5HRPA

Hiv integrase catalytic domain containing f185k + a124t mutations complexed with gsk0002
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 51
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrpA00
1TV6A 4CHPA 3HP9A 3KIOA 4E7LA 2EX3A 3TAEA 4KHSA 1QHTA 1JL1A 3G10A 4OPKA 5HRSA 2I5JA 4DWIA 5C42A 2D0AA 2X74A 2IDOA 3VQ7A 4OLBA 2YHBA 2ETJA 4KKOA 4LD0A 4OVLA 3ZSWA 1VSLA 3ALYA 3EZ5A 4FK0A 4KO0A 3HP6A 2P5OA 1ASVA 3H08A 4H4MA 2F8TA 3NF6A 3K5OA 1U45A 1K6YA 3DRRA 4M3YA 2QXFA 1Y97A 4JS5A 4KRFA 3E01A 4KTWA 1ZBLA 1C1BA 3OYNA 2VWKA 2IC3A 1RT4A 4KB1A 4KV8A 1SKWA 3ZT4A 1WSHA 1NJXA 3K58A 4I2PA 4KHWA 1SV5A 3AVJA 3DI6A 3VQEA 2WONA 1T03A 4KHNA 4J2EA 4PY5A 4Z0UA 3RMAA 4PQUA 4IG3A 1TGOA 3PX4A 3I0SA 3VQ4A 4N5SA 4E1NA 1RILA 4OPJA 3MEEA 4F2SA 1KFDA 3V6DA 2ZQBA 3S9HA 2G8KA 1C1AA 3LALA 5HRPA 3L2UA 3TWHA 1QS4A 1RBRA 4DTXA 1NJWA 2HVIA 3KKSA 4BE1A 4DSEA 1J5OA 4CF0A 3NGZA 3DLRA 4BDZA 3TAPA 1DTTA 4RW4A 2Z1IA 3AVMA 3RMBA 2VG6A 3V9UA 3MEDA 1YVUA 1BQNA 3SPYA 1UA0A 3KD5E 4FJHA 4KTZA 2G8UA 2G8IA 1LWEA 3IRXA 2Y1JA 1D8YA 4GVMA 1DTQA 2XY8A 3ASMA 4YFUA 3SI6A 1JLAA 4RW9A 4CIGA 4HTUA 3NAEA 3PV8A 3D0PA 1D9DA 2HMIA 3AO5A 3K57A 1J54A 1SUQA 1IKYA 4HHTA 4CK1A 5CY4A 4K8ZA 3HVRA 3VA3A 4ID1A 1T8EA 3LZJA 1JLQA 4E7IA 4F3OA 1TKTA 2Z1JA 5DMRA 3K2PA 3OYKA 5I3UA 1XHZA 4FZXC 3PO5A 3AO2A 3SQ0A 2XRIA 4RW7A 5CYMA 1S9EA 2B4JA 2JGUA 4AHUA 4CEZA 5KGXA 4O0JA 3LWMA 3CQ8A 4JRQA 5HP1A 3SCXA 3SNNA 4FJ5A 3O4NA 4HUGA 1VSMA 1UWBA 1NK6A 1X9MA 3B6PA 3I0RA 1RT1A 4B08A 4YNQA 4QAGA 1NJZA 2ITGA 4CJRA 4E7HA 2OPRA 2GUIA 1KCFA 3QNNA 1U04A 1XC9A 4HUFA 1VSHA 5D3GA 4FXDA 4CGHA 4FLUA 3LANA 5SZTA 4FCYA 4CJVA 1NJYA 3RTVA 2KFZA 4G1QA 5FRNA 1IKXA 1L3VA 1JLEA 1SL1A 4IKFA 1NK9A 3HYFA 4B9VA 3O4QA 1JXEA 1TAUA 1RBSA 3V9ZA 1NKEA 4NCGA 4DU3A 4F3TA 4EZ6A 4EP4A 5CZ1A 2QKKA 3HM9A 3VQ9A 1LWFA 3L2RA 1S6PA 4N56A 3F73A 1MU2A 1WAJA 3HPGA 3V81A 2HHWA 2XHBA 3DRPA 1QSSA 4LH4A 3LP2A 4JLHA 3VQDA 1R0AA 4CF9A 1KSPA 4CEBA 4C8KA 1REVA 4CECA 4E0DA 1VSDA 2HNZA 3OS2A 1BCMA 4EZ9A 3L3UA 3AVHA 4Q5VA 1WN7A 2VWJA 3IAYA 3NCIA 2B5JA 3OYAA 1WNSA 3BGRA 1N5YA 1FK9A 3VQ5A 1IKVA 1C0UA 4Y1DA 4DQPA 4DTRA 2OZSA 4AHVA 5J2PA 3DOKA 1WAFA 3OJUA 4CJ4A 5KRSA 3BDPA 4FJ8A 4PWDA 1RDAA 1RT3A 3S3OA 4IG0A 4DS5A 4DF4A 1WLJA 4DG1A 3A2FA 4FZZA 3MXIA 2FBYA 3M8PA 3S3MA 2HVHA 5SWMA 3VQQA 4CE9A 3VQPA 1QE1A 4OGCA 3NDKA 3QEVA 1Q8IA 4RW6A 1NK7A 4B9SA 3ZT2A 4DQQA 3DMJA 2F8SA 4B3OA 5C25A 1NOZA 3K5MA 4XIUA 4Z4IA 4DFMA 5J1EA 4I7FA 5DK5A 2PYJA 2EHGA 1S1UA 1RBUA 4MQ3A 4W5RA 3OS0A 3TAQA 1SKSA 4N41A 4DLGA 2F96A 3DM2A 3WNEA 1U47A 4FJ9A 3B6OA 3MEGA 3KLGA 3C94A 1RDCA 4BDYA 1TK5A 1BIUA 3NBPA 1IG9A 3OYEA 1RCHA 4CF8A 4CFDA 2HHUA 4J2AA 3DLHA 3OVNA 4ICLA 4HUEA 3LP3A 4GW6A 4KHQA 2DY4A 3OYBA 3PUFA 3ZSYA 4W5QA 4FLXA 3QNOA 1VRUA 3HSTB 2KFNA 3AVFA 4OGEA 3HO1A 3O3HA 1RT5A 3AVIA 3SYZA 4B9LA 5CZ2A 1B9DA 4DSIA 3K5LA 2ATQA 4FK2A 1RBVA 2OPPA 3KK2A 4F8RA 1YTAA 4DSFA 4DTMA 4CEQA 4FVMA 5K14A 1GOAA 3QIPA 4Z4FA 1VSKA 1Z26A 4E1MA 5HRRA 1HQEA 2KTQA 1CZ9A 4CJ5A 3KD1E 3CM6A 2D0CA 3VA0A 4M3ZA 3HXMA 4UQGA 2FBVA 4LSNA 4O5BA 3EY1A 3LP1A 1B9FA 2IGIA 4FYDA 4PA1A 2HHTA 1RDDA 3DOLA 4DF8A 1BCOA 2BANA 3CM5A 1IKWA 2HW3A 1TL1A 3L2QA 3NGIA 3U6FA 1KFSA 3C6TA 4DSJA 3VQAA 4CFAA 3NH1A 4KHUA 1W9HA 3U3GA 1NK4A 2G8WA 1QSLA 1C0TA 4CGIA 4Z4HA 3RMDA 3DLEA 4B8AB 4C8LA 3MXJA 1XWLA 4CF2A 4WE1A 3C95A 4IBNA 1RT7A 4AHTA 4CHOA 4BACA 4FJKA 3P83D 1WSEA 1TVRA 4FJLA 3CFRA 5E41A 4K8XA 3MECA 3QEIA 1ZYQA 2HHVA 3QO9A 1EX4A 3AA4A 1RTIA 3QEPA 3CYMA 1SKRA 3NGYA 1S1VA 4DU1A 4CJEA 4DSLA 2E6LA 1ZBIA 4W5OA 3SUOA 3HPOA 3VQ6A 2WOMA 3ZSXA 4DU4A 5J2NA 3I8DA 3KLIA 4OJRA 4O44A 1LWCA 3AVKA 1RBTA 3HT3A 3MAQA 3NF7A 4DTJA 3ZSOA 3T3FA 3KKRA 1FKOA 2IOCA 4CEFA 5HRNA 1UA1A 4FJIA 2O4GA 1G15A 2R7YA 3LP0A 4FLZA 4J2DA 1VRTA 1KLMA 3P1GA 4LY7A 1WSIA 1TAQA 4M3UA 3AVNA 2HNYA 3P5JA 2JLEA 1BI4B 4DTOA 4B9TA 4CF1A 1XHXA 3DRSA 3RRHA 3QERA 1EXQA 4CK3A 1FXXA 4FM2A 2PZSA 4M3WA 1UOCA 4ZTFA 1C0MA 1WSFA 1BHLA 1A5WA 4FLYA 3TR8A 1RT2A 2A1SA 3C6UA 5HBMA 1TK8A 3AVAA 4W5NA 3RWUA 2ZE2A 4ZTJA 1YTUA 1HNIA 4CCHA 3OYMA 4O55A 1SL2A 3AV9A 4E7JA 1HMVA 3D45A 1CXUA 1L5UA 3SUQA 4OLAA 1NK5A 3V1QA 4O4GA 3KLEA 3HJFA 2D0BA 2GBZA 2YHAA 1BISA 3OY9A 1HJRA 5HROA 2E6MA 1JLGA 4M42A 5JS2A 4CERA 1DLOA 2HNDA 1Q9YA 5CYQA 4M3TA 3SZ2A 3U3YA 1NK8A 4I9QA 3NF9A 3PX6A 4HCCA 1ZBFA 1JLCA 3NE6A 1CLQA 3AO1A 3NF8A 3LZIA 3HK2A 3ZSVA 3ZT3A 4DQIA 2KQ2A 3FFIA 4KREA 1JLBA 1LAVA 1ZBUA 3ITHA 3NFAA 4C8MA 3ZSZA 1NOYA 4KAZA 2P1JA 5FRMA 3HVTA 4CJKA 1HYVA 3PY8A 4BE2A 1KVAA 1LAWA 2Z1GA 4FJGA 4HCBA 4KPYA 2BDPA 2IS3A 3VN5A 4GMJB 2E4LA 3IS9A 4OKEA 1ASUA 4AHSA 1TKZA 3ZCMA 4N47A 3AO4A 3DYAA 3PO4A 4DS4A 1EP4A 3KLFA 3VQBA 1TKDA 3OYIA 3WNGA 1RDBA 2FBXA 3SUNA 2BE2A 1J9AA 5FDLA 3QEWA 2OA8A 4DSKA 1ZBHA 1HPZA 4KFBA 3G0ZA 4HVJA 3F9KA 4CJQA 3EYZA 2XY7A 2OPQA 4LH5A 3QESA 3SQ4A 4N76A 2A1RA 3NH2A 4IDKA 3ULDA 1QSYA 3VQ8A 2DTUA 1BIZA 4BWMA 1WSJA 1JXBA 3QINA 4CHQA 4M3RA 3LAKA 3L2WA 5KTQA 2ZD1A 1YT3A 1C6VA 4CEEA 5J2QA 4Z4GA 4M45A 2HB5A 2AJQA 3O3GA 1BI4A 5C24A 1GOBA 4C8OA 1A5XA 4NCBA 2FC0A 2P51A 1EKEA 3JYTA 3WNFA 2VG5A 2OZMA 2YNHA 2W42A 4DQSA 1NKBA 2RF2A 1L3SA 3T19A 3ISNC 3ZSRA 2OPSA 4CK2A 4CFBA 3SPZA 1NKCA 4CESA 3QEXA 3M8RA 4CJWA 3LPTA 2XO7A 3QETA 4CJLA 2HHSA 1X9SA 1T7PA 4CJUA 4KB0A 3S3NA 4EP5A 4H4OA 1S5JA 4NYNA 1U48A 4KHYA 2GV9A 3HPHA 3CFPA 2YNGA 1ASWA 4OKKA 1TK0A 1JL2A 4CJTA 4E89A 4BE0A 4E7KA 4O0IA 3NH0A 1IO2A 2O4IA 3QLHA 3LWLA 5HLFA 1HYZA 1HYSA 4CJPA 1C1CA 4CEAA 4DFKA 3K5NA 4NYFA 4ELVA 2KZMA 3DLGA 1ITGA 2FBTA 5KGWA 3TABA 4B9NA 3ZT0A 4FJMA 1BL3A 4JRPA 3SUPA 1VSEA 2G8HA 2LSNA 4E3SA 1JKHA 3L2VA 1HRHA 3M8QA 4CGGA 4CGDA 4CHNA 3KTQA 1QQCA 1VK0A 3CFOA 3ZT1A 3NHGA 2OYQA 3RR7A 1L3UA 2X6SA 4CGJA 3V4IA 1I39A 3TAGA 4FJJA 1TKXA 1B92A 4CJFA 4QOZB 2XY6A 1BGXT 4C8NA 2DFHA 4AH9A 4DFJA 3RRGA 4FLTA 3V9SA 4DTUA 3PX0A 4KI6A 3QIOA 1VSJA 4W5TA 3OYLA 3RR8A 2X6NA 3AA3A 4E19A 1KLNA 1WSGA 2RPIA 1VSFA 3AA2A 5EU7A 2RN2A 3AA5X 4I9LA 1UAXA 3SV4A 1LV5A 1KVCA 3OYDA 4BDPA 2BGGA 4FM0A 4CGFA 1HQUA 1U49A 4Q0BA 1FKPA 4M41A 5FROA 3OYJA 1S6QA 1I3AA 4IFYA 3DLBA 1L3TA 4ELUA 4FZYA 4QCLA 4H8KA 4F4KA 3CG7A 2KW4A 3AVLA 2YKNA 4CIEA 1RT6A 1N6QA 1KVBA 4PUOA 3AVBA 5I42A 2PYLA 3KLHA 2D5RA 3KK1A 4JS4A 2RKIA 1HNVA 4MFBA 3RMCA 1T05A 4J2BA 3L8BA 4RW8A 4AHCA 4AHRA 4TSXA 4CHZA 1RTDA 1CXQA 4CFCA 4DTPA 2IAJA 3AVCA 4CEOA 3JSMA 2Y1IA 4R5PA 1S9GA 2XY5A 2B6AA 2P5GA 3TANA 2PY5A 3SQ2A 3WNHA 3THVA 1W0HA 2VG7A 3V1RA 3OYFA 3M8SA 4KI4A 4DMNA 3KJVA 2DFFA 3V9XA 2G8VA 3V1OA 1Z25A 2G8FA 2Q3SA 4CEDA 4DFPA 3VQCA 3TARA 4I2QA 3TAMA 3UIQA 2QKBA 4FM1A 4FJNA 5J2MA 4ID5A 1S1WA 3SJJA 4DTNA 2YNIA 4RG8A 4LSLA 5T7BA 4FLWA 1J53A 4L8RB 1CZBA 2DFEA 3AVGA 1A5VA 2HHXA 4FK4A 1VSIA 3AO3A 4DTSA 2QK9A 1X9WA 1KTQA 1Q9XA 2YKMA 1LW0A 1F21A 1IH7A 5JS1A 4DLEA 1SL0A 4CHYA 4ELTA 1S1XA 3SV3A 1QTMA 1RNHA 3O3FA 4CIFA 3IG1A 4FW2A 4B8CA 4Z4CA 5KI6A 4AILC 1XI1A 4CJ3A 3KK3A 1RTJA 4FJXA 3OJSA 1LW2A 1D5AA 2YNFA 1O1WA 3MXMA 4IFVA 4NCAA 3LDSA 2KZZA 2NUBA 3ZSQA 3L3VA 3OYGA 4FJ7A 1BQMA 1GOCA 4M3XA 1JLFA 3LPUA 3K59A 3SQ1A 3DLKA 4OKJA 4BWJA 3OS1A 2X78A 2YV0X 4FLVA 4KTQA 3HL8A 1NK0A 3OYCA 4FW1A 3T1AA 4CJSA 4ZHRA 4B9UA 2HHQA 1KRPA 4Y1CA 4DQRA 3LAMA 1EETA 1X1PA 1U4BA 4B9MA 4Z4EA 2Z1HA 1TL3A 3V9WA 3TAFA 1D9FA 4F2RA 3OYHA 1S1TA 5KRTA 1RTHA 3TI0A
chains in the Genus database with same CATH superfamily
