E A;  4M3Z A;  1YVU A;  4FZX C;  2NZT A;  1DLO A;  3L2U A;  4DS4 A;  2KTQ A;  3DRS A;  1BU6 O;  5EX5 A;  3P38 A;  1NGC A;  5HRN A;  3R3L A;  4W5T A;  4NLB A;  3QEW A;  1KAX A;  4UQG A;  3AVM A;  1I39 A;  5AFU H;  1S6Q A;  3J8A A;  4NYF A;  4OKK A;  3EZ5 A;  4CEQ A;  3D7E O;  2G8K A;  4E19 A;  3ZT4 A;  5AQW A;  3PSF A;  1B9F A;  1RT4 A;  4JKG A;  3RMA A;  1RT7 A;  3ENH A;  4WFA L;  1GLF O;  4ILJ A;  1I94 K;  3VF2 A;  2CH5 A;  4KHS A;  5MLC Q;  4CF8 A;  3S3N A;  3CMA N;  2AJQ A;  1JLE A;  3OBW A;  2HBM A;  2KW4 A;  4EFH A;  3T7Z A;  2HB5 A;  4CK2 A;  1NMD A;  2Z1I A;  5LMN K;  1GLE G;  2X78 A;  1VQN N;  4FW1 A;  4PL8 A;  2D0B A;  4H0X B;  4BQL A;  4JKF A;  5ADX H;  4EHT A;  2XHB A;  3J7Y P;  3VQE A;  3IAY A;  4RG8 A;  3AVA A;  2P9K A;  2P9S A;  3OVN A;  3P31 A;  4PA1 A;  1S72 N;  2Q31 A;  3I0R A;  1HX1 A;  4FL9 A;  1TYQ A;  4KBO A;  3NVM A;  1RDW X;  1QS4 A;  1DTT A;  1QQC A;  1NGF A;  3K9J A;  3WXK A;  3OYN A;  3A5L C;  3WQT A;  4E3S A;  3DWL A;  3CJB A;  5K14 A;  3KKS A;  4BWM A;  4JI8 K;  2P9U A;  3JSM A;  3NH2 A;  4DKW A;  5C12 A;  1BCM A;  3R9P A;  1TV6 A;  2HVH A;  4AIL C;  1NWK A;  4O4G A;  3PSI A;  3SJJ A;  5CZ1 A;  4BR4 A;  1H1V A;  3TTC A;  2QTD A;  1WAF A;  4DB3 A;  1T44 A;  3HPO A;  1VQ9 N;  3CFP A;  4N41 A;  4CHN A;  3M8R A;  4FLV A;  3IMX A;  1FW6 A;  3K9K A;  3OYK A;  4JNE A;  1HQE A;  2D0P A;  2IOC A;  3SZ2 A;  3RRG A;  3M6G A;  1D9F A;  2P9N A;  3NFA A;  3MCP A;  1YHQ N;  3P83 D;  4IZ9 A;  4K42 A;  4CIG A;  2DPN A;  4BRD A;  4W5O A;  2DTU A;  3VPZ A;  4W5N A;  2E20 A;  3DXM B;  2O4I A;  4O8U A;  1GLL O;  3SJH A;  3SK3 A;  1C1B A;  1WSE A;  3HPH A;  1NKB A;  3EEQ A;  5T7B A;  4DCH A;  1N6Q A;  2ZM6 K;  3F5T A;  1EKE A;  4CCH A;  1RBR A;  2HBK A;  4WQ5 A;  4FJX A;  1IJJ A;  1XUP O;  2YKN A;  4KH6 A;  3E1Y A;  3CJA A;  1C0T A;  1ESV A;  1Q9X A;  1NU0 A;  1NJX A;  1MA9 B;  3VF4 A;  2KHO A;  4JKC A;  4Z4E A;  4K0K K;  4A5A A;  2VWB A;  2P5G A;  3A2F A;  4YOX A;  4MDA A;  1U48 A;  1VSM A;  1UAX A;  3MN7 A;  5E41 A;  3BDP A;  4FJI A;  1Y64 A;  4NCG A;  3CCV N;  4FJJ A;  4A2A A;  3VES A;  1BIU A;  4FSV A;  1GLA G;  1S9G A;  3SUN A;  5D3G A;  3KWG A;  1HMV A;  4DTN A;  2NRX A;  5JLF A;  3P39 A;  2I7P A;  4CEB A;  1RBT A;  3OYJ A;  4DLG A;  1ZBH A;  4C23 A;  3I0S A;  4DTU A;  1BQN A;  4GNI A;  4Y0W A;  4EP5 A;  3SQ4 A;  3EN9 A;  3H45 C;  3U9D A;  4JKB A;  1VSE A;  1UWB A;  2RPI A;  4YY3 K;  5KQD A;  1ZYQ A;  1Q7Y O;  1JXE A;  5CHI A;  5LY3 A;  3EKS A;  3BGR A;  5LJV A;  4E7J A;  3U3Y A;  2HND A;  4UY8 O;  2BAN A;  1OH7 A;  3ZSW A;  3M8S A;  2NRT A;  4FJK A; 
#chains in the Genus database with same CATH homology
 3EY1 A;  4DMN A;  1NK4 A;  4CK1 A;  4FVM A;  5CZ2 A;  4CHZ A;  4O44 A;  3RR7 A;  4DSL A;  2R7Y A;  3AV9 A;  3K57 A;  4B8A B;  1ASW A;  4DQS A;  4KPY A;  3AO1 A;  3OS0 A;  4FYD A;  2X6S A;  4GW6 A;  1LW2 A;  4IFV A;  3O4N A;  4E89 A;  4YFU A;  3VA0 A;  4KO0 A;  4E7K A;  1JL2 A;  2ZD1 A;  3SV4 A;  3QES A;  2HHS A;  3KIO A;  1HJR A;  4RW6 A;  4CK3 A;  1C6V A;  4MQ3 A;  5FRM A;  1ITG A;  4FM1 A;  3WNH A;  1QSY A;  2F8T A;  2HMI A;  4M3T A;  4NCB A;  3AVI A;  5CYQ A;  4CHP A;  4DTR A;  1J9A A;  3L8B A;  2I5J A;  4KHU A;  2G8W A;  4Z4H A;  4KI4 A;  3L3U A;  4RW7 A;  3S9H A;  4J2D A;  2DY4 A;  3OYF A;  2E4L A;  3HVT A;  4DG1 A;  3SUP A;  3OYC A;  1SL0 A;  3PY8 A;  2QK9 A;  1FKP A;  2D0C A;  1KSP A;  5HRS A;  4O5B A;  3CYM A;  3AVF A;  4AH9 A;  3HM9 A;  1XC9 A;  1SL1 A;  4FJG A;  4M3Y A;  1RTI A;  3QIO A;  4HUG A;  3ISN C;  4CHY A;  4B3O A;  3O4Q A;  4Q5V A;  3ZSX A;  1IG9 A;  2B5J A;  3UIQ A;  5KRS A;  3SV3 A;  1T05 A;  4BE2 A;  5FDL A;  3ULD A;  1L3U A;  3NCI A;  5J2Q A;  4DSJ A;  1TK5 A;  4ELT A;  4KI6 A;  1ZBU A;  4H4M A;  1TKT A;  1L3V A;  1HNI A;  3E01 A;  4BDP A;  4W5R A;  3B6O A;  1IO2 A;  2ZQB A;  1KVC A;  3AO3 A;  4BAC A;  4YNQ A;  3V9W A;  3TAE A;  2P51 A;  4B9U A;  4FJN A;  2JGU A;  4B08 A;  1WSG A;  2ETJ A;  4CEA A;  4CJE A;  4JLH A;  3T1A A;  3HPG A;  1WSF A;  1EXQ A;  1RT6 A;  3ZCM A;  5KRT A;  1HNV A;  1VSI A;  1K6Y A;  1WSJ A;  1NK8 A;  1L3T A;  4KTQ A;  3S3M A;  4RW4 A;  5KGX A;  1VSJ A;  1VSH A;  4FZZ A;  4C8K A;  4CJS A;  3LPT A;  5J2P A;  2HNZ A;  1TGO A;  4CFD A;  1TL3 A;  1X9S A;  1EX4 A;  1EET A;  3G10 A;  4CGJ A;  3KK3 A;  3RRH A;  4DS5 A;  2G8U A;  1KCF A;  3VQC A;  3AVH A;  