3KIOA 4E7LA 4IJAA 4DWIA 1NGHA 3VQ7A 4KKOA 4OVLA 3HP6A 2P5OA 4B9QA 4H4MA 4BGBA 3VEOA 3K5OA 1U45A 3DRRA 4M3YA 3RSEB 3CC4N 4DR1K 2VWKA 4MO4A 4BC5A 3K58A 5C2DA 4KHWA 3DI6A 1T03A 4J8FA 3QBXA 3A0IX 1BWFO 4IG3A 5B8HA 2I7PA 4N5SA 3W3DA 2Q2RA 3JS6A 2W40A 2A42A 2JWKA 3KKSA 3MWTA 4DSEA 1J5OA 1VQ6N 3PLAA 3TAPA 4JKFA 1YVUA 1BQNA 4FJHA 2E20A 3HRGA 4JV5K 1D8YA 1DTQA 4XEIA 3ASMA 2YHYA 3O9RA 1JLAA 4RW9A 4HTUA 3D0PA 2HMIA 4HHTA 1J54A 1IKYA 2UXCK 3LZJA 1JLQA 4E7IA 3OYKA 3C65A 4K0KK 4HWIA 3SQ0A 5CYMA 4LF8K 2JWLA 1S9EA 4AHUA 5ADXA 1GLJO 1N8RO 1NJZA 5F0XA 1IBLK 4E7HA 3IDHA 2GUIA 1P8ZA 3QNNA 4DCHA 4HUFA 3EE8A 1NGIA 3K9KA 4GY2B 4CJVA 3SBGA 4G1QA 4DR6K 4DR7K 1NK9A 3RSEA 1JXEA 3VETA 1RBSA 3A5LC 3CJ1A 1KC8O 3G6EN 1HNWK 2QKKA 3QDKA 4BGAA 3PY8A 1LWFA 3B8AX 1J6ZA 2W41A 4ILJA 3LP2A 2OTLN 5AQJA 4BRAA 1REVA 4BRHA 3KHYA 1NMDA 1N33K 4Q5VA 1M90O 4JKGB 1WNSA 1N5YA 1FK9A 1GLBG 3HM8A 4Y1DA 2QWPA 4YOTA 2ITMA 5DM6L 5J2PA 1HKCA 1QVGM 1ATSA 1VQPN 3E9OA 3H3OB 1J5EK 2CGLA 1S3XA 1OVQA 4BRIA 4BRGA 3VQPA 1QE1A 2D4WA 3QEVA 2F8SA 5I9EB 3SAGA 1NNEA 5C25A 2EHGA 1RBUA 4MQ3A 4W5RA 4DLGA 3WNEA 3B6OA 3C94A 1RDCA 1BIUA 1IBMK 4GNIA 3OYEA 2FF3B 5HL7L 4BR9A 3DLHA 4LF4K 2PBDA 4JI1K 4C23A 2DPNA 4GW6A 3G25A 3ZSYA 4W5QA 2P9LB 1VRUA 3HO1A 3AVIA 4DSIA 1RDUA 3R8EA 4DTMA 4FVMA 1VSKA 4CJ5A 4PHTX 3F9MA 4UQGA 4JN4A 5EX5A 4PA1A 3DOLA 3CM5A 3H6EA 1IKWA 1TL1A 3L2QA 4IFEA 3HSCA 4DV4K 3AAPA 1VQ9N 4KHUA 1W9HA 1S22A 4JKGA 4WFNL 2G8WA 3D2FB 3DLEA 4B8AB 4C8LA 3MXJA 4BC2A 1ZYQA 2HHVA 3J81O 2NRRA 3ATUA 3QEPA 5C10A 3CYMA 3UE5A 1VAZA 2P9IB 3VQ6A 2HOEA 5J2NA 3KLIA 1RBTA 1ZBLA 4CEFA 1UA1A 4FJIA 3NMUA 2R7YA 4FLZA 2FLOA 3KK7A 4LY7A 1WSIA 4M3UA 4BRFA 2JLEA 5KPZA 4CF1A 1QZ6A 2P9LA 4FOIA 3SAHA 4M3WA 1UOCA 4B3TK 4ZTFA 4A5AA 3P31A 3TR8A 5HBMA 3RWUA 4H5TA 4ZTJA 4CCHA 1OH5A 2IIRA 4IWVA 3AV9A 4OPAA 1HMVA 1CXUA 3M6GA 1L5UA 4KH4A 1E4GT 4RWTA 1GLDG 1BISA 1BG3A 2E6MA 2O8EB 3EO3A 5JS2A 4CERA 4CVNE 4RCHA 4M3TA 3C6AA 3U3YA 4I9QA 3NF9A 2NRZA 3CC7N 3TPQA 3NE6A 3HK2A 5CHIA 4KREA 3D2FA 1ZBUA 3ITHA 3NFAA 4KAZA 4FWRA 5JLFA 3HVTA 1HYVA 3A8YA 5FPDA 4HCBA 4JYAK 3VN5A 2A40A 3QBWA 4IEIA 2E4LA 3IS9A 1ASUA 3ZCMA 1NGFA 4X64K 3DYAA 3KLFA 1TKDA 1YUWA 3FR0A 3WNGA 4YORA 4MDBA 2P9IA 4KFBA 4HVJA 1NGEA 4CJQA 5CE3A 2OPQA 4GV3A 2NRWA 4IDKA 2DTUA 4BWMA 3KWIA 2UXBK 4M3RA 5KTQA 4Z4GA 3AARA 1WUAA 4C8OA 1GOBA 1EKEA 4CW7B 3ZSRA 1TUUA 4CESA 3QETA 2HHSA 1X9SA 3CCEN 4KB0A 4EP5A 4NYNA 4EAHD 1U48A 4BR0A 3HPHA 5LJWA 4BRKA 4BE0A 3CJ7A 4O0IA 4FOEA 2O8EA 3E9LA 1HYZA 4YOWA 4CEAA 4DUZK 4PL7A 3DLGA 3TABA 2CH6A 3ZT0A 2OCEA 4LF5K 3RVCA 1HRHA 3M8QA 3ZT1A 4H0XB 4FJJA 1TKXA 1YF5L 4QOZB 2XY6A 1BGXT 4JI5K 3PX0A 5AFUA 3DWLA 3OYLA 3RR8A 3O9QA 4DV1K 3VOVA 4FL9A 1VQ5N 2RN2A 1UAXA 2BGGA 3OYDA 4PKIA 4L3QA 4CGFA 1HQUA 1FKPA 5FROA 2QWLA 4ELUA 4QCLA 2HMPA 1WBBA 4NB4A 4CIEA 1RT6A 1N6QA 1KVBA 4PUOA 2PYLA 2D5RA 4FO0A 3KK1A 3OW2M 4JS4A 1HNVA 4ILHA 3IMXA 4BRCA 3RMCA 4CZLA 4AHCA 3L6QA 1JCGA 3CI5A 4DV7K 4DTPA 4MDAA 4R5PA 1QVFM 3O9TA 3I33A 5M1QA 3WNHA 3THVA 1W0HA 2VG7A 3OYFA 3O8MA 4NLBA 3D7EO 3N4PA 5FPEA 1FJGK 2G8VA 4CZFA 4JK8A 2Q3SA 4CEDA 4I2QA 3LDLA 3FZLA 4ID5A 1NGGA 4JI0K 3WXMB 4LSLA 4L8RB 3LL3A 2HHXA 2RHKA 1VSIA 3AO3A 2QK9A 1LW0A 5JS1A 4EFHA 4FWKA 2PFUA 1QTMA 1RNHA 3MK6A 1BA0A 3IG1A 4YDUC 4B8CA 3VENA 1XI1A 5AQHA 5AQYA 1LW2A 5AQNA 2YNFA 3MXMA 2E2OA 3ZSQA 3CCSN 4M3XA 4OPHA 3LPUA 3Q7BA 2CH5A 4BWJA 4B1WB 2X78A 4FLVA 4BRNA 4FPAA 4WCEL 4JI3K 4F2RA 1RTHA 2VWBA 3CJ9A 4BRPA 5BR9A 4OPKA 2I5JA 4OLBA 3O1WA 1VSLA 3EZ5A 2BH1A 3H08A 2F8TA 3NF6A 3MCPA 1K6YA 2QXFA 4KRFA 3E01A 3OYNA 2O8DB 3ZT4A 4BROA 2ZJPL 3VQEA 2WONA 5AQPA 4Z94A 4Z0UA 3RMAA 4ILGB 3I0SA 3VQ4A 5A2QO 1NG9A 4E1NA 4OPJA 3MEEA 3V6DA 2ZQBA 3FE1A 3VESA 3H45C 4O8KA 2V52B 3DLRA 1DTTA 1N36K 2Z1IA 3AVMA 4PKGA 1RDWX 1UA0A 3H1VX 2G8UA 3BY5A 2Y1JA 4FWMA 2XY8A 3SI6A 1D9DA 4CIGA 1E4FT 3HOTA 1SUQA 3TTFA 1IG8A 4BVOA 4ID1A 4F3OA 4FZXC 5LMUK 1QZ5A 3AO2A 3PO5A 3QFPA 4QS7A 3CQ8A 4JRQA 3LWMA 1VSMA 1UWBA 3WXIA 3I0RA 3LDOA 1RT1A 2ITGA 4CJRA 1XC9A 1VSHA 4CGHA 5AQSA 1GLEG 1VQKN 3CCLN 1SL1A 4IKFA 1MA9B 4B9VA 5EY4A 4EHTA 2O8DA 4EZ6A 3MX5A 4H5RA 4BR5A 3HM9A 3V81A 3F73A 4IOCL 3ID8A 2HHWA 2A41A 3DRPA 1QSSA 4LH4A 3SMSA 5BREA 2W6KA 4BVPA 3AGKA 1V4SA 1BCMA 1U2VB 3VERA 1WN7A 3IAYA 2CGKA 1C0GA 1DKGD 2NRXA 4XH1A 3OYAA 5M1NA 4BQZA 1IKVA 1C0UA 3DOKA 1WAFA 1HX1A 5KRSA 3PSIA 3J7AP 1GLAG 3S3OA 4DS5A 3TTCA 3QB0A 3MXIA 2FBYA 3CHWA 1VQLN 3D2EB 3QMLA 1Q8IA 4RW6A 1NK7A 4CBWA 3CMEN 3DMJA 1NOZA 4XIUA 5J1EA 4LFBK 3JXUA 3TAQA 4JI6K 3DM2A 3MEGA 3NBPA 3P39A 2VQEK 3ENBA 2HHUA 1DT9A 3R6MA 3AY9A 2Q36A 3OVNA 4HUEA 3LP3A 3OYBA 1X9JA 2GELA 3AVFA 1RT5A 5LJVA 5BRHA 3SYZA 1BDGA 5CZ2A 4FK2A 1RBVA 4CI6A 4F8RA 5K14A 4IXCA 4Z4FA 4E1MA 5HRRA 3CM6A 4ISEA 4WFBL 2FBVA 4LSNA 4O5BA 3IFRA 2IGIA 3BF1A 2E2NA 3M3ZA 1T44A 2E2QA 4DF8A 1BCOA 2BANA 2HF3A 3U6FA 4DSJA 1KFSA 3WXKA 1U2VA 3EL2A 3NH1A 3G71N 3U3GA 3VF6A 1QSLA 4Z4HA 3OHRA 4WE1A 3CMAN 3HTVA 5F2RA 4FSVA 1YJWN 4CZJA 4FWPA 4FJLA 5E41A 2QW9A 3MECA 3THWB 1ESVA 3D2EA 3MN6A 2GWKA 4CJEA 4DSLA 3J7YP 4H0PA 3HPOA 1ZC6A 3VGKA 3AVKA 4DTJA 1XQSC 3HT3A 1FKOA 3CCVN 2O4GA 4J2DA 2NLXA 4M7XA 4B1XB 2HNYA 1BI4B 2VYPA 1RGIA 3TSPA 3DRSA 2P9SB 4FM2A 2PZSA 3O80A 4EIAA 4IZ9A 4KHPK 1WSFA 1WOQA 4W5NA 3AVAA 1YTUA 4BR7A 1K73O 4AF1A 3MDQA 3R9PA 4BC3A 2QA4N 1NK5A 4A62A 1VHXA 3OY9A 1HJRA 3ZX2A 4M42A 1JLGA 4AQYK 3TTDA 1DLOA 3T1HK 1Q9YA 1NK8A 4HCCA 1QQNA 2A6AA 1CLQA 3AO1A 3WQTA 3ZT3A 1JLBA 1VQ7N 4C8MA 5BPLA 3D6RA 1SAZA 4CJKA 4WQ5A 4BE2A 4FJGA 1LAWA 2ZJQL 2YX6A 4OKEA 4AHSA 4JHDB 1E3MA 4N47A 1EP4A 3ENHA 3DLLL 3THWA 2D0PA 1J9AA 5FDLA 4BREA 4DSKA 4GVEA 4N76A 3SQ4A 3QESA 5E84A 2A1RA 1QSYA 3VQ8A 4CHQA 3CCJN 3L2WA 1YT3A 1BO5O 1C6VA 4CEEA 3CC2N 1HLUA 4M45A 3NVMA 3LDQA 3O3GA 1BI4A 4H0TB 4NCBA 2P51A 2P9SA 2IVPA 5EXWA 1ZXOA 2CGJA 2YNHA 2W42A 4DQSA 2GEMA 2OPSA 1JCEA 3LPTA 1Y64A 3R3LA 4CJUA 3T7ZA 4JI2K 1T3VA 5AZIB 3BZCA 4AM7A 5M1FA 1TK0A 4E7KA 3EZWA 1IO2A 2O4IA 4V19S 3K5NA 4KH5A 2FBTA 2I7NA 1N34K 4JRPA 4BG8A 2G8HA 1JKHA 3L2VA 3WXJA 3VF2A 1VK0A 1NWKA 1L3UA 5C0YA 4CGJA 1NLVA 1YAGA 4AH9A 4JHDA 5AQKA 2GX9A 2HBMA 4KI6A 1VSJA 3WUHA 4Y0WA 4E19A 3AA2A 1VSFA 2DY4A 3SV4A 4I9LA 4XH5A 4BDPA 4MLEA 3ZX3A 4FM0A 2FF6A 4Q0BA 3OYJA 3HBTA 4LC9B 1L3TA 3CG7A 3LDNA 2YCHA 5AQXA 1HJOA 1GLLO 2KW4A 3AVLA 2YKNA 1W7AA 4QS9A 4A2AA 5LL6Z 2RKIA 4DHYA 3FZMA 2E1YA 1T05A 3L8BA 4RW8A 4AHRA 3PSFA 5BPNA 1MWKA 1DGKN 3UB5A 1RTDA 4CFCA 4CEOA 3AVCA 2Y1IA 4DQ8A 2P5GA 4GV6A 2GWJA 3VEWA 3ENOA 3V1RA 4ISFA 5AZIA 2DFFA 3V9XA 5BR8K 3V1OA 1Z25A 2UYTA 4DFPA 4DB3A 5J2MA 4I6MB 4K43A 5AQWA 5GADP 3ZX0A 3EKSA 5T7BA 4C1NK 1CZBA 2DFEA 4FK4A 1Q9XA 5BN8A 1EWRA 1D4XA 3L4QA 3LM9A 4DLEA 5FLXO 1S1XA 3O3FA 5KI6A 3BUZB 4AILC 4JKDA 4CJ3A 4X62K 3KK3A 4B3SK 1RTJA 3OJSA 1D5AA 1O1WA 3R1XA 4IFVA 5LY3A 1JCFA 1EQYA 1IJJA 2NUBA 3J80O 3OYGA 1BQMA 1GOCA 1NU0A 3CCUN 1OH6A 3ZLJA 3DLKA 5AQLA 3SBTA 2YV0X 1W2BM 3T1AA 4CJSA 2OTJN 4ZHRA 4B9UA 1KRPA 4DQRA 1LOTB 1EETA 1X1PA 2WC9A 1U4BA 3V9WA 3O6WA 1D9FA 4DTNA 1K8KB 5BRDA 4CHPA 3HP9A 2EX3A 1YI2N 3E1YA 1QHTA 1JL1A 3G10A 5HRSA 4X65K 1EO1A 5C42A 2D0AA 1GLFO 2IDOA 3ZEUB 2D0OA 2YHBA 2ETJA 4LD0A 3ALYA 4KO0A 3DXMB 2VQFK 1Y97A 1T6DA 2IC3A 2Q0RA 4KV8A 1WSHA 2YHWA 5AJ3K 1Q18A 5ELZA 4I2PA 1SV5A 4FPBA 4A57A 4KHNA 4PY5A 4PQUA 1TGOA 2HF4A 3MMVA 1Q81O 4I6MA 5FPNA 2G8KA 1C1AA 5HRPA 1NJWA 4BE1A 3NGZA 3CJBA 4RW4A 3K9JA 3RMBA 3T69A 2VG6A 1NJIO 3I55N 2YI1A 3F2KA 3SPYA 3KD5E 2O8CB 4KTZA 3EEQA 3VTIA 3HI0A 2G8IA 1LWEA 1Q82O 4GVMA 3AGRA 4B3MK 4YFUA 3M1FA 3NAEA 3AO5A 4H0OA 4CK1A 3WXLA 1WBDA 5KQDA 2QWMA 3HVRA 1T8EA 1OVYA 1TKTA 1T6CA 2Z1JA 3K2PA 3O5BA 5DMRA 2JGUA 2B4JA 4XH4A 4CEZA 4GKKK 4O0JA 1FW6A 3SCXA 4FJ5A 2KLAA 1K8KA 2Q0UA 4QAGA 2FSJA 3EKUA 3Q7CA 3ZEUA 4FLUA 3TSQA 4FCYA 4LFCK 1NGBA 3RTVA 3BEXA 3DXMA 4DV3K 1L3VA 3EE9A 2OANA 2P9NB 5IWAK 1TAUA 1OKJA 4LF9K 4IOAL 1NKEA 4NCGA 4DU3A 2F9WA 5CZ1A 3S41A 3L2RA 1S6PA 3P4IA 4N56A 1MU2A 2XHBA 4LF6K 4CEBA 4CECA 3OS2A 4FWSA 3L3UA 4PL8A 3AVHA 2VWJA 4NXMK 3NCIA 3BGRA 3CCQN 4DQPA 4DTRA 2O8CA 4CJ4A 3BDPA 4WQ5C 1RT3A 3OBWA 4IG0A 4DF4A 1NM1A 4FZZA 1XUPO 4B1UB 2HVHA 5SWMA 3VQQA 3A5NC 3NDKA 3ULEB 2HHHK 5JLHA 3ZT2A 4B3OA 3K5MA 3IUCA 4Z4IA 4DFMA 1BU6O 4I7FA 5DK5A 1S1UA 3OS0A 1SKSA 2F96A 1U47A 4FJ9A 3KLGA 1IG9A 1TK5A 3GL1A 4BQLA 1BOTO 3CD6N 1RCHA 4CF8A 4J2AA 3G4SN 4B3RK 2P9PB 3O4WA 3T1YK 5JVGL 4X66K 3CXCM 3MCAB 1R59O 4FLXA 3QNOA 4OGEA 4YOVA 4B9LA 3K5LA 2ATQA 1Q86O 2P9NA 3DJCA 3AAQA 4CEQA 1HPMA 3CJAA 5AQIA 1HQEA 2KTQA 1BA1A 4DV2K 3KD1E 1YJ9N 2D0CA 3HXMA 3M5RA 4FYDA 1RDDA 4JKCA 1KQSM 4JEPA 2HW3A 1QQMA 2ASPA 4CFAA 3CPEA 3U9ZA 4H0VB 4CGIA 3RMDA 1HR0K 2WBNA 1XWLA 4CF2A 3C95A 4IBNA 4AHTA 4CHOA 4BACA 3P83D 1WSEA 3OBYA 3UKUB 3MN5A 3QEIA 4K8XA 3QO9A 1RTIA 1SKRA 2QM1A 4F9OA 3ULEA 5AR0A 3I8DA 4OJRA 3T3FA 5FRMA 4MLHA 1G15A 4JI4K 3MWPA 3SJHA 4BRMA 1KLMA 2H3GX 4H5NA 4NXNK 1TAQA 3AVNA 2NRHA 3P5JA 2P9PA 3VF4A 4B9TA 1XHXA 3QERA 1EXQA 4CK3A 4K42A 1NGAA 1C0MA 3VPZA 1A5WA 2A1SA 1TK8A 3I8BA 1HNIA 4B1VA 3BF3A 4O55A 1SL2A 3D45A 3SUQA 4O4GA 2F7TA 5MLCQ 2D0BA 3KLEA 5HROA 2YHAA 3I56N 3SZ2A 1BUPA 3PX6A 1ZBFA 4CZMA 1JLCA 3NF8A 3LZIA 1YVNA 4DQIA 2KQ2A 3CQXA 3FFIA 1LAVA 4YOUA 2P1JA 1NBWA 2UUBK 1KVAA 1NGCA 2BDPA 2IS3A 