4M41 A;  4LH5 A;  1JLQ A;  1BHL A;  5HRP A;  3V9X A;  4FJH A;  1TKX A;  3AA2 A;  4ICL A;  4DQR A;  3KK1 A;  1RT2 A;  1HQU A;  3CFR A;  3TR8 A;  1RT1 A;  3DOL A;  2B6A A;  3NGY A;  4DQI A;  2HHX A;  4AHU A;  1D5A A;  3DRR A;  3V4I A;  4M42 A;  4FCY A;  4CJW A;  3TAB A;  1HRH A;  1XWL A;  2FBT A;  1HYZ A;  1Q8I A;  3HL8 A;  3HJF A;  4FLW A;  1TK8 A;  2RF2 A;  4OPJ A;  5CY4 A;  3EYZ A;  1WNS A;  1A5V A;  1KRP A;  3NE6 A;  4DLE A;  1BI4 B;  4CF2 A;  4DQP A;  1TKZ A;  2XY5 A;  1S1T A;  3HP9 A;  4LH4 A;  3TWH A;  1KLM A;  3DOK A;  5HLF A;  1KFD A;  3VQB A;  4Z4C A;  3C6U A;  3OY9 A;  2FC0 A;  3DM2 A;  4B9M A;  4DU3 A;  4CEO A;  4L8R B;  4H8K A;  4FJK A;  4IBN A;  4N5S A;  3AVG A;  4AHT A;  1EP4 A;  4FLZ A;  4E0D A;  1XHX A;  4HVJ A;  1GOA A;  2PYJ A;  4EP4 A;  3NDK A;  2FBV A;  1LWE A;  3L3V A;  1VSK A;  3OYA A;  3V6D A;  1X9W A;  3K2P A;  4DTM A;  3OYE A;  3PO4 A;  1GOC A;  1LW0 A;  3OJU A;  3KTQ A;  2QXF A;  3SPY A;  1C1C A;  3AVB A;  3MEG A;  2XO7 A;  3LWL A;  1Y97 A;  2Z1H A;  1ZBF A;  4CJP A;  2GUI A;  1TL1 A;  4CIE A;  3C6T A;  4KTZ A;  2EX3 A;  3VA3 A;  4DTO A;  1REV A;  1WLJ A;  3ZSR A;  5I42 A;  4H4O A;  4CJF A;  4AHV A;  4M3X A;  4QOZ B;  4F3T A;  3DMJ A;  2LSN A;  5DK5 A;  3M8P A;  1SKS A;  4ELU A;  1BGX T;  1MU2 A;  1YTA A;  2Y1I A;  3DLB A;  3NF7 A;  1WN7 A;  3V81 A;  5HRO A;  2B4J A;  4Z4I A;  1LAV A;  4CHO A;  1CLQ A;  1G15 A;  4DSE A;  3LP3 A;  1RT3 A;  1WAJ A;  1C1A A;  1WSI A;  4LY7 A;  4OGC A;  4M3U A;  1W9H A;  2OYQ A;  3HST B;  4I9L A;  3ZSZ A;  3I8D A;  2YNF A;  4DF4 A;  3AA4 A;  1JL1 A;  4JRQ A;  4R5P A;  1ASV A;  3RMC A;  3V9U A;  4B9V A;  2YNI A;  1QE1 A;  2Y1J A;  1FXX A;  2RN2 A;  2A1S A;  1TAQ A;  1F21 A;  4F2R A;  4FZY A;  4IKF A;  4FK4 A;  4KRE A;  3IG1 A;  4CJ5 A;  3M8Q A;  1NOZ A;  4CFA A;  1TK0 A;  4DTJ A;  1VRU A;  1FKO A;  2KZM A;  4CHQ A;  4FJ8 A;  4W5Q A;  4CF9 A;  5KTQ A;  1RBV A;  4DTP A;  3KLI A;  4QCL A;  4E1N A;  1O1W A;  3V9Z A;  3LZJ A;  4ZTJ A;  1YTU A;  2VG5 A;  1S6P A;  2VG6 A;  4AHS A;  4B8C A;  2XY8 A;  4C8O A;  4CJL A;  4DSI A;  4Y1D A;  3G0Z A;  3OYH A;  4IG3 A;  4CJK A;  1X9M A;  3S3O A;  1QTM A;  4HUF A;  2E6M A;  3QLH A;  4WE1 A;  3QNO A;  1NJZ A;  2OZM A;  4JS5 A;  2YHB A;  3H08 A;  3ALY A;  1ZBL A;  3NF6 A;  3L2W A;  2FBX A;  1A5X A;  4CJV A;  2Z1J A;  3KJV A;  2W42 A;  4CER A;  3ZSO A;  4CEC A;  3MXI A;  4KB1 A;  3VQ8 A;  1NK6 A;  1ZBI A;  3ZT0 A;  2KQ2 A;  4B9N A;  3V1Q A;  4I2Q A;  1VK0 A;  3NF9 A;  4FLX A;  4GMJ B;  3SI6 A;  4KHY A;  3QEP A;  1JLB A;  2YKM A;  2KFZ A;  4AHC A;  1YT3 A;  5DMR A;  4CJR A;  3PO5 A;  1HYV A;  4EZ6 A;  3VQP A;  1VSL A;  1CXU A;  3TAM A;  4CGD A;  1HYS A;  1VSD A;  1L3S A;  4DFK A;  4FJL A;  2F96 A;  3CM5 A;  4RW8 A;  4KHW A;  1U47 A;  1GOB A;  1N5Y A;  2QKB A;  3TAG A;  4LSN A;  2BDP A;  2Q3S A;  3SQ2 A;  3AA3 A;  3VQ9 A;  2D5R A;  2RKI A;  3AVJ A;  5KI6 A;  3ZT3 A;  3SYZ A;  2PYL A;  1KLN A;  3C95 A;  3PUF A;  1JKH A;  4F8R A;  2IS3 A;  4CE9 A;  3VQ6 A;  2ATQ A;  3RR8 A;  1VRT A;  2YV0 X;  3T3F A;  4DFP A;  1RNH A;  5I3U A;  1FK9 A;  4J2E A;  3MED A;  3VQ4 A;  4KKO A;  4XIU A;  5HRR A;  1JXB A;  2Z1G A;  3QIN A;  3NGZ A;  4BE1 A;  2FBY A;  3LP2 A;  1RTD A;  3OS1 A;  3PX4 A;  1D8Y A;  2G8F A;  4HCC A;  1CZ9 A;  1R0A A;  2P1J A;  4FJ5 A;  3RWU A;  4CJ4 A;  4Q0B A;  2XY7 A;  1IKX A;  3SUQ A;  3LAL A;  1T8E A;  4FK2 A;  2YNG A;  4M3Z A;  1YVU A;  4FZX C;  1LWC A;  4DF8 A;  3TAR A;  1RTH A;  3NF8 A;  1DLO A;  3L2U A;  4CF1 A;  4Z0U A;  2VWJ A;  1NK9 A;  3IAY A;  5KGW A;  4QAG A;  4DS4 A;  3PX0 A;  2P5O A;  4CFC A;  4HUE A;  2KTQ A;  3DRS A;  1SKW A;  5HRN A;  3ITH A;  3OYL A;  1C0U A;  4W5T A;  4IG0 A;  4MFB A;  3U3G A;  3QEW A;  4UQG A;  4KV8 A;  1XI1 A;  4EZ9 A;  3AVM A;  4CIF A;  3TAP A;  1I39 A;  4FLU A;  4ID1 A;  3HVR A;  1S6Q A;  4NYF A;  1SUQ A;  4OKK A;  3OYI A;  3EZ5 A;  4KB0 A;  4FJ9 A;  4CEQ A;  4CES A;  2G8K A;  4E19 A;  4NCA A;  1T7P A;  2HHV A;  3VQ7 A;  3ZT4 A;  4CEE A;  3OJS A;  3ZT2 A;  1B9F A;  1I3A A;  1CXQ A;  1RIL A;  1RT4 A;  1B9D A;  2WOM A;  2PY5 A;  3QER A;  4N76 A;  4DQQ A;  2HHQ A;  3RMA A;  1RT7 A;  3DYA A;  5CYM A;  5JS1 A;  2EHG A;  4CJ3 A;  3OYD A;  3K5N A;  1LV5 A;  3VQA A;  3TAN A;  3D0P A;  3MXM A;  4B9S A;  2OPS A;  3JYT A;  3AVK A;  3P1G A;  4KHS A;  3ZT1 A;  4CF8 A;  3QNN A;  3S3N A;  3OYB