3HOSA 4GMJB 3DAWA 3UKUA 1KAZA 3THYB 5IT9O 3FZFA 2P9UB 4DS4A 3VQBA 3GDQA 2E8AA 2IVNA 1S72N 1RDBA 3THXB 3SUNA 1XNQK 2BE2A 3QEWA 2OA8A 1ZBHA 3SK3A 4IO8A 4MO5A 3EYZA 5M1KA 2XY7A 3NH2A 3DXKB 1JXBA 3C7NB 2D1KA 2V7YA 3QINA 2RE2A 3LAKA 5DM7L 4R79A 2ZD1A 3KWGA 4K25A 2HB5A 2AJQA 5EVZA 5C24A 1A5XA 5EOYA 3WNFA 4M63C 1NKBA 3T19A 1NKCA 3SPZA 4CFBA 3QEXA 2WFBA 2XO7A 3K0SA 4CJLA 2ZJRL 1T7PA 3S3NA 4H0YB 4H4OA 4CZEA 1S5JA 2YHXA 3QFUA 2GV9A 1VQNN 3CFPA 1ASWA 4OKKA 4CBXA 4CZIA 1SZ2A 5FPMA 4E89A 2QWRA 2IVOA 3OTOK 4DFKA 4ELVA 2KZMA 4BRLA 4FJMA 1ITGA 2VGNA 4B9NA 3O1BA 3ZYYX 2LSNA 2UU9K 5E26A 2HBJA 4CGGA 4CHNA 4CGDA 5GIPA 3KTQA 1QQCA 3CFOA 3NHGA 2GUPA 4JKAA 2OYQA 4CZGA 4IO9L 3RR7A 3NVKA 3VEXA 4JK9A 1WB9A 5C2FA 3V4IA 1I39A 3TAGA 4C8NA 2DFHA 4DFJA 3THYA 4M7YA 3VGLA 4FLTA 2P9UA 3QIOA 4E1JA 1K8AO 1K9MO 3THXA 4JKHA 2Q1NA 1WSGA 1LV5A 3AA5X 3JAMO 3EN9A 4BY9C 4M41A 5GIOA 3DXKA 4F4KA 3C7NA 2QWOA 3VEYA 3OA9A 5I42A 3KLHA 4O8UA 4AM6A 2BTFA 4JAXA 4MFBA 1DEJA 1C0FA 1EWQA 4KBOA 4J2BA 4U7BA 1HNZK 2YJEA 5M1PA 1VQ8N 3FLCO 1CXQA 3JSMA 4IEEA 1S9GA 2B6AA 3TANA 5AQQA 4KI4A 3KJVA 2QEXN 4FWQA 2FSKA 2UXDK 2QKBA 3TAMA 3UIQA 4LFAK 4FM1A 3ATVA 4WFAL 1S1WA 1GLCG 1A5VA 3BZKA 4DTSA 1KTQA 2YKMA 2Q97A 1IH7A 1SL0A 3W0LA 4CHYA 4ELTA 4UY8O 4PKHA 4CIFA 3UKRB 1ILYA 2HBKA 3VEZA 1N32K 4JKBA 4YDUA 2KZZA 3FZKA 3L4IA 1JJ2M 3K59A 4OKJA 2ZGZA 1X3NA 1NK0A 2E1ZA 4C1NI 5AQTA 2HHQA 4WQ4A 1HKGA 1XC3A 3LAMA 1HKBA 2Z1HA 1TL3A 3KZBA 5KRTA 1TV6A 3VMFB 1VQMN 3TAEA 4KHSA 3CERA 3O9UA 2X74A 2O8BB 3ZSWA 4FK0A 5AFUH 5AQMA 1ASVA 2HBLA 3H3NO 1YHQN 2J4RA 3CJCA 4JS5A 4KTWA 4BRDA 1C1BA 5AQOA 4B1YB 1RT4A 4KB1A 1H1VA 1SKWA 4RTFD 1NJXA 2F9TA 3QICA 3AVJA 3F5TA 4J2EA 4DV5K 3C0BA 3PIOL 3PX4A 1RILA 4F2SA 1KFDA 3E9PA 3S9HA 3LALA 3L2UA 3TWHA 1QS4A 1RBRA 4DTXA 3J8AA 2HVIA 4H5VA 4CF0A 4BDZA 1QQOA 3N4QA 3SMPA 3V9UA 3MEDA 4DR4K 1KAYA 1O13A 3UKRA 4OO1J 3IRXA 3CQYA 5HOOA 3PV8A 3K57A 1YJNN 5CY4A 4K8ZA 3VA3A 1XHZA 5I3UA 1TUYA 2XRIA 4RW7A 5KGXA 1KSPA 1XNRK 5HP1A 3SNNA 3O4NA 4HUGA 1NK6A 4WF9L 1X9MA 3B6PA 4B08A 4YNQA 2GTDA 2ZGYA 2ZWHA 2E2PA 4LF7K 2OPRA 2P9KB 5JMVA 1KCFA 5GAEP 4FXDA 1U04A 3WEEB 5H1SQ 4YOXA 5D3GA 2O8BA 3LANA 5C15A 5SZTA 5KQ8A 3E66A 2NNWA 1NJYA 2ASOA 2KFZA 5FRNA 1IKXA 1JLEA 4O5FA 1QHAA 3HYFA 3O4QA 4JI7K 3V9ZA 3HZ6A 4F3TA 4EP4A 1MWMA 1U6ZA 3CF5L 3VQ9A 5C12A 1WAJA 3HPGA 1YIJN 4JLHA 3VQDA 1R0AA 4CF9A 4C8KA 4E0DA 1VSDA 2HNZA 4JK7A 4DV0K 4EZ9A 2B5JA 3VQ5A 5AQFA 2OZSA 4AHVA 3OJUA 4FJ8A 1RDAA 2NZTA 4A61A 1WLJA 4DG1A 3A2FA 3M8PA 3S3MA 3FFKB 4CE9A 4OGCA 4B9SA 4DQQA 3IKMA 1LCUA 1RFQA 2PYJA 4N41A 4BDYA 1MDUB 5AZJB 3CCRN 2ZM6K 4JKEA 4CFDA 4ICLA 4KHQA 2P9KA 3MN9A 3PUFA 3WEEA 2PAVA 3KVGA 3HSTB 2KFNA 3O3HA 3U9DA 1B9DA 4NLCA 2OPPA 3KK2A 1YTAA 4DSFA 1GOAA 3QIPA 3CPWM 1Z26A 5TKYA 2YJFA 1CZ9A 4JD2B 4DUYK 3VA0A 4M3ZA 1CZAN 3EY1A 3LP1A 1B9FA 2HHTA 1SS6A 4CBUA 4DR3K 3NGIA 3VGMA 3C6TA 3CCMN 1ATNA 1NMNA 2E88A 4DR5K 1I94K 3MX2A 3VQAA 3O08A 5JICA 1NK4A 4FVUA 2HSTA 5BPMA 2A5XA 1C0TA 4H5WA 1Q7YO 2ZF5O 4H03B 1RT7A 2BUPA 4U67L 4FJKA 3SLCA 1TVRA 3CFRA 5KPTA 1EX4A 3AA4A 3GBTA 1IV0A 4FWLA 3NGYA 1S1VA 4DU1A 5AQZA 2E6LA 5M1OA 4W5OA 3SUOA 1ZBIA 2WOMA 3ZSXA 4DU4A 2V51B 2AP1A 4O44A 1LWCA 3U4LA 1KAXA 3MAQA 3NF7A 3ZSOA 1SQKA 3KKRA 2IOCA 5HRNA 4CD1A 5CR4A 3CIPA 3ID6A 3LP0A 3H46O 1HNXK 1VRTA 3P1GA 5AZJA 3A5MC 2NRVA 4DTOA 3ZETB 3RRHA 1FXXA 1BHLA 2F4VK 4FLYA 1RT2A 3C6UA 2ZE2A 4IJNA 4OX9K 3FGUA 3VTHA 3OYMA 4E7JA 4GKJK 1VQON 4JD2A 4B1ZA 4OLAA 3V1QA 2ASMA 3HJFA 4DR2K 2GBZA 4JNEA 2O8FB 1V4TA 2QWQA 5BN9A 2HNDA 4BR4A 3WQUA 5CYQA 4CD3A 2EWSA 3MN7A 3TSUA 4G9ZA 3ZSVA 3U8XA 3ZSZA 1NOYA 3A5OC 4KPYA 2Z1GA 5AQGA 4CZKA 2KHOA 5KPRA 1TKZA 3AO4A 3PO4A 1Z6RA 1G99A 3OYIA 2FBXA 4QS8A 1HPZA 3G0ZA 5LMNK 3F9KA 4LH5A 1Z05A 2FXUA 3ULDA 1BIZA 4WQ4C 1YITN 1WSJA 3CETA 2UUAK 3GE1A 5J2QA 1TYQB 4A5BA 1KXPA 1OH8A 4A59A 3LDPA 3ZETA 4CZHA 2FC0A 3JYTA 2VG5A 3P38A 2OZMA 2AA4A 3O9SA 5ADXH 4A2BA 2RF2A 4BC4A 1L3SA 3ISNC 4CK2A 2KKZA 5BRFA 2W6LA 3M8RA 4CJWA 4BG9A 4KHYA 1YXQA 1NGJA 2YNGA 1VQ4N 3TU5A 4BRQA 1JL2A 4CJTA 2WTUA 3NH0A 2O8FA 1OH7A 3QLHA 3LWLA 5HLFA 3VEVA 1HYSA 4CJPA 1M1KO 4K41A 1C1CA 2VGMA 5GAGP 4FWOA 1XMQK 4NYFA 5KGWA 1BL3A 3SUPA 1VSEA 4CJ7A 4E3SA 5GINA 1XMOK 3LM2A 2X6SA 3WT0A 1HUXA 1B92A 4CJFA 3RRGA 3J7ZO 3V9SA 4DTUA 4WYBA 4W5TA 5JVHL 4DKWA 4IOXA 2X6NA 3AA3A 1KLNA 2QWNA 3GG4A 2RPIA 4PWDA 5EU7A 5AQVA 1KVCA 2V7ZA 1U49A 2E5LK 3DLBA 1S6QA 1I3AA 4IFYA 4FZYA 4H8KA 4HTLA 1W97L 3L0QA 1KD1O 3GOIA 4FWNA 1TYQA 3AVBA 4IDHA 4NO7A 1X3MA 3FZHA 5TKWA 2A3ZA 1ZBSA 3H1QA 3BP8A 2QTDA 2VCPA 2Q31A 4TSXA 2QXLA 4CHZA 3PIPL 4EHUA 2IAJA 2WUSA 4ISGA 2XY5A 1P90A 5AQUA 5F1XA 2PY5A 3SQ2A 4YOYA 3M8SA 4DMNA 4KH6A 3C6HA 2G8FA 3VQCA 3TARA 4FJNA 2QI2A 3SJJA 2YNIA 4RG8A 5GAHP 4FLWA 1J53A 2UUCK 3AVGA 1X9WA 4YY3K 4GV9A 1NGDA 1F21A 4BR2A 3SV3A 4YHHK 4FW2A 4Z4CA 4FJXA 4NCAA 3LDSA 3L3VA 4FJ7A 5AQRA 2NRTA 1JLFA 4JI8K 3SQ1A 3OS1A 4KTQA 3SAFA 3HL8A 3OYCA 4FW1A 2FSNA 1ATRA 4B9MA 4Y1CA 4Z4EA 4DV6K 3TAFA 3OYHA 1S1TA 1IBKK 3TI0A
chains in the Genus database with same CATH topology
1TV6A 4CHPA 3HP9A 3KIOA 4E7LA 2EX3A 3TAEA 4KHSA 1QHTA 1JL1A 3G10A 4OPKA 5HRSA 2I5JA 4DWIA 5C42A 2D0AA 2X74A 2IDOA 3VQ7A 4OLBA 2YHBA 2ETJA 4KKOA 4LD0A 4OVLA 3ZSWA 1VSLA 3ALYA 3EZ5A 4FK0A 4KO0A 3HP6A 2P5OA 1ASVA 3H08A 4H4MA 2F8TA 3NF6A 3K5OA 1U45A 1K6YA 3DRRA 4M3YA 2QXFA 1Y97A 4JS5A 4KRFA 3E01A 4KTWA 1ZBLA 1C1BA 3OYNA 2VWKA 2IC3A 1RT4A 4KB1A 4KV8A 1SKWA 3ZT4A 1WSHA 1NJXA 3K58A 4I2PA 4KHWA 1SV5A 3AVJA 3DI6A 3VQEA 2WONA 1T03A 4KHNA 4J2EA 4PY5A 4Z0UA 3RMAA 4PQUA 4IG3A 1TGOA 3PX4A 3I0SA 3VQ4A 4N5SA 4E1NA 1RILA 4OPJA 3MEEA 4F2SA 1KFDA 3V6DA 2ZQBA 3S9HA 2G8KA 1C1AA 3LALA 5HRPA 3L2UA 3TWHA 1QS4A 1RBRA 4DTXA 1NJWA 2HVIA 3KKSA 4BE1A 4DSEA 1J5OA 4CF0A 3NGZA 3DLRA 4BDZA 3TAPA 1DTTA 4RW4A 2Z1IA 3AVMA 3RMBA 2VG6A 3V9UA 3MEDA 1YVUA 1BQNA 3SPYA 1UA0A 3KD5E 4FJHA 4KTZA 2G8UA 2G8IA 1LWEA 3IRXA 2Y1JA 1D8YA 4GVMA 1DTQA 2XY8A 3ASMA 4YFUA 3SI6A 1JLAA 4RW9A 4CIGA 4HTUA 3NAEA 3PV8A 3D0PA 1D9DA 2HMIA 3AO5A 3K57A 1J54A 1SUQA 1IKYA 4HHTA 4CK1A 5CY4A 4K8ZA 3HVRA 3VA3A 4ID1A 1T8EA 3LZJA 1JLQA 4E7IA 4F3OA 1TKTA 2Z1JA 5DMRA 3K2PA 3OYKA 5I3UA 1XHZA 4FZXC 3PO5A 3AO2A 3SQ0A 2XRIA 4RW7A 5CYMA 1S9EA 2B4JA 2JGUA 4AHUA 4CEZA 5KGXA 4O0JA 3LWMA 3CQ8A 4JRQA 5HP1A 3SCXA 3SNNA 4FJ5A 3O4NA 4HUGA 1VSMA 1UWBA 1NK6A 1X9MA 3B6PA 3I0RA 1RT1A 4B08A 4YNQA 4QAGA 1NJZA 2ITGA 4CJRA 4E7HA 2OPRA 2GUIA 1KCFA 3QNNA 1U04A 1XC9A 4HUFA 1VSHA 5D3GA 4FXDA 4CGHA 4FLUA 3LANA 5SZTA 4FCYA 4CJVA 1NJYA 3RTVA 2KFZA 4G1QA 5FRNA 1IKXA 1L3VA 1JLEA 1SL1A 4IKFA 1NK9A 3HYFA 4B9VA 3O4QA 1JXEA 1TAUA 1RBSA 3V9ZA 1NKEA 4NCGA 4DU3A 4F3TA 4EZ6A 4EP4A 5CZ1A 2QKKA 3HM9A 3VQ9A 1LWFA 3L2RA 1S6PA 4N56A 3F73A 1MU2A 1WAJA 3HPGA 3V81A 2HHWA 2XHBA 3DRPA 1QSSA 4LH4A 3LP2A 4JLHA 3VQDA 1R0AA 4CF9A 1KSPA 4CEBA 4C8KA 1REVA 4CECA 4E0DA 1VSDA 2HNZA 3OS2A 1BCMA 4EZ9A 3L3UA 3AVHA 4Q5VA 1WN7A 2VWJA 3IAYA 3NCIA 2B5JA 3OYAA 1WNSA 3BGRA 1N5YA 1FK9A 3VQ5A 1IKVA 1C0UA 4Y1DA 4DQPA 4DTRA 2OZSA 4AHVA 5J2PA 3DOKA 1WAFA 3OJUA 4CJ4A 5KRSA 3BDPA 4FJ8A 4PWDA 1RDAA 1RT3A 3S3OA 4IG0A 4DS5A 4DF4A 1WLJA 4DG1A 3A2FA 4FZZA 3MXIA 2FBYA 3M8PA 3S3MA 2HVHA 5SWMA 3VQQA 4CE9A 3VQPA 1QE1A 4OGCA 3NDKA 3QEVA 1Q8IA 4RW6A 1NK7A 4B9SA 3ZT2A 4DQQA 3DMJA 2F8SA 4B3OA 5C25A 1NOZA 3K5MA 4XIUA 4Z4IA 4DFMA 5J1EA 4I7FA 5DK5A 2PYJA 2EHGA 1S1UA 1RBUA 4MQ3A 4W5RA 3OS0A 3TAQA 1SKSA 4N41A 4DLGA 2F96A 3DM2A 3WNEA 1U47A 4FJ9A 3B6OA 3MEGA 3KLGA 3C94A 1RDCA 4BDYA 1TK5A 1BIUA 3NBPA 1IG9A 3OYEA 1RCHA 4CF8A 4CFDA 2HHUA 4J2AA 3DLHA 3OVNA 4ICLA 4HUEA 3LP3A 4GW6A 4KHQA 2DY4A 3OYBA 3PUFA 3ZSYA 4W5QA 4FLXA 3QNOA 1VRUA 3HSTB 2KFNA 3AVFA 4OGEA 3HO1A 3O3HA 1RT5A 3AVIA 3SYZA 4B9LA 5CZ2A 1B9DA 4DSIA 3K5LA 2ATQA 4FK2A 1RBVA 2OPPA 3KK2A 4F8RA 1YTAA 4DSFA 4DTMA 4CEQA 4FVMA 5K14A 1GOAA 3QIPA 4Z4FA 1VSKA 1Z26A 4E1MA 5HRRA 1HQEA 2KTQA 1CZ9A 4CJ5A 3KD1E 3CM6A 2D0CA 3VA0A 4M3ZA 3HXMA 4UQGA 2FBVA 4LSNA 4O5BA 3EY1A 3LP1A 1B9FA 2IGIA 4FYDA 4PA1A 2HHTA 1RDDA 3DOLA 4DF8A 1BCOA 2BANA 3CM5A 1IKWA 2HW3A 1TL1A 3L2QA 3NGIA 3U6FA 1KFSA 3C6TA 4DSJA 3VQAA 4CFAA 3NH1A 4KHUA 1W9HA 3U3GA 1NK4A 2G8WA 1QSLA 1C0TA 4CGIA 4Z4HA 3RMDA 3DLEA 4B8AB 4C8LA 3MXJA 1XWLA 4CF2A 4WE1A 3C95A 4IBNA 1RT7A 4AHTA 4CHOA 4BACA 4FJKA 3P83D 1WSEA 1TVRA 4FJLA 3CFRA 5E41A 4K8XA 3MECA 3QEIA 1ZYQA 2HHVA 3QO9A 1EX4A 3AA4A 1RTIA 3QEPA 3CYMA 1SKRA 3NGYA 1S1VA 4DU1A 4CJEA 4DSLA 2E6LA 1ZBIA 4W5OA 3SUOA 3HPOA 3VQ6A 2WOMA 3ZSXA 4DU4A 5J2NA 3I8DA 3KLIA 4OJRA 4O44A 1LWCA 3AVKA 1RBTA 3HT3A 3MAQA 3NF7A 4DTJA 3ZSOA 3T3FA 3KKRA 1FKOA 2IOCA 4CEFA 5HRNA 1UA1A 4FJIA 2O4GA 1G15A 2R7YA 3LP0A 4FLZA 4J2DA 1VRTA 1KLMA 3P1GA 4LY7A 1WSIA 1TAQA 4M3UA 3AVNA 2HNYA 3P5JA 2JLEA 1BI4B 4DTOA 4B9TA 4CF1A 1XHXA 3DRSA 3RRHA 3QERA 1EXQA 4CK3A 1FXXA 4FM2A 2PZSA 4M3WA 1UOCA 4ZTFA 1C0MA 1WSFA 1BHLA 1A5WA 4FLYA 3TR8A 1RT2A 2A1SA 3C6UA 5HBMA 1TK8A 3AVAA 4W5NA 3RWUA 2ZE2A 4ZTJA 1YTUA 1HNIA 4CCHA 3OYMA 4O55A 1SL2A 3AV9A 4E7JA 1HMVA 3D45A 1CXUA 1L5UA 3SUQA 4OLAA 1NK5A 3V1QA 4O4GA 3KLEA 3HJFA 2D0BA 2GBZA 2YHAA 1BISA 3OY9A 1HJRA 5HROA 2E6MA 1JLGA 4M42A 5JS2A 4CERA 1DLOA 2HNDA 1Q9YA 5CYQA 4M3TA 3SZ2A 3U3YA 1NK8A 4I9QA 3NF9A 3PX6A 4HCCA 1ZBFA 1JLCA 3NE6A 1CLQA 3AO1A 3NF8A 3LZIA 3HK2A 3ZSVA 3ZT3A 4DQIA 2KQ2A 3FFIA 4KREA 1JLBA 1LAVA 1ZBUA 3ITHA 3NFAA 4C8MA 3ZSZA 1NOYA 4KAZA 2P1JA 5FRMA 3HVTA 4CJKA 1HYVA 3PY8A 4BE2A 1KVAA 1LAWA 2Z1GA 4FJGA 4HCBA 4KPYA 2BDPA 2IS3A 3VN5A 4GMJB 2E4LA 3IS9A 4OKEA 1ASUA 4AHSA 1TKZA 3ZCMA 4N47A 3AO4A 3DYAA 3PO4A 4DS4A 1EP4A 3KLFA 3VQBA 1TKDA 3OYIA 3WNGA 1RDBA 2FBXA 3SUNA 2BE2A 1J9AA 5FDLA 3QEWA 2OA8A 4DSKA 1ZBHA 1HPZA 4KFBA 3G0ZA 4HVJA 3F9KA 4CJQA 3EYZA 2XY7A 2OPQA 4LH5A 3QESA 3SQ4A 4N76A 2A1RA 3NH2A 4IDKA 3ULDA 1QSYA 3VQ8A 2DTUA 1BIZA 4BWMA 1WSJA 1JXBA 3QINA 4CHQA 4M3RA 3LAKA 3L2WA 5KTQA 2ZD1A 1YT3A 1C6VA 4CEEA 5J2QA 4Z4GA 4M45A 2HB5A 2AJQA 3O3GA 1BI4A 5C24A 1GOBA 4C8OA 1A5XA 4NCBA 2FC0A 2P51A 1EKEA 3JYTA 3WNFA 2VG5A 2OZMA 2YNHA 2W42A 4DQSA 1NKBA 2RF2A 1L3SA 3T19A 3ISNC 3ZSRA 2OPSA 4CK2A 4CFBA 3SPZA 1NKCA 4CESA 3QEXA 3M8RA 4CJWA 3LPTA 2XO7A 3QETA 4CJLA 2HHSA 1X9SA 1T7PA 4CJUA 4KB0A 3S3NA 4EP5A 4H4OA 1S5JA 4NYNA 1U48A 4KHYA 2GV9A 3HPHA 3CFPA 2YNGA 1ASWA 4OKKA 1TK0A 1JL2A 4CJTA 4E89A 4BE0A 4E7KA 4O0IA 3NH0A 1IO2A 2O4IA 3QLHA 3LWLA 5HLFA 1HYZA 1HYSA 4CJPA 1C1CA 4CEAA 4DFKA 3K5NA 4NYFA 4ELVA 2KZMA 3DLGA 1ITGA 2FBTA 5KGWA 3TABA 4B9NA 3ZT0A 4FJMA 1BL3A 4JRPA 3SUPA 1VSEA 2G8HA 2LSNA 4E3SA 1JKHA 3L2VA 1HRHA 3M8QA 4CGGA 4CGDA 4CHNA 3KTQA 1QQCA 1VK0A 3CFOA 3ZT1A 3NHGA 2OYQA 3RR7A 1L3UA 2X6SA 4CGJA 3V4IA 1I39A 3TAGA 4FJJA 1TKXA 1B92A 4CJFA 4QOZB 2XY6A 1BGXT 4C8NA 2DFHA 4AH9A 4DFJA 3RRGA 4FLTA 3V9SA 4DTUA 3PX0A 4KI6A 3QIOA 1VSJA 4W5TA 3OYLA 3RR8A 2X6NA 3AA3A 4E19A 1KLNA 1WSGA 2RPIA 1VSFA 3AA2A 5EU7A 2RN2A 3AA5X 4I9LA 1UAXA 3SV4A 1LV5A 1KVCA 3OYDA 4BDPA 2BGGA 4FM0A 4CGFA 1HQUA 1U49A 4Q0BA 1FKPA 4M41A 5FROA 3OYJA 1S6QA 1I3AA 4IFYA 3DLBA 1L3TA 4ELUA 4FZYA 4QCLA 4H8KA 4F4KA 3CG7A 2KW4A 3AVLA 2YKNA 4CIEA 1RT6A 1N6QA 1KVBA 4PUOA 3AVBA 5I42A 2PYLA 3KLHA 2D5RA 3KK1A 4JS4A 2RKIA 1HNVA 4MFBA 3RMCA 1T05A 4J2BA 3L8BA 4RW8A 4AHCA 4AHRA 4TSXA 4CHZA 1RTDA 1CXQA 4CFCA 4DTPA 2IAJA 3AVCA 4CEOA 3JSMA 2Y1IA 4R5PA 1S9GA 2XY5A 2B6AA 2P5GA 3TANA 2PY5A 3SQ2A 3WNHA 3THVA 1W0HA 2VG7A 3V1RA 3OYFA 3M8SA 4KI4A 4DMNA 3KJVA 2DFFA 3V9XA 2G8VA 3V1OA 1Z25A 2G8FA 2Q3SA 4CEDA 4DFPA 3VQCA 3TARA 4I2QA 3TAMA 3UIQA 2QKBA 4FM1A 4FJNA 5J2MA 4ID5A 1S1WA 3SJJA 4DTNA 2YNIA 4RG8A 4LSLA 5T7BA 4FLWA 1J53A 4L8RB 1CZBA 2DFEA 3AVGA 1A5VA 2HHXA 4FK4A 1VSIA 3AO3A 4DTSA 2QK9A 1X9WA 1KTQA 1Q9XA 2YKMA 1LW0A 1F21A 1IH7A 5JS1A 4DLEA 1SL0A 4CHYA 4ELTA 1S1XA 3SV3A 1QTMA 1RNHA 3O3FA 4CIFA 3IG1A 4FW2A 4B8CA 4Z4CA 5KI6A 4AILC 1XI1A 4CJ3A 3KK3A 1RTJA 4FJXA 3OJSA 1LW2A 1D5AA 2YNFA 1O1WA 3MXMA 4IFVA 4NCAA 3LDSA 2KZZA 2NUBA 3ZSQA 3L3VA 3OYGA 4FJ7A 1BQMA 1GOCA 4M3XA 1JLFA 3LPUA 3K59A 3SQ1A 3DLKA 4OKJA 4BWJA 3OS1A 2X78A 2YV0X 4FLVA 4KTQA 3HL8A 1NK0A 3OYCA 4FW1A 3T1AA 4CJSA 4ZHRA 4B9UA 2HHQA 1KRPA 4Y1CA 4DQRA 3LAMA 1EETA 1X1PA 1U4BA 4B9MA 4Z4EA 2Z1HA 1TL3A 3V9WA 3TAFA 1D9FA 4F2RA 3OYHA 1S1TA 5KRTA 1RTHA 3TI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TV6 A;  4CHP A;  3HP9 A;  3KIO A;  4E7L A;  2EX3 A;  3TAE A;  4KHS A;  1QHT A;  1JL1 A;  3G10 A;  4OPK A;  5HRS A;  2I5J A;  4DWI A;  5C42 A;  2D0A A;  2X74 A;  2IDO A;  3VQ7 A;  4OLB A;  2YHB A;  2ETJ A;  4KKO A;  4LD0 A;  4OVL A;  3ZSW A;  1VSL A;  3ALY A;  3EZ5 A;  4FK0 A;  4KO0 A;  3HP6 A;  2P5O A;  1ASV A;  3H08 A;  4H4M A;  2F8T A;  3NF6 A;  3K5O A;  1U45 A;  1K6Y A;  3DRR A;  4M3Y A;  2QXF A;  1Y97 A;  4JS5 A;  4KRF A;  3E01 A;  4KTW A;  1ZBL A;  1C1B A;  3OYN A;  2VWK A;  2IC3 A;  1RT4 A;  4KB1 A;  4KV8 A;  1SKW A;  3ZT4 A;  1WSH A;  1NJX A;  3K58 A;  4I2P A;  4KHW A;  1SV5 A;  3AVJ A;  3DI6 A;  3VQE A;  2WON A;  1T03 A;  4KHN A;  4J2E A;  4PY5 A;  4Z0U A;  3RMA A;  4PQU A;  4IG3 A;  1TGO A;  3PX4 A;  3I0S A;  3VQ4 A;  4N5S A;  4E1N A;  1RIL A;  4OPJ A;  3MEE A;  4F2S A;  1KFD A;  3V6D A;  2ZQB A;  3S9H A;  2G8K A;  1C1A A;  3LAL A;  5HRP A;  3L2U A;  3TWH A;  1QS4 A;  1RBR A;  4DTX A;  1NJW A;  2HVI A;  3KKS A;  4BE1 A;  4DSE A;  1J5O A;  4CF0 A;  3NGZ A;  3DLR A;  4BDZ A;  3TAP A;  1DTT A;  4RW4 A;  2Z1I A;  3AVM A;  3RMB A;  2VG6 A;  3V9U A;  3MED A;  1YVU A;  1BQN A;  3SPY A;  1UA0 A;  3KD5 E;  4FJH A;  4KTZ A;  2G8U A;  2G8I A;  1LWE A;  3IRX A;  2Y1J A;  1D8Y A;  4GVM A;  1DTQ A;  2XY8 A;  3ASM A;  4YFU A;  3SI6 A;  1JLA A;  4RW9 A;  4CIG A;  4HTU A;  3NAE A;  3PV8 A;  3D0P A;  1D9D A;  2HMI A;  3AO5 A;  3K57 A;  1J54 A;  1SUQ A;  1IKY A;  4HHT A;  4CK1 A;  5CY4 A;  4K8Z A;  3HVR A;  3VA3 A;  4ID1 A;  1T8E A;  3LZJ A;  1JLQ A;  4E7I A;  4F3O A;  1TKT A;  2Z1J A;  5DMR A;  3K2P A;  3OYK A;  5I3U A;  1XHZ A;  4FZX C;  3PO5 A;  3AO2 A;  3SQ0 A;  2XRI A;  4RW7 A;  5CYM A;  1S9E A;  2B4J A;  2JGU A;  4AHU A;  4CEZ A;  5KGX A;  4O0J A;  3LWM A;  3CQ8 A;  4JRQ A;  5HP1 A;  3SCX A;  3SNN A;  4FJ5 A;  3O4N A;  4HUG A;  1VSM A;  1UWB A;  1NK6 A;  1X9M A;  3B6P A;  3I0R A;  1RT1 A;  4B08 A;  4YNQ A;  4QAG A;  1NJZ A;  2ITG A;  4CJR A;  4E7H A;  2OPR A;  2GUI A;  1KCF A;  3QNN A;  1U04 A;  1XC9 A;  4HUF A;  1VSH A;  5D3G A;  4FXD A;  4CGH A;  4FLU A;  3LAN A;  5SZT A;  4FCY A;  4CJV A;  1NJY A;  3RTV A;  2KFZ A;  4G1Q A;  5FRN A;  1IKX A;  1L3V A;  1JLE A;  1SL1 A;  4IKF A;  1NK9 A;  3HYF A;  4B9V A;  3O4Q A;  1JXE A;  1TAU A;  1RBS A;  3V9Z A;  1NKE A;  4NCG A;  4DU3 A;  4F3T A;  4EZ6 A;  4EP4 A;  5CZ1 A;  2QKK A;  3HM9 A;  3VQ9 A;  1LWF A;  3L2R A;  1S6P A;  4N56 A;  3F73 A;  1MU2 A;  1WAJ A;  3HPG A;  3V81 A;  2HHW A;  2XHB A;  3DRP A;  1QSS A;  4LH4 A;  3LP2 A;  4JLH A;  3VQD A;  1R0A A;  4CF9 A;  1KSP A;  4CEB A;  4C8K A;  1REV A;  4CEC A;  4E0D A;  1VSD A;  2HNZ A;  3OS2 A;  1BCM A;  4EZ9 A;  3L3U A;  3AVH A;  4Q5V A;  1WN7 A;  2VWJ A;  3IAY A;  3NCI A;  2B5J A;  3OYA A;  1WNS A;  3BGR A;  1N5Y A;  1FK9 A;  3VQ5 A;  1IKV A;  1C0U A;  4Y1D A;  4DQP A;  4DTR A;  2OZS A;  4AHV A;  5J2P A;  3DOK A;  1WAF A;  3OJU A;  4CJ4 A;  5KRS A;  3BDP A;  4FJ8 A;  4PWD A;  1RDA A;  1RT3 A;  3S3O A;  4IG0 A;  4DS5 A;  4DF4 A;  1WLJ A;  4DG1 A;  3A2F A;  4FZZ A;  3MXI A;  2FBY A;  3M8P A;  3S3M A;  2HVH A;  5SWM A;  3VQQ A;  4CE9 A;  3VQP A;  1QE1 A;  4OGC A;  3NDK A;  3QEV A;  1Q8I A;  4RW6 A;  1NK7 A;  4B9S A;  3ZT2 A;  4DQQ A;  3DMJ A;  2F8S A;  4B3O A;  5C25 A;  1NOZ A;  3K5M A;  4XIU A;  4Z4I A;  4DFM A;  5J1E A;  4I7F A;  5DK5 A;  2PYJ A;  2EHG A;  1S1U A;  1RBU A;  4MQ3 A;  4W5R A;  3OS0 A;  3TAQ A;  1SKS A;  4N41 A;  4DLG A;  2F96 A;  3DM2 A;  3WNE A;  1U47 A;  4FJ9 A;  3B6O A;  3MEG A;  3KLG A;  3C94 A;  1RDC A;  4BDY A;  1TK5 A;  1BIU A;  3NBP A;  1IG9 A;  3OYE A;  1RCH A;  4CF8 A;  4CFD A;  2HHU A;  4J2A A;  3DLH A;  3OVN A;  4ICL A;  4HUE A;  3LP3 A;  4GW6 A;  4KHQ A;  2DY4 A;  3OYB A;  3PUF A;  3ZSY A;  4W5Q A;  4FLX A;  3QNO A;  1VRU A;  3HST B;  2KFN A;  3AVF A;  4OGE A;  3HO1 A;  3O3H A;  1RT5 A;  3AVI A;  3SYZ A;  4B9L A;  5CZ2 A;  1B9D A;  4DSI A;  3K5L A;  2ATQ A;  4FK2 A;  1RBV A;  2OPP A;  3KK2 A;  4F8R A;  1YTA A;  4DSF A;  4DTM A;  4CEQ A;  4FVM A;  5K14 A;  1GOA A;  3QIP A;  4Z4F A;  1VSK A;  1Z26 A;  4E1M A;  5HRR A;  1HQE A;  2KTQ A;  1CZ9 A;  4CJ5 A;  3KD1 E;  3CM6 A;  2D0C A;  3VA0 A;  4M3Z A;  3HXM A;  4UQG A;  2FBV A;  4LSN A;  4O5B A;  3EY1 A;  3LP1 A;  1B9F A;  2IGI A;  4FYD A;  4PA1 A;  2HHT A;  1RDD A;  