A;  4CGI A;  4LD0 A;  1RBU A;  3KD5 E;  2X6N A;  1JLE A;  3VQD A;  2KW4 A;  3TAF A;  1UA1 A;  1SL2 A;  2AJQ A;  2HB5 A;  3DLG A;  4CK2 A;  2Z1I A;  4DSK A;  1ASU A;  2X78 A;  4FW1 A;  3NGI A;  4CEF A;  3NH0 A;  4KHQ A;  3V1R A;  2D0B A;  1L5U A;  4F2S A;  4HTU A;  1NJW A;  2KZZ A;  2ITG A;  2GV9 A;  1Z26 A;  1TVR A;  5JS2 A;  1UA0 A;  4J2B A;  4ZTF A;  3WNG A;  1KVB A;  2YHA A;  1NK0 A;  3DLR A;  2XHB A;  3KK2 A;  2BGG A;  2DFE A;  3P5J A;  5FRO A;  3MEE A;  2O4G A;  3VQE A;  4DU1 A;  4RG8 A;  3AVA A;  2YNH A;  3V1O A;  2G8V A;  3L2Q A;  3FFI A;  3SUO A;  2HHU A;  1Z25 A;  2PZS A;  3OVN A;  3OYG A;  2DFF A;  4PA1 A;  4E1M A;  1S1V A;  5J2M A;  1RTJ A;  4CGH A;  3KD1 E;  1QHT A;  4CFB A;  3I0R A;  2E6L A;  2F8S A;  3DLK A;  3NH1 A;  4FM0 A;  1S9E A;  3K58 A;  4Z4G A;  1LWF A;  5SWM A;  3AO5 A;  3F9K A;  3HP6 A;  3F73 A;  3QEX A;  1QS4 A;  2IAJ A;  1DTT A;  1QQC A;  4CGF A;  1JLF A;  4CJT A;  3OYN A;  4OKJ A;  4FLT A;  4B9L A;  4FM2 A;  1BIZ A;  4Z4F A;  3HO1 A;  3QIP A;  3SNN A;  4E3S A;  4PUO A;  5K14 A;  3ZSY A;  3OS2 A;  3KKS A;  4BWM A;  4OKE A;  4FLY A;  3JSM A;  3NH2 A;  4K8X A;  1BQM A;  1J53 A;  3WNF A;  5FRN A;  1CZB A;  1KTQ A;  3V9S A;  3QET A;  4DTS A;  1BCM A;  3U6F A;  1TV6 A;  2XY6 A;  4JS4 A;  2BE2 A;  4AIL C;  4O4G A;  3PX6 A;  4KFB A;  3K59 A;  2HVH A;  4E7I A;  5CZ1 A;  3SJJ A;  1UOC A;  3KLG A;  1C0M A;  4DTX A;  4I7F A;  2OPR A;  4AHR A;  3PV8 A;  3O3G A;  1WAF A;  1WSH A;  1TKD A;  1KVA A;  3HPO A;  2KFN A;  1BCO A;  2IC3 A;  3SQ1 A;  3CFP A;  1S5J A;  4N41 A;  1JLC A;  4CHN A;  3M8R A;  4E7H A;  2OA8 A;  3KLE A;  3ASM A;  4FLV A;  4CED A;  5C25 A;  4CF0 A;  3SQ0 A;  4BE0 A;  2ZE2 A;  4F3O A;  3QEI A;  1U49 A;  3OYK A;  3CQ8 A;  1NK5 A;  1HQE A;  3K5L A;  3NHG A;  2OZS A;  4C8L A;  3DRP A;  1IKY A;  1JLG A;  4N56 A;  2IOC A;  3RTV A;  4NYN A;  3SZ2 A;  4DSF A;  1D9F A;  3RRG A;  3CG7 A;  3DI6 A;  4ZHR A;  4N47 A;  1TAU A;  3NFA A;  1NKE A;  1IKW A;  4J2A A;  3C94 A;  3P83 D;  3RMD A;  1A5W A;  1U45 A;  1S1W A;  4TSX A;  2HW3 A;  4CIG A;  4PY5 A;  3LPU A;  4IDK A;  3ZSV A;  4W5O A;  2DTU A;  1HPZ A;  4W5N A;  1S1U A;  2O4I A;  1RCH A;  