3DOL A;  4DF8 A;  1BCO A;  2BAN A;  3CM5 A;  1IKW A;  2HW3 A;  1TL1 A;  3L2Q A;  3NGI A;  3U6F A;  1KFS A;  3C6T A;  4DSJ A;  3VQA A;  4CFA A;  3NH1 A;  4KHU A;  1W9H A;  3U3G A;  1NK4 A;  2G8W A;  1QSL A;  1C0T A;  4CGI A;  4Z4H A;  3RMD A;  3DLE A;  4B8A B;  4C8L A;  3MXJ A;  1XWL A;  4CF2 A;  4WE1 A;  3C95 A;  4IBN A;  1RT7 A;  4AHT A;  4CHO A;  4BAC A;  4FJK A;  3P83 D;  1WSE A;  1TVR A;  4FJL A;  3CFR A;  5E41 A;  4K8X A;  3MEC A;  3QEI A;  1ZYQ A;  2HHV A;  3QO9 A;  1EX4 A;  3AA4 A;  1RTI A;  3QEP A;  3CYM A;  1SKR A;  3NGY A;  1S1V A;  4DU1 A;  4CJE A;  4DSL A;  2E6L A;  1ZBI A;  4W5O A;  3SUO A;  3HPO A;  3VQ6 A;  2WOM A;  3ZSX A;  4DU4 A;  5J2N A;  3I8D A;  3KLI A;  4OJR A;  4O44 A;  1LWC A;  3AVK A;  1RBT A;  3HT3 A;  3MAQ A;  3NF7 A;  4DTJ A;  3ZSO A;  3T3F A;  3KKR A;  1FKO A;  2IOC A;  4CEF A;  5HRN A;  1UA1 A;  4FJI A;  2O4G A;  1G15 A;  2R7Y A;  3LP0 A;  4FLZ A;  4J2D A;  1VRT A;  1KLM A;  3P1G A;  4LY7 A;  1WSI A;  1TAQ A;  4M3U A;  3AVN A;  2HNY A;  3P5J A;  2JLE A;  1BI4 B;  4DTO A;  4B9T A;  4CF1 A;  1XHX A;  3DRS A;  3RRH A;  3QER A;  1EXQ A;  4CK3 A;  1FXX A;  4FM2 A;  2PZS A;  4M3W A;  1UOC A;  4ZTF A;  1C0M A;  1WSF A;  1BHL A;  1A5W A;  4FLY A;  3TR8 A;  1RT2 A;  2A1S A;  3C6U A;  5HBM A;  1TK8 A;  3AVA A;  4W5N A;  3RWU A;  2ZE2 A;  4ZTJ A;  1YTU A;  1HNI A;  4CCH A;  3OYM A;  4O55 A;  1SL2 A;  3AV9 A;  4E7J A;  1HMV A;  3D45 A;  1CXU A;  1L5U A;  3SUQ A;  4OLA A;  1NK5 A;  3V1Q A;  4O4G A;  3KLE A;  3HJF A;  2D0B A;  2GBZ A;  2YHA A;  1BIS A;  3OY9 A;  1HJR A;  5HRO A;  2E6M A;  1JLG A;  4M42 A;  5JS2 A;  4CER A;  1DLO A;  2HND A;  1Q9Y A;  5CYQ A;  4M3T A;  3SZ2 A;  3U3Y A;  1NK8 A;  4I9Q A;  3NF9 A;  3PX6 A;  4HCC A;  1ZBF A;  1JLC A;  3NE6 A;  1CLQ A;  3AO1 A;  3NF8 A;  3LZI A;  3HK2 A;  3ZSV A;  3ZT3 A;  4DQI A;  2KQ2 A;  3FFI A;  4KRE A;  1JLB A;  1LAV A;  1ZBU A;  3ITH A;  3NFA A;  4C8M A;  3ZSZ A;  1NOY A;  4KAZ A;  2P1J A;  5FRM A;  3HVT A;  4CJK A;  1HYV A;  3PY8 A;  4BE2 A;  1KVA A;  1LAW A;  2Z1G A;  4FJG A;  4HCB A;  4KPY A;  2BDP A;  2IS3 A;  3VN5 A;  4GMJ B;  2E4L A;  3IS9 A;  4OKE A;  1ASU A;  4AHS A;  1TKZ A;  3ZCM A;  4N47 A;  3AO4 A;  3DYA A;  3PO4 A;  4DS4 A;  1EP4 A;  3KLF A;  3VQB A;  1TKD A;  3OYI A;  3WNG A;  1RDB A;  2FBX A;  3SUN A;  2BE2 A;  1J9A A;  5FDL A;  3QEW A;  2OA8 A;  4DSK A;  1ZBH A;  1HPZ A;  4KFB A;  3G0Z A;  4HVJ A;  3F9K A;  4CJQ A;  3EYZ A;  2XY7 A;  2OPQ A;  4LH5 A;  3QES A;  3SQ4 A;  4N76 A;  2A1R A;  3NH2 A;  4IDK A;  3ULD A;  1QSY A;  3VQ8 A;  2DTU A;  1BIZ A;  4BWM A;  1WSJ A;  1JXB A;  3QIN A;  4CHQ A;  4M3R A;  3LAK A;  3L2W A;  5KTQ A;  2ZD1 A;  1YT3 A;  1C6V A;  4CEE A;  5J2Q A;  4Z4G A;  4M45 A;  2HB5 A;  2AJQ A;  3O3G A;  1BI4 A;  5C24 A;  1GOB A;  4C8O A;  1A5X A;  4NCB A;  2FC0 A;  2P51 A;  1EKE A;  3JYT A;  3WNF A;  2VG5 A;  2OZM A;  2YNH A;  2W42 A;  4DQS A;  1NKB A;  2RF2 A;  1L3S A;  3T19 A;  3ISN C;  3ZSR A;  2OPS A;  4CK2 A;  4CFB A;  3SPZ A;  1NKC A;  4CES A;  3QEX A;  3M8R A;  4CJW A;  3LPT A;  2XO7 A;  3QET A;  4CJL A;  2HHS A;  1X9S A;  1T7P A;  4CJU A;  4KB0 A;  3S3N A;  4EP5 A;  4H4O A;  1S5J A;  4NYN A;  1U48 A;  4KHY A;  2GV9 A;  3HPH A;  3CFP A;  2YNG A;  1ASW A;  4OKK A;  1TK0 A;  1JL2 A;  4CJT A;  4E89 A;  4BE0 A;  4E7K A;  4O0I A;  3NH0 A;  1IO2 A;  2O4I A;  3QLH A;  3LWL A;  5HLF A;  1HYZ A;  1HYS A;  4CJP A;  1C1C A;  4CEA A;  4DFK A;  3K5N A;  4NYF A;  4ELV A;  2KZM A;  3DLG A;  1ITG A;  2FBT A;  5KGW A;  3TAB A;  4B9N A;  3ZT0 A;  4FJM A;  1BL3 A;  4JRP A;  3SUP A;  1VSE A;  2G8H A;  2LSN A;  4E3S A;  1JKH A;  3L2V A;  1HRH A;  3M8Q A;  4CGG A;  4CGD A;  4CHN A;  3KTQ A;  1QQC A;  1VK0 A;  3CFO A;  3ZT1 A;  3NHG A;  2OYQ A;  3RR7 A;  1L3U A;  2X6S A;  4CGJ A;  3V4I A;  1I39 A;  3TAG A;  4FJJ A;  1TKX A;  1B92 A;  4CJF A;  4QOZ B;  2XY6 A;  1BGX T;  4C8N A;  2DFH A;  4AH9 A;  4DFJ A;  3RRG A;  4FLT A;  3V9S A;  4DTU A;  3PX0 A;  4KI6 A;  3QIO A;  1VSJ A;  4W5T A;  3OYL A;  3RR8 A;  2X6N A;  3AA3 A;  4E19 A;  1KLN A;  1WSG A;  2RPI A;  1VSF A;  3AA2 A;  5EU7 A;  2RN2 A;  3AA5 X;  4I9L A;  1UAX A;  3SV4 A;  1LV5 A;  1KVC A;  3OYD A;  4BDP A;  2BGG A;  4FM0 A;  4CGF A;  1HQU A;  1U49 A;  4Q0B A;  1FKP A;  4M41 A;  5FRO A;  3OYJ A;  1S6Q A;  1I3A A;  4IFY A;  3DLB A;  1L3T A;  4ELU A;  4FZY A;  4QCL A;  4H8K A;  4F4K A;  3CG7 A;  2KW4 A;  3AVL A;  2YKN A;  4CIE A;  1RT6 A;  1N6Q A;  1KVB A;  4PUO A;  3AVB A;  5I42 A;  2PYL A;  3KLH A;  2D5R A;  3KK1 A;  4JS4 A;  2RKI A;  1HNV A;  4MFB A;  3RMC A;  1T05 A;  4J2B A;  3L8B A;  4RW8 A;  4AHC A;  4AHR A;  4TSX A;  4CHZ A;  1RTD A;  1CXQ A;  4CFC A;  4DTP A;  2IAJ A;  3AVC A;  4CEO A;  3JSM A;  2Y1I A;  4R5P A;  1S9G A;  2XY5 A;  2B6A A;  2P5G A;  3TAN A;  2PY5 A;  3SQ2 A;  3WNH A;  3THV A;  1W0H A;  2VG7 A;  3V1R A;  3OYF A;  3M8S A;  4KI4 A;  4DMN A;  3KJV A;  2DFF A;  3V9X A;  2G8V A;  3V1O A;  1Z25 A;  2G8F A;  2Q3S A;  4CED A;  4DFP A;  3VQC A;  3TAR A;  4I2Q A;  3TAM A;  3UIQ A;  2QKB A;  4FM1 A;  4FJN A;  5J2M A;  4ID5 A;  1S1W A;  3SJJ A;  4DTN A;  2YNI A;  4RG8 A;  4LSL A;  5T7B A;  4FLW A;  1J53 A;  4L8R B;  1CZB A;  2DFE A;  3AVG A;  1A5V A;  2HHX A;  4FK4 A;  1VSI A;  3AO3 A;  4DTS A;  2QK9 A;  1X9W A;  1KTQ A;  1Q9X A;  2YKM A;  1LW0 A;  1F21 A;  1IH7 A;  5JS1 A;  4DLE A;  1SL0 A;  4CHY A;  4ELT A;  1S1X A;  3SV3 A;  1QTM A;  1RNH A;  3O3F A;  4CIF A;  3IG1 A;  4FW2 A;  4B8C A;  4Z4C A;  5KI6 A;  4AIL C;  1XI1 A;  4CJ3 A;  3KK3 A;  1RTJ A;  4FJX A;  3OJS A;  1LW2 A;  1D5A A;  2YNF A;  1O1W A;  3MXM A;  4IFV A;  4NCA A;  3LDS A;  2KZZ A;  2NUB A;  3ZSQ A;  3L3V A;  3OYG A;  4FJ7 A;  1BQM A;  1GOC A;  4M3X A;  1JLF A;  3LPU A;  3K59 A;  3SQ1 A;  3DLK A;  4OKJ A;  4BWJ A;  3OS1 A;  2X78 A;  2YV0 X;  4FLV A;  4KTQ A;  3HL8 A;  1NK0 A;  3OYC A;  4FW1 A;  3T1A A;  4CJS A;  4ZHR A;  4B9U A;  2HHQ A;  1KRP A;  4Y1C A;  4DQR A;  3LAM A;  1EET A;  1X1P A;  1U4B A;  4B9M A;  4Z4E A;  2Z1H A;  1TL3 A;  3V9W A;  3TAF A;  1D9F A;  4F2R A;  3OYH A;  1S1T A;  5KRT A;  1RTH A;  3TI0 A; 
#chains in the Genus database with same CATH topology
 3KIO A;  4E7L A;  4IJA A;  4DWI A;  1NGH A;  3VQ7 A;  4KKO A;  4OVL A;  3HP6 A;  2P5O A;  4B9Q A;  4H4M A;  4BGB A;  3VEO A;  3K5O A;  1U45 A;  3DRR A;  4M3Y A;  3RSE B;  3CC4 N;  4DR1 K;  2VWK A;  4MO4 A;  4BC5 A;  3K58 A;  5C2D A;  4KHW A;  3DI6 A;  1T03 A;  4J8F A;  3QBX A;  3A0I X;  1BWF O;  4IG3 A;  5B8H A;  2I7P A;  4N5S A;  3W3D A;  2Q2R A;  3JS6 A;  2W40 A;  2A42 A;  2JWK A;  3KKS A;  3MWT A;  4DSE A;  1J5O A;  1VQ6 N;  3PLA A;  3TAP A;  4JKF A;  1YVU A;  1BQN A;  4FJH A;  2E20 A;  3HRG A;  4JV5 K;  1D8Y A;  1DTQ A;  4XEI A;  3ASM A;  2YHY A;  3O9R A;  1JLA A;  4RW9 A;  4HTU A;  3D0P A;  2HMI A;  4HHT A;  1J54 A;  1IKY A;  2UXC K;  3LZJ A;  1JLQ A;  4E7I A;  3OYK A;  3C65 A;  4K0K K;  4HWI A;  3SQ0 A;  5CYM A;  4LF8 K;  2JWL A;  1S9E A;  4AHU A;  5ADX A;  1GLJ O;  1N8R O;  1NJZ A;  5F0X A;  1IBL K;  4E7H A;  3IDH A;  2GUI A;  1P8Z A;  3QNN A;  4DCH A;  4HUF A;  3EE8 A;  1NGI A;  3K9K A;  4GY2 B;  4CJV A;  3SBG A;  4G1Q A;  4DR6 K;  4DR7 K;  1NK9 A;  3RSE A;  1JXE A;  3VET A;  1RBS A;  3A5L C;  3CJ1 A;  1KC8 O;  3G6E N;  1HNW K;  2QKK A;  3QDK A;  4BGA A;  3PY8 A;  1LWF A;  3B8A X;  1J6Z A;  2W41 A;  4ILJ A;  3LP2 A;  2OTL N;  5AQJ A;  4BRA A;  1REV A;  4BRH A;  3KHY A;  1NMD A;  1N33 K;  4Q5V A;  1M90 O;  4JKG B;  1WNS A;  1N5Y A;  1FK9 A;  1GLB G;  3HM8 A;  4Y1D A;  2QWP A;  4YOT A;  2ITM A;  5DM6 L;  5J2P A;  1HKC A;  1QVG M;  1ATS A;  1VQP N;  3E9O A;  3H3O B;  1J5E K;  2CGL A;  1S3X A;  1OVQ A;  4BRI A;  4BRG A;  3VQP A;  1QE1 A;  2D4W A;  3QEV A;  2F8S A;  5I9E B;  3SAG A;  1NNE A;  5C25 A;  2EHG A;  1RBU A;  4MQ3 A;  4W5R A;  4DLG A;  3WNE A;  3B6O A;  3C94 A;  1RDC A;  1BIU A;  1IBM K;  4GNI A;  3OYE A;  2FF3 B;  5HL7 L;  4BR9 A;  3DLH A;  4LF4 K;  2PBD A;  4JI1 K;  4C23 A;  2DPN A;  4GW6 A;  3G25 A;  3ZSY A;  4W5Q A;  2P9L B;  1VRU A;  3HO1 A;  3AVI A;  4DSI A;  1RDU A;  3R8E A;  4DTM A;  4FVM A;  1VSK A;  4CJ5 A;  4PHT X;  3F9M A;  