3IS9 A;  1X1P A;  5C24 A;  4LSL A;  3L2R A;  1RBS A;  3QO9 A;  1U4B A;  1RDD A;  3LAK A;  1C1B A;  4I2P A;  1WSE A;  3HPH A;  1NKB A;  3B6P A;  5T7B A;  1N6Q A;  1QSS A;  3K5O A;  3KLH A;  4KRF A;  4G1Q A;  3NAE A;  1BI4 A;  1EKE A;  4E7L A;  1KFS A;  4CCH A;  2HVI A;  1DTQ A;  3QEV A;  1RBR A;  1RDA A;  3CM6 A;  2HHW A;  4CEZ A;  5SZT A;  4PQU A;  4CGG A;  3DLH A;  1NJY A;  3HT3 A;  3HK2 A;  3TI0 A;  4FJX A;  4OPK A;  4HCB A;  5C42 A;  4K8Z A;  3ZSQ A;  1J5O A;  4RW9 A;  1Q9Y A;  2YKN A;  2NUB A;  1SKR A;  4FJ7 A;  3OYM A;  4M3W A;  1C0T A;  4IFY A;  3K5M A;  1Q9X A;  5HP1 A;  4DFJ A;  3O3F A;  1NJX A;  2VWK A;  3LDS A;  1SV5 A;  3KLF A;  2IDO A;  4BDY A;  4DU4 A;  4O0J A;  4DFM A;  2D0A A;  1T03 A;  4OLA A;  4Z4E A;  3T19 A;  4B9T A;  3LAN A;  2P5G A;  3A2F A;  4C8N A;  3THV A;  1U48 A;  1VSM A;  1UAX A;  5E41 A;  1NKC A;  3BDP A;  4Y1C A;  4FJI A;  1IH7 A;  4NCG A;  2HNY A;  2VG7 A;  4OVL A;  4OLB A;  4M3R A;  3WNE A;  4PWD A;  2HHT A;  4OGE A;  4FJJ A;  3AA5 X;  3RMB A;  1BIU A;  1D9D A;  4JRP A;  1NK7 A;  1S9G A;  1W0H A;  3SUN A;  3O3H A;  5D3G A;  1HMV A;  2GBZ A;  4O0I A;  4DTN A;  4BDZ A;  4I9Q A;  3VQ5 A;  2X74 A;  4M45 A;  4HHT A;  4C8M A;  4CEB A;  4CJQ A;  1RBT A;  1S1X A;  2QKK A;  3LAM A;  1IKV A;  3OYJ A;  4CJU A;  4DLG A;  5J2N A;  3SCX A;  4FJM A;  1ZBH A;  4FW2 A;  3AO2 A;  3I0S A;  4DTU A;  1BL3 A;  3LZI A;  4KHN A;  4O55 A;  1BQN A;  1B92 A;  4ID5 A;  1VSF A;  3LP0 A;  1J54 A;  4FXD A;  4EP5 A;  3MEC A;  3SQ4 A;  4FK0 A;  3MAQ A;  3KKR A;  3AVC A;  3D45 A;  3HYF A;  4GVM A;  1VSE A;  1UWB A;  2RPI A;  5J1E A;  3SPZ A;  2OPP A;  1ZYQ A;  1BIS A;  1JXE A;  2WON A;  3NBP A;  1LAW A;  4ELV A;  1XHZ A;  3LP1 A;  3TAQ A;  3LWM A;  1RDC A;  2G8H A;  4KAZ A;  3BGR A;  2XRI A;  4KTW A;  4E7J A;  3U3Y A;  2HND A;  5EU7 A;  2DFH A;  2JLE A;  2OPQ A;  1RT5 A;  3VN5 A;  1NOY A;  3AVN A;  3HXM A;  5HBM A;  4DWI A;  2G8I A;  1RDB A;  1U04 A;  4BWJ A;  1JLA A;  4OJR A;  3IRX A;  3MXJ A;  3DLE A;  3AO4 A;  3AVL A;  4F4K A;  2BAN A;  3L2V A;  3CFO A;  2A1R A;  1QSL A;  3ZSW A;  3M8S A;  2IGI A;  3VQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...