4UQG A;  4JN4 A;  5EX5 A;  4PA1 A;  3DOL A;  3CM5 A;  3H6E A;  1IKW A;  1TL1 A;  3L2Q A;  4IFE A;  3HSC A;  4DV4 K;  3AAP A;  1VQ9 N;  4KHU A;  1W9H A;  1S22 A;  4JKG A;  4WFN L;  2G8W A;  3D2F B;  3DLE A;  4B8A B;  4C8L A;  3MXJ A;  4BC2 A;  1ZYQ A;  2HHV A;  3J81 O;  2NRR A;  3ATU A;  3QEP A;  5C10 A;  3CYM A;  3UE5 A;  1VAZ A;  2P9I B;  3VQ6 A;  2HOE A;  5J2N A;  3KLI A;  1RBT A;  1ZBL A;  4CEF A;  1UA1 A;  4FJI A;  3NMU A;  2R7Y A;  4FLZ A;  2FLO A;  3KK7 A;  4LY7 A;  1WSI A;  4M3U A;  4BRF A;  2JLE A;  5KPZ A;  4CF1 A;  1QZ6 A;  2P9L A;  4FOI A;  3SAH A;  4M3W A;  1UOC A;  4B3T K;  4ZTF A;  4A5A A;  3P31 A;  3TR8 A;  5HBM A;  3RWU A;  4H5T A;  4ZTJ A;  4CCH A;  1OH5 A;  2IIR A;  4IWV A;  3AV9 A;  4OPA A;  1HMV A;  1CXU A;  3M6G A;  1L5U A;  4KH4 A;  1E4G T;  4RWT A;  1GLD G;  1BIS A;  1BG3 A;  2E6M A;  2O8E B;  3EO3 A;  5JS2 A;  4CER A;  4CVN E;  4RCH A;  4M3T A;  3C6A A;  3U3Y A;  4I9Q A;  3NF9 A;  2NRZ A;  3CC7 N;  3TPQ A;  3NE6 A;  3HK2 A;  5CHI A;  4KRE A;  3D2F A;  1ZBU A;  3ITH A;  3NFA A;  4KAZ A;  4FWR A;  5JLF A;  3HVT A;  1HYV A;  3A8Y A;  5FPD A;  4HCB A;  4JYA K;  3VN5 A;  2A40 A;  3QBW A;  4IEI A;  2E4L A;  3IS9 A;  1ASU A;  3ZCM A;  1NGF A;  4X64 K;  3DYA A;  3KLF A;  1TKD A;  1YUW A;  3FR0 A;  3WNG A;  4YOR A;  4MDB A;  2P9I A;  4KFB A;  4HVJ A;  1NGE A;  4CJQ A;  5CE3 A;  2OPQ A;  4GV3 A;  2NRW A;  4IDK A;  2DTU A;  4BWM A;  3KWI A;  2UXB K;  4M3R A;  5KTQ A;  4Z4G A;  3AAR A;  1WUA A;  4C8O A;  1GOB A;  1EKE A;  4CW7 B;  3ZSR A;  1TUU A;  4CES A;  3QET A;  2HHS A;  1X9S A;  3CCE N;  4KB0 A;  4EP5 A;  4NYN A;  4EAH D;  1U48 A;  4BR0 A;  3HPH A;  5LJW A;  4BRK A;  4BE0 A;  3CJ7 A;  4O0I A;  4FOE A;  2O8E A;  3E9L A;  1HYZ A;  4YOW A;  4CEA A;  4DUZ K;  4PL7 A;  3DLG A;  3TAB A;  2CH6 A;  3ZT0 A;  2OCE A;  4LF5 K;  3RVC A;  1HRH A;  3M8Q A;  3ZT1 A;  4H0X B;  4FJJ A;  1TKX A;  1YF5 L;  4QOZ B;  2XY6 A;  1BGX T;  4JI5 K;  3PX0 A;  5AFU A;  3DWL A;  3OYL A;  3RR8 A;  3O9Q A;  4DV1 K;  3VOV A;  4FL9 A;  1VQ5 N;  2RN2 A;  1UAX A;  2BGG A;  3OYD A;  4PKI A;  4L3Q A;  4CGF A;  1HQU A;  1FKP A;  5FRO A;  2QWL A;  4ELU A;  4QCL A;  2HMP A;  1WBB A;  4NB4 A;  4CIE A;  1RT6 A;  1N6Q A;  1KVB A;  4PUO A;  2PYL A;  2D5R A;  4FO0 A;  3KK1 A;  3OW2 M;  4JS4 A;  1HNV A;  4ILH A;  3IMX A;  4BRC A;  3RMC A;  4CZL A;  4AHC A;  3L6Q A;  1JCG A;  3CI5 A;  4DV7 K;  4DTP A;  4MDA A;  4R5P A;  1QVF M;  3O9T A;  3I33 A;  5M1Q A;  3WNH A;  3THV A;  1W0H A;  2VG7 A;  3OYF A;  3O8M A;  4NLB A;  3D7E O;  3N4P A;  5FPE A;  1FJG K;  2G8V A;  4CZF A;  4JK8 A;  2Q3S A;  4CED A;  4I2Q A;  3LDL A;  3FZL A;  4ID5 A;  1NGG A;  4JI0 K;  3WXM B;  4LSL A;  4L8R B;  3LL3 A;  2HHX A;  2RHK A;  1VSI A;  3AO3 A;  2QK9 A;  1LW0 A;  5JS1 A;  4EFH A;  4FWK A;  2PFU A;  1QTM A;  1RNH A;  3MK6 A;  1BA0 A;  3IG1 A;  4YDU C;  4B8C A;  3VEN A;  1XI1 A;  5AQH A;  5AQY A;  1LW2 A;  5AQN A;  2YNF A;  3MXM A;  2E2O A;  3ZSQ A;  3CCS N;  4M3X A;  4OPH A;  3LPU A;  3Q7B A;  2CH5 A;  4BWJ A;  4B1W B;  2X78 A;  4FLV A;  4BRN A;  4FPA A;  4WCE L;  4JI3 K;  4F2R A;  1RTH A;  2VWB A;  3CJ9 A;  4BRP A;  5BR9 A;  4OPK A;  2I5J A;  4OLB A;  3O1W A;  1VSL A;  3EZ5 A;  2BH1 A;  3H08 A;  2F8T A;  3NF6 A;  3MCP A;  1K6Y A;  2QXF A;  4KRF A;  3E01 A;  3OYN A;  2O8D B;  3ZT4 A;  4BRO A;  2ZJP L;  3VQE A;  2WON A;  5AQP A;  4Z94 A;  4Z0U A;  3RMA A;  4ILG B;  3I0S A;  3VQ4 A;  5A2Q O;  1NG9 A;  4E1N A;  4OPJ A;  3MEE A;  3V6D A;  2ZQB A;  3FE1 A;  3VES A;  3H45 C;  4O8K A;  2V52 B;  3DLR A;  1DTT A;  1N36 K;  2Z1I A;  3AVM A;  4PKG A;  1RDW X;  1UA0 A;  3H1V X;  2G8U A;  3BY5 A;  2Y1J A;  4FWM A;  2XY8 A;  3SI6 A;  1D9D A;  4CIG A;  1E4F T;  3HOT A;  1SUQ A;  3TTF A;  1IG8 A;  4BVO A;  4ID1 A;  4F3O A;  4FZX C;  5LMU K;  1QZ5 A;  3AO2 A;  3PO5 A;  3QFP A;  4QS7 A;  3CQ8 A;  4JRQ A;  3LWM A;  1VSM A;  1UWB A;  3WXI A;  3I0R A;  3LDO A;  1RT1 A;  2ITG A;  4CJR A;  1XC9 A;  1VSH A;  4CGH A;  5AQS A;  1GLE G;  1VQK N;  3CCL N;  1SL1 A;  4IKF A;  1MA9 B;  4B9V A;  5EY4 A;  4EHT A;  2O8D A;  4EZ6 A;  3MX5 A;  4H5R A;  4BR5 A;  3HM9 A;  3V81 A;  3F73 A;  4IOC L;  3ID8 A;  2HHW A;  2A41 A;  3DRP A;  1QSS A;  4LH4 A;  3SMS A;  5BRE A;  2W6K A;  4BVP A;  3AGK A;  1V4S A;  1BCM A;  1U2V B;  3VER A;  1WN7 A;  3IAY A;  2CGK A;  1C0G A;  1DKG D;  2NRX A;  4XH1 A;  3OYA A;  5M1N A;  4BQZ A;  1IKV A;  1C0U A;  3DOK A;  1WAF A;  1HX1 A;  5KRS A;  3PSI A;  3J7A P;  1GLA G;  3S3O A;  4DS5 A;  3TTC A;  3QB0 A;  3MXI A;  2FBY A;  3CHW A;  1VQL N;  3D2E B;  3QML A;  1Q8I A;  4RW6 A;  1NK7 A;  4CBW A;  3CME N;  3DMJ A;  1NOZ A;  4XIU A;  5J1E A;  4LFB K;  3JXU A;  3TAQ A;  4JI6 K;  3DM2 A;  3MEG A;  3NBP A;  3P39 A;  2VQE K;  3ENB A;  2HHU A;  1DT9 A;  3R6M A;  3AY9 A;  2Q36 A;  3OVN A;  4HUE A;  3LP3 A;  3OYB A;  1X9J A;  2GEL A;  3AVF A;  1RT5 A;  5LJV A;  5BRH A;  3SYZ A;  1BDG A;  5CZ2 A;  4FK2 A;  1RBV A;  4CI6 A;  4F8R A;  5K14 A;  4IXC A;  4Z4F A;  4E1M A;  5HRR A;  3CM6 A;  4ISE A;  4WFB L;  2FBV A;  4LSN A;  4O5B A;  3IFR A;  2IGI A;  3BF1 A;  2E2N A;  3M3Z A;  1T44 A;  2E2Q A;  4DF8 A;  1BCO A;  2BAN A;  2HF3 A;  3U6F A;  4DSJ A;  1KFS A;  3WXK A;  1U2V A;  3EL2 A;  3NH1 A;  3G71 N;  3U3G A;  3VF6 A;  1QSL A;  4Z4H A;  3OHR A;  4WE1 A;  3CMA N;  3HTV A;  5F2R A;  4FSV A;  1YJW N;  4CZJ A;  4FWP A;  4FJL A;  5E41 A;  2QW9 A;  3MEC A;  3THW B;  1ESV A;  3D2E A;  3MN6 A;  2GWK A;  4CJE A;  4DSL A;  3J7Y P;  4H0P A;  3HPO A;  1ZC6 A;  3VGK A;  3AVK A;  4DTJ A;  1XQS C;  3HT3 A;  1FKO A;  3CCV N;  2O4G A;  4J2D A;  2NLX A;  4M7X A;  4B1X B;  2HNY A;  1BI4 B;  2VYP A;  1RGI A;  3TSP A;  3DRS A;  2P9S B;  4FM2 A;  2PZS A;  3O80 A;  4EIA A;  4IZ9 A;  4KHP K;  1WSF A;  1WOQ A;  4W5N A;  3AVA A;  1YTU A;  4BR7 A;  1K73 O;  4AF1 A;  3MDQ A;  3R9P A;  4BC3 A;  2QA4 N;  1NK5 A;  4A62 A;  1VHX A;  3OY9 A;  1HJR A;  3ZX2 A;  4M42 A;  1JLG A;  4AQY K;  3TTD A;  1DLO A;  3T1H K;  1Q9Y A;  1NK8 A;  4HCC A;  1QQN A;  2A6A A;  1CLQ A;  3AO1 A;  3WQT A;  3ZT3 A;  1JLB A;  1VQ7 N;  4C8M A;  5BPL A;  3D6R A;  1SAZ A;  4CJK A;  4WQ5 A;  4BE2 A;  4FJG A;  1LAW A;  2ZJQ L;  2YX6 A;  4OKE A;  4AHS A;  4JHD B;  1E3M A;  4N47 A;  1EP4 A;  3ENH A;  3DLL L;  3THW A;  2D0P A;  1J9A A;  5FDL A;  4BRE A;  4DSK A;  4GVE A;  4N76 A;  3SQ4 A;  3QES A;  5E84 A;  2A1R A;  1QSY A;  3VQ8 A;  4CHQ A;  3CCJ N;  3L2W A;  1YT3 A;  1BO5 O;  1C6V A;  4CEE A;  3CC2 N;  1HLU A;  4M45 A;  3NVM A;  3LDQ A;  3O3G A;  1BI4 A;  4H0T B;  4NCB A;  2P51 A;  2P9S A;  2IVP A;  5EXW A;  1ZXO A;  2CGJ A;  2YNH A;  2W42 A;  4DQS A;  2GEM A;  2OPS A;  1JCE A;  3LPT A;  1Y64 A;  3R3L A;  4CJU A;  3T7Z A;  4JI2 K;  1T3V A;  5AZI B;  3BZC A;  4AM7 A;  5M1F A;  1TK0 A;  4E7K A;  3EZW A;  1IO2 A;  2O4I A;  4V19 S;  3K5N A;  4KH5 A;  2FBT A;  2I7N A;  1N34 K;  4JRP A;  4BG8 A;  2G8H A;  1JKH A;  3L2V A;  3WXJ A;  3VF2 A;  1VK0 A;  1NWK A;  1L3U A;  5C0Y A;  4CGJ A;  1NLV A;  1YAG A;  4AH9 A;  4JHD A;  5AQK A;  2GX9 A;  2HBM A;  4KI6 A;  1VSJ A;  3WUH A;  4Y0W A;  4E19 A;  3AA2 A;  1VSF A;  2DY4 A;  3SV4 A;  4I9L A;  4XH5 A;  4BDP A;  4MLE A;  3ZX3 A;  4FM0 A;  2FF6 A;  4Q0B A;  3OYJ A;  3HBT A;  4LC9 B;  1L3T A;  3CG7 A;  3LDN A;  2YCH A;  5AQX A;  1HJO A;  1GLL O;  2KW4 A;  3AVL A;  2YKN A;  1W7A A;  4QS9 A;  4A2A A;  5LL6 Z;  2RKI A;  4DHY A;  3FZM A;  2E1Y A;  1T05 A;  3L8B A;  4RW8 A;  4AHR A;  3PSF A;  5BPN A;  1MWK A;  1DGK N;  3UB5 A;  1RTD A;  4CFC A;  4CEO A;  3AVC A;  2Y1I A;  4DQ8 A;  2P5G A;  4GV6 A;  2GWJ A;  3VEW A;  3ENO A;  3V1R A;  4ISF A;  5AZI A;  2DFF A;  3V9X A;  5BR8 K;  3V1O A;  1Z25 A;  2UYT A;  4DFP A;  4DB3 A;  5J2M A;  4I6M B;  4K43 A;  5AQW A;  5GAD P;  3ZX0 A;  3EKS A;  5T7B A;  4C1N K;  1CZB A;  2DFE A;  4FK4 A;  1Q9X A;  5BN8 A;  1EWR A;  1D4X A;  3L4Q A;  3LM9 A;  4DLE A;  5FLX O;  1S1X A;  3O3F A;  5KI6 A;  3BUZ B;  4AIL C;  4JKD A;  4CJ3 A;  4X62 K;  3KK3 A;  4B3S K;  1RTJ A;  3OJS A;  1D5A A;  1O1W A;  3R1X A;  4IFV A;  5LY3 A;  1JCF A;  1EQY A;  1IJJ A;  2NUB A;  3J80 O;  3OYG A;  1BQM A;  1GOC A;  1NU0 A;  3CCU N;  1OH6 A;  3ZLJ A;  3DLK A;  5AQL A;  3SBT A;  2YV0 X;  1W2B M;  3T1A A;  4CJS A;  2OTJ N;  4ZHR A;  4B9U A;  1KRP A;  4DQR A;  1LOT B;  1EET A;  1X1P A;  2WC9 A;  1U4B A;  3V9W A;  3O6W A;  1D9F A;  4DTN A;  1K8K B;  5BRD A;  4CHP A;  3HP9 A;  2EX3 A;  1YI2 N;  3E1Y A;  1QHT A;  1JL1 A;  3G10 A;  5HRS A;  4X65 K;  1EO1 A;  5C42 A;  2D0A A;  1GLF O;  2IDO A;  3ZEU B;  2D0O A;  2YHB A;  2ETJ A;  4LD0 A;  3ALY A;  4KO0 A;  3DXM B;  2VQF K;  1Y97 A;  1T6D A;  2IC3 A;  2Q0R A;  4KV8 A;  1WSH A;  2YHW A;  5AJ3 K;  1Q18 A;  5ELZ A;  4I2P A;  1SV5 A;  4FPB A;  4A57 A;  4KHN A;  4PY5 A;  4PQU A;  1TGO A;  2HF4 A;  3MMV A;  1Q81 O;  4I6M A;  5FPN A;  2G8K A;  1C1A A;  5HRP A;  1NJW A;  4BE1 A;  3NGZ A;  3CJB A;  4RW4 A;  3K9J A;  3RMB A;  3T69 A;  2VG6 A;  1NJI O;  3I55 N;  2YI1 A;  3F2K A;  3SPY A;  3KD5 E;  2O8C B;  4KTZ A;  3EEQ A;  3VTI A;  3HI0 A;  2G8I A;  1LWE A;  1Q82 O;  4GVM A;  3AGR A;  4B3M K;  4YFU A;  3M1F A;  3NAE A;  3AO5 A;  4H0O A;  4CK1 A;  3WXL A;  1WBD A;  5KQD A;  2QWM A;  3HVR A;  1T8E A;  1OVY A;  1TKT A;  1T6C A;  2Z1J A;  3K2P A;  3O5B A;  5DMR A;  2JGU A;  2B4J A;  4XH4 A;  4CEZ A;  4GKK K;  4O0J A;  1FW6 A;  3SCX A;  4FJ5 A;  2KLA A;  1K8K A;  2Q0U A;  4QAG A;  2FSJ A;  3EKU A;  3Q7C A;  3ZEU A;  4FLU A;  3TSQ A;  4FCY A;  4LFC K;  1NGB A;  3RTV A;  3BEX A;  3DXM A;  4DV3 K;  1L3V A;  3EE9 A;  2OAN A;  2P9N B;  5IWA K;  1TAU A;  1OKJ A;  4LF9 K;  4IOA L;  1NKE A;  4NCG A;  4DU3 A;  2F9W A;  5CZ1 A;  3S41 A;  3L2R A;  1S6P A;  3P4I A;  4N56 A;  1MU2 A;  2XHB A;  4LF6 K;  4CEB A;  4CEC A;  3OS2 A;  4FWS A;  3L3U A;  4PL8 A;  3AVH A;  2VWJ A;  4NXM K;  3NCI A;  3BGR A;  3CCQ N;  4DQP A;  4DTR A;  2O8C A;  4CJ4 A;  3BDP A;  4WQ5 C;  1RT3 A;  3OBW A;  4IG0 A;  4DF4 A;  1NM1 A;  4FZZ A;  1XUP O;  4B1U B;  2HVH A;  5SWM A;  3VQQ A;  3A5N C;  3NDK A;  3ULE B;  2HHH K;  5JLH A;  3ZT2 A;  4B3O A;  3K5M A;  3IUC A;  4Z4I A;  4DFM A;  1BU6 O;  4I7F A;  5DK5 A;  1S1U A;  3OS0 A;  1SKS A;  2F96 A;  1U47 A;  4FJ9 A;  3KLG A;  1IG9 A;  1TK5 A;  3GL1 A;  4BQL A;  1BOT O;  3CD6 N;  1RCH A;  4CF8 A;  4J2A A;  3G4S N;  4B3R K;  2P9P B;  3O4W A;  3T1Y K;  5JVG L;  4X66 K;  3CXC M;  3MCA B;  1R59 O;  4FLX A;  3QNO A;  4OGE A;  4YOV A;  4B9L A;  3K5L A;  2ATQ A;  1Q86 O;  2P9N A;  3DJC A;  3AAQ A;  4CEQ A;  1HPM A;  3CJA A;  5AQI A;  1HQE A;  2KTQ A;  1BA1 A;  4DV2 K;  3KD1 E;  1YJ9 N;  2D0C A;  3HXM A;  3M5R A;  4FYD A;  1RDD A;  4JKC A;  1KQS M;  4JEP A;  2HW3 A;  1QQM A;  2ASP A;  4CFA A;  3CPE A;  3U9Z A;  4H0V B;  4CGI A;  3RMD A;  1HR0 K;  2WBN A;  1XWL A;  4CF2 A;  3C95 A;  4IBN A;  4AHT A;  4CHO A;  4BAC A;  3P83 D;  1WSE A;  3OBY A;  3UKU B;  3MN5 A;  3QEI A;  4K8X A;  3QO9 A;  1RTI A;  1SKR A;  2QM1 A;  4F9O A;  3ULE A;  5AR0 A;  3I8D A;  4OJR A;  3T3F A;  5FRM A;  4MLH A;  1G15 A;  4JI4 K;  3MWP A;  3SJH A;  4BRM A;  1KLM A;  2H3G X;  4H5N A;  4NXN K;  1TAQ A;  3AVN A;  2NRH A;  3P5J A;  2P9P A;  3VF4 A;  4B9T A;  1XHX A;  3QER A;  1EXQ A;  4CK3 A;  4K42 A;  1NGA A;  1C0M A;  3VPZ A;  1A5W A;  2A1S A;  1TK8 A;  3I8B A;  1HNI A;  4B1V A;  3BF3 A;  4O55 A;  1SL2 A;  3D45 A;  3SUQ A;  4O4G A;  2F7T A;  5MLC Q;  2D0B A;  3KLE A;  5HRO A;  2YHA A;  3I56 N;  3SZ2 A;  1BUP A;  3PX6 A;  1ZBF A;  4CZM A;  1JLC A;  3NF8 A;  3LZI A;  1YVN A;  4DQI A;  2KQ2 A;  3CQX A;  3FFI A;  1LAV A;  4YOU A;  2P1J A;  1NBW A;  2UUB K;  1KVA A;  1NGC A;  2BDP A;  2IS3 A;  3HOS A;  4GMJ B;  3DAW A;  3UKU A;  1KAZ A;  3THY B;  5IT9 O;  3FZF A;  2P9U B;  4DS4 A;  3VQB A;  3GDQ A;  2E8A A;  2IVN A;  1S72 N;  1RDB A;  3THX B;  3SUN A;  1XNQ K;  2BE2 A;  3QEW A;  2OA8 A;  1ZBH A;  3SK3 A;  4IO8 A;  4MO5 A;  3EYZ A;  5M1K A;  2XY7 A;  3NH2 A;  3DXK B;  1JXB A;  3C7N B;  2D1K A;  2V7Y A;  3QIN A;  2RE2 A;  3LAK A;  5DM7 L;  4R79 A;  2ZD1 A;  3KWG A;  4K25 A;  2HB5 A;  2AJQ A;  5EVZ A;  5C24 A;  1A5X A;  5EOY A;  3WNF A;  4M63 C;  1NKB A;  3T19 A;  1NKC A;  3SPZ A;  4CFB A;  3QEX A;  2WFB A;  2XO7 A;  3K0S A;  4CJL A;  2ZJR L;  1T7P A;  3S3N A;  4H0Y B;  4H4O A;  4CZE A;  1S5J A;  2YHX A;  3QFU A;  2GV9 A;  1VQN N;  3CFP A;  1ASW A;  4OKK A;  4CBX A;  4CZI A;  1SZ2 A;  5FPM A;  4E89 A;  2QWR A;  2IVO A;  3OTO K;  4DFK A;  4ELV A;  2KZM A;  4BRL A;  4FJM A;  1ITG A;  2VGN A;  4B9N A;  3O1B A;  3ZYY X;  2LSN A;  2UU9 K;  5E26 A;  2HBJ A;  4CGG A;  4CHN A;  4CGD A;  5GIP A;  3KTQ A;  1QQC A;  3CFO A;  3NHG A;  2GUP A;  4JKA A;  2OYQ A;  4CZG A;  4IO9 L;  3RR7 A;  3NVK A;  3VEX A;  4JK9 A;  1WB9 A;  5C2F A;  3V4I A;  1I39 A;  3TAG A;  4C8N A;  2DFH A;  4DFJ A;  3THY A;  4M7Y A;  3VGL A;  4FLT A;  2P9U A;  3QIO A;  4E1J A;  1K8A O;  1K9M O;  3THX A;  4JKH A;  2Q1N A;  1WSG A;  1LV5 A;  3AA5 X;  3JAM O;  3EN9 A;  4BY9 C;  4M41 A;  5GIO A;  3DXK A;  4F4K A;  3C7N A;  2QWO A;  3VEY A;  3OA9 A;  5I42 A;  3KLH A;  4O8U A;  4AM6 A;  2BTF A;  4JAX A;  4MFB A;  1DEJ A;  1C0F A;  1EWQ A;  4KBO A;  4J2B A;  4U7B A;  1HNZ K;  2YJE A;  5M1P A;  1VQ8 N;  3FLC O;  1CXQ A;  3JSM A;  4IEE A;  1S9G A;  2B6A A;  3TAN A;  5AQQ A;  4KI4 A;  3KJV A;  2QEX N;  4FWQ A;  2FSK A;  2UXD K;  2QKB A;  3TAM A;  3UIQ A;  4LFA K;  4FM1 A;  3ATV A;  4WFA L;  1S1W A;  1GLC G;  1A5V A;  3BZK A;  4DTS A;  1KTQ A;  2YKM A;  2Q97 A;  1IH7 A;  1SL0 A;  3W0L A;  4CHY A;  4ELT A;  4UY8 O;  4PKH A;  4CIF A;  3UKR B;  1ILY A;  2HBK A;  3VEZ A;  1N32 K;  4JKB A;  4YDU A;  2KZZ A;  3FZK A;  3L4I A;  1JJ2 M;  3K59 A;  4OKJ A;  2ZGZ A;  1X3N A;  1NK0 A;  2E1Z A;  4C1N I;  5AQT A;  2HHQ A;  4WQ4 A;  1HKG A;  1XC3 A;  3LAM A;  1HKB A;  2Z1H A;  1TL3 A;  3KZB A;  5KRT A;  1TV6 A;  3VMF B;  1VQM N;  3TAE A;  4KHS A;  3CER A;  3O9U A;  2X74 A;  2O8B B;  3ZSW A;  4FK0 A;  5AFU H;  5AQM A;  1ASV A;  2HBL A;  3H3N O;  1YHQ N;  2J4R A;  3CJC A;  4JS5 A;  4KTW A;  4BRD A;  1C1B A;  5AQO A;  4B1Y B;  1RT4 A;  4KB1 A;  1H1V A;  1SKW A;  4RTF D;  1NJX A;  2F9T A;  3QIC A;  3AVJ A;  3F5T A;  4J2E A;  4DV5 K;  3C0B A;  3PIO L;  3PX4 A;  1RIL A;  4F2S A;  1KFD A;  3E9P A;  3S9H A;  3LAL A;  3L2U A;  3TWH A;  1QS4 A;  1RBR A;  4DTX A;  3J8A A;  2HVI A;  4H5V A;  4CF0 A;  4BDZ A;  1QQO A;  3N4Q A;  3SMP A;  3V9U A;  3MED A;  4DR4 K;  1KAY A;  1O13 A;  3UKR A;  4OO1 J;  3IRX A;  3CQY A;  5HOO A;  3PV8 A;  3K57 A;  1YJN N;  5CY4 A;  4K8Z A;  3VA3 A;  1XHZ A;  5I3U A;  1TUY A;  2XRI A;  4RW7 A;  5KGX A;  1KSP A;  1XNR K;  5HP1 A;  3SNN A;  3O4N A;  4HUG A;  1NK6 A;  4WF9 L;  1X9M A;  3B6P A;  4B08 A;  4YNQ A;  2GTD A;  2ZGY A;  2ZWH A;  2E2P A;  4LF7 K;  2OPR A;  2P9K B;  5JMV A;  1KCF A;  5GAE P;  4FXD A;  1U04 A;  3WEE B;  5H1S Q;  4YOX A;  5D3G A;  2O8B A;  3LAN A;  5C15 A;  5SZT A;  5KQ8 A;  3E66 A;  2NNW A;  1NJY A;  2ASO A;  2KFZ A;  5FRN A;  1IKX A;  1JLE A;  4O5F A;  1QHA A;  3HYF A;  3O4Q A;  4JI7 K;  3V9Z A;  3HZ6 A;  4F3T A;  4EP4 A;  1MWM A;  1U6Z A;  3CF5 L;  3VQ9 A;  5C12 A;  1WAJ A;  3HPG A;  1YIJ N;  4JLH A;  3VQD A;  1R0A A;  4CF9 A;  4C8K A;  4E0D A;  1VSD A;  2HNZ A;  4JK7 A;  4DV0 K;  4EZ9 A;  2B5J A;  3VQ5 A;  5AQF A;  2OZS A;  4AHV A;  3OJU A;  4FJ8 A;  1RDA A;  2NZT A;  4A61 A;  1WLJ A;  4DG1 A;  3A2F A;  3M8P A;  3S3M A;  3FFK B;  4CE9 A;  4OGC A;  4B9S A;  4DQQ A;  3IKM A;  1LCU A;  1RFQ A;  2PYJ A;  4N41 A;  4BDY A;  1MDU B;  5AZJ B;  3CCR N;  2ZM6 K;  4JKE A;  4CFD A;  4ICL A;  4KHQ A;  2P9K A;  3MN9 A;  3PUF A;  3WEE A;  2PAV A;  3KVG A;  3HST B;  2KFN A;  3O3H A;  3U9D A;  1B9D A;  4NLC A;  2OPP A;  3KK2 A;  1YTA A;  4DSF A;  1GOA A;  3QIP A;  3CPW M;  1Z26 A;  5TKY A;  2YJF A;  1CZ9 A;  4JD2 B;  4DUY K;  3VA0 A;  4M3Z A;  1CZA N;  3EY1 A;  3LP1 A;  1B9F A;  2HHT A;  1SS6 A;  4CBU A;  4DR3 K;  3NGI A;  3VGM A;  3C6T A;  3CCM N;  1ATN A;  1NMN A;  2E88 A;  4DR5 K;  1I94 K;  3MX2 A;  3VQA A;  3O08 A;  5JIC A;  1NK4 A;  4FVU A;  2HST A;  5BPM A;  2A5X A;  1C0T A;  4H5W A;  1Q7Y O;  2ZF5 O;  4H03 B;  1RT7 A;  2BUP A;  4U67 L;  4FJK A;  3SLC A;  1TVR A;  3CFR A;  5KPT A;  1EX4 A;  3AA4 A;  3GBT A;  1IV0 A;  4FWL A;  3NGY A;  1S1V A;  4DU1 A;  5AQZ A;  2E6L A;  5M1O A;  4W5O A;  3SUO A;  1ZBI A;  2WOM A;  3ZSX A;  4DU4 A;  2V51 B;  2AP1 A;  4O44 A;  1LWC A;  3U4L A;  1KAX A;  3MAQ A;  3NF7 A;  3ZSO A;  1SQK A;  3KKR A;  2IOC A;  5HRN A;  4CD1 A;  5CR4 A;  3CIP A;  3ID6 A;  3LP0 A;  3H46 O;  1HNX K;  1VRT A;  3P1G A;  5AZJ A;  3A5M C;  2NRV A;  4DTO A;  3ZET B;  3RRH A;  1FXX A;  1BHL A;  2F4V K;  4FLY A;  1RT2 A;  3C6U A;  2ZE2 A;  4IJN A;  4OX9 K;  3FGU A;  3VTH A;  3OYM A;  4E7J A;  4GKJ K;  1VQO N;  4JD2 A;  4B1Z A;  4OLA A;  3V1Q A;  2ASM A;  3HJF A;  4DR2 K;  2GBZ A;  4JNE A;  2O8F B;  1V4T A;  2QWQ A;  5BN9 A;  2HND A;  4BR4 A;  3WQU A;  5CYQ A;  4CD3 A;  2EWS A;  3MN7 A;  3TSU A;  4G9Z A;  3ZSV A;  3U8X A;  3ZSZ A;  1NOY A;  3A5O C;  4KPY A;  2Z1G A;  5AQG A;  4CZK A;  2KHO A;  5KPR A;  1TKZ A;  3AO4 A;  3PO4 A;  1Z6R A;  1G99 A;  3OYI A;  2FBX A;  4QS8 A;  1HPZ A;  3G0Z A;  5LMN K;  3F9K A;  4LH5 A;  1Z05 A;  2FXU A;  3ULD A;  1BIZ A;  4WQ4 C;  1YIT N;  1WSJ A;  3CET A;  2UUA K;  3GE1 A;  5J2Q A;  1TYQ B;  4A5B A;  1KXP A;  1OH8 A;  4A59 A;  3LDP A;  3ZET A;  4CZH A;  2FC0 A;  3JYT A;  2VG5 A;  3P38 A;  2OZM A;  2AA4 A;  3O9S A;  5ADX H;  4A2B A;  2RF2 A;  4BC4 A;  1L3S A;  3ISN C;  4CK2 A;  2KKZ A;  5BRF A;  2W6L A;  3M8R A;  4CJW A;  4BG9 A;  4KHY A;  1YXQ A;  1NGJ A;  2YNG A;  1VQ4 N;  3TU5 A;  4BRQ A;  1JL2 A;  4CJT A;  2WTU A;  3NH0 A;  2O8F A;  1OH7 A;  3QLH A;  3LWL A;  5HLF A;  3VEV A;  1HYS A;  4CJP A;  1M1K O;  4K41 A;  1C1C A;  2VGM A;  5GAG P;  4FWO A;  1XMQ K;  4NYF A;  5KGW A;  1BL3 A;  3SUP A;  1VSE A;  4CJ7 A;  4E3S A;  5GIN A;  1XMO K;  3LM2 A;  2X6S A;  3WT0 A;  1HUX A;  1B92 A;  4CJF A;  3RRG A;  3J7Z O;  3V9S A;  4DTU A;  4WYB A;  4W5T A;  5JVH L;  4DKW A;  4IOX A;  2X6N A;  3AA3 A;  1KLN A;  2QWN A;  3GG4 A;  2RPI A;  4PWD A;  5EU7 A;  5AQV A;  1KVC A;  2V7Z A;  1U49 A;  2E5L K;  3DLB A;  1S6Q A;  1I3A A;  4IFY A;  4FZY A;  4H8K A;  4HTL A;  1W97 L;  3L0Q A;  1KD1 O;  3GOI A;  4FWN A;  1TYQ A;  3AVB A;  4IDH A;  4NO7 A;  1X3M A;  3FZH A;  5TKW A;  2A3Z A;  1ZBS A;  3H1Q A;  3BP8 A;  2QTD A;  2VCP A;  2Q31 A;  4TSX A;  2QXL A;  4CHZ A;  3PIP L;  4EHU A;  2IAJ A;  2WUS A;  4ISG A;  2XY5 A;  1P90 A;  5AQU A;  5F1X A;  2PY5 A;  3SQ2 A;  4YOY A;  3M8S A;  4DMN A;  4KH6 A;  3C6H A;  2G8F A;  3VQC A;  3TAR A;  4FJN A;  2QI2 A;  3SJJ A;  2YNI A;  4RG8 A;  5GAH P;  4FLW A;  1J53 A;  2UUC K;  3AVG A;  1X9W A;  4YY3 K;  4GV9 A;  1NGD A;  1F21 A;  4BR2 A;  3SV3 A;  4YHH K;  4FW2 A;  4Z4C A;  4FJX A;  4NCA A;  3LDS A;  3L3V A;  4FJ7 A;  5AQR A;  2NRT A;  1JLF A;  4JI8 K;  3SQ1 A;  3OS1 A;  4KTQ A;  3SAF A;  3HL8 A;  3OYC A;  4FW1 A;  2FSN A;  1ATR A;  4B9M A;  4Y1C A;  4Z4E A;  4DV6 K;  3TAF A;  3OYH A;  1S1T A;  1IBK K;  3TI0 A; 
#chains in the Genus database with same CATH homology
 1TV6 A;  4CHP A;  3HP9 A;  3KIO A;  4E7L A;  2EX3 A;  3TAE A;  4KHS A;  1QHT A;  1JL1 A;  3G10 A;  4OPK A;  5HRS A;  2I5J A;  4DWI A;  5C42 A;  2D0A A;  2X74 A;  2IDO A;  3VQ7 A;  4OLB A;  2YHB A;  2ETJ A;  4KKO A;  4LD0 A;  4OVL A;  3ZSW A;  1VSL A;  3ALY A;  3EZ5 A;  4FK0 A;  4KO0 A;  3HP6 A;  2P5O A;  1ASV A;  3H08 A;  4H4M A;  2F8T A;  3NF6 A;  3K5O A;  1U45 A;  1K6Y A;  3DRR A;  4M3Y A;  2QXF A;  1Y97 A;  4JS5 A;  4KRF A;  3E01 A;  4KTW A;  1ZBL A;  1C1B A;  3OYN A;  2VWK A;  2IC3 A;  1RT4 A;  4KB1 A;  4KV8 A;  1SKW A;  3ZT4 A;  1WSH A;  1NJX A;  3K58 A;  4I2P A;  4KHW A;  1SV5 A;  3AVJ A;  3DI6 A;  3VQE A;  2WON A;  1T03 A;  4KHN A;  4J2E A;  4PY5 A;  4Z0U A;  3RMA A;  4PQU A;  4IG3 A;  1TGO A;  3PX4 A;  3I0S A;  3VQ4 A;  4N5S A;  4E1N A;  1RIL A;  4OPJ A;  3MEE A;  4F2S A;  1KFD A;  3V6D A;  2ZQB A;  3S9H A;  2G8K A;  1C1A A;  3LAL A;  5HRP A;  3L2U A;  3TWH A;  1QS4 A;  1RBR A;  4DTX A;  1NJW A;  2HVI A;  3KKS A;  4BE1 A;  4DSE A;  1J5O A;  4CF0 A;  3NGZ A;  3DLR A;  4BDZ A;  3TAP A;  1DTT A;  4RW4 A;  2Z1I A;  3AVM A;  3RMB A;  2VG6 A;  3V9U A;  3MED A;  1YVU A;  1BQN A;  3SPY A;  1UA0 A;  3KD5 E;  4FJH A;  4KTZ A;  2G8U A;  2G8I A;  1LWE A;  3IRX A;  2Y1J A;  1D8Y A;  4GVM A;  1DTQ A;  2XY8 A;  3ASM A;  4YFU A;  3SI6 A;  1JLA A;  4RW9 A;  4CIG A;  4HTU A;  3NAE A;  3PV8 A;  3D0P A;  1D9D A;  2HMI A;  3AO5 A;  3K57 A;  1J54 A;  1SUQ A;  1IKY A;  4HHT A;  4CK1 A;  5CY4 A;  4K8Z A;  3HVR A;  3VA3 A;  4ID1 A;  1T8E A;  3LZJ A;  1JLQ A;  4E7I A;  4F3O A;  1TKT A;  2Z1J A;  5DMR A;  3K2P A;  3OYK A;  5I3U A;  1XHZ A;  4FZX C;  3PO5 A;  3AO2 A;  3SQ0 A;  2XRI A;  4RW7 A;  5CYM A;  1S9E A;  2B4J A;  2JGU A;  4AHU A;  4CEZ A;  5KGX A;  4O0J A;  3LWM A;  3CQ8 A;  4JRQ A;  5HP1 A;  3SCX A;  3SNN A;  4FJ5 A;  3O4N A;  4HUG A;  1VSM A;  1UWB A;  1NK6 A;  1X9M A;  3B6P A;  3I0R A;  1RT1 A;  4B08 A;  4YNQ A;  4QAG A;  1NJZ A;  2ITG A;  4CJR A;  4E7H A;  2OPR A;  2GUI A;  1KCF A;  3QNN A;  1U04 A;  1XC9 A;  4HUF A;  1VSH A;  5D3G A;  4FXD A;  4CGH A;  4FLU A;  3LAN A;  5SZT A;  4FCY A;  4CJV A;  1NJY A;  3RTV A;  2KFZ A;  4G1Q A;  5FRN A;  1IKX A;  1L3V A;  1JLE A;  1SL1 A;  4IKF A;  1NK9 A;  3HYF A;  4B9V A;  3O4Q A;  1JXE A;  1TAU A;  1RBS A;  3V9Z A;  1NKE A;  4NCG A;  4DU3 A;  4F3T A;  4EZ6 A;  4EP4 A;  5CZ1 A;  2QKK A;  3HM9 A;  3VQ9 A;  1LWF A;  3L2R A;  1S6P A;  4N56 A;  3F73 A;  1MU2 A;  1WAJ A;  3HPG A;  3V81 A;  2HHW A;  2XHB A;  3DRP A;  1QSS A;  4LH4 A;  3LP2 A;  4JLH A;  3VQD A;  1R0A A;  4CF9 A;  1KSP A;  4CEB A;  4C8K A;  1REV A;  4CEC A;  4E0D A;  1VSD A;  2HNZ A;  3OS2 A;  1BCM A;  4EZ9 A;  3L3U A;  3AVH A;  4Q5V A;  1WN7 A;  2VWJ A;  3IAY A;  3NCI A;  2B5J A;  3OYA A;  1WNS A;  3BGR A;  1N5Y A;  1FK9 A;  3VQ5 A;  1IKV A;  1C0U A;  4Y1D A;  4DQP A;  4DTR A;  2OZS A;  4AHV A;  5J2P A;  3DOK A;  1WAF A;  3OJU A;  4CJ4 A;  5KRS A;  3BDP A;  4FJ8 A;  4PWD A;  1RDA A;  1RT3 A;  3S3O A;  4IG0 A;  4DS5 A;  4DF4 A;  1WLJ A;  4DG1 A;  3A2F A;  4FZZ A;  3MXI A;  2FBY A;  3M8P A;  3S3M A;  2HVH A;  5SWM A;  3VQQ A;  4CE9 A;  3VQP A;  1QE1 A;  4OGC A;  3NDK A;  3QEV A;  1Q8I A;  4RW6 A;  1NK7 A;  4B9S A;  3ZT2 A;  4DQQ A;  3DMJ A;  2F8S A;  4B3O A;  5C25 A;  1NOZ A;  3K5M A;  4XIU A;  4Z4I A;  4DFM A;  5J1E A;  4I7F A;  5DK5 A;  2PYJ A;  2EHG A;  1S1U A;  1RBU A;  4MQ3 A;  4W5R A;  3OS0 A;  3TAQ A;  1SKS A;  4N41 A;  4DLG A;  2F96 A;  3DM2 A;  3WNE A;  1U47 A;  4FJ9 A;  3B6O A;  3MEG A;  3KLG A;  3C94 A;  1RDC A;  4BDY A;  1TK5 A;  1BIU A;  3NBP A;  1IG9 A;  3OYE A;  1RCH A;  4CF8 A;  4CFD A;  2HHU A;  4J2A A;  3DLH A;  3OVN A;  4ICL A;  4HUE A;  3LP3 A;  4GW6 A;  4KHQ A;  2DY4 A;  3OYB A;  3PUF A;  3ZSY A;  4W5Q A;  4FLX A;  3QNO A;  1VRU A;  3HST B;  2KFN A;  3AVF A;  4OGE A;  3HO1 A;  3O3H A;  1RT5 A;  3AVI A;  3SYZ A;  4B9L A;  5CZ2 A;  1B9D A;  4DSI A;  3K5L A;  2ATQ A;  4FK2 A;  1RBV A;  2OPP A;  3KK2 A;  4F8R A;  1YTA A;  4DSF A;  4DTM A;  4CEQ A;  4FVM A;  5K14 A;  1GOA A;  3QIP A;  4Z4F A;  1VSK A;  1Z26 A;  4E1M A;  5HRR A;  1HQE A;  2KTQ A;  1CZ9 A;  4CJ5 A;  3KD1 E;  3CM6 A;  2D0C A;  3VA0 A;  4M3Z A;  3HXM A;  4UQG A;  2FBV A;  4LSN A;  4O5B A;  3EY1 A;  3LP1 A;  1B9F A;  2IGI A;  4FYD A;  4PA1 A;  2HHT A;  1RDD A;  3DOL A;  4DF8 A;  1BCO A;  2BAN A;  3CM5 A;  1IKW A;  2HW3 A;  1TL1 A;  3L2Q A;  3NGI A;  3U6F A;  1KFS A;  3C6T A;  4DSJ A;  3VQA A;  4CFA A;  3NH1 A;  4KHU A;  1W9H A;  3U3G A;  1NK4 A;  2G8W A;  1QSL A;  1C0T A;  4CGI A;  4Z4H A;  3RMD A;  3DLE A;  4B8A B;  4C8L A;  3MXJ A;  1XWL A;  4CF2 A;  4WE1 A;  3C95 A;  4IBN A;  1RT7 A;  4AHT A;  4CHO A;  4BAC A;  4FJK A;  3P83 D;  1WSE A;  1TVR A;  4FJL A;  3CFR A;  5E41 A;  4K8X A;  3MEC A;  3QEI A;  1ZYQ A;  2HHV A;  3QO9 A;  1EX4 A;  3AA4 A;  1RTI A;  3QEP A;  3CYM A;  1SKR A;  3NGY A;  1S1V A;  4DU1 A;  4CJE A;  4DSL A;  2E6L A;  1ZBI A;  4W5O A;  3SUO A;  3HPO A;  3VQ6 A;  2WOM A;  3ZSX A;  4DU4 A;  5J2N A;  3I8D A;  3KLI A;  4OJR A;  4O44 A;  1LWC A;  3AVK A;  1RBT A;  3HT3 A;  3MAQ A;  3NF7 A;  4DTJ A;  3ZSO A;  3T3F A;  3KKR A;  1FKO A;  2IOC A;  4CEF A;  5HRN A;  1UA1 A;  4FJI A;  2O4G A;  1G15 A;  2R7Y A;  3LP0 A;  4FLZ A;  4J2D A;  1VRT A;  1KLM A;  3P1G A;  4LY7 A;  1WSI A;  1TAQ A;  4M3U A;  3AVN A;  2HNY A;  3P5J A;  2JLE A;  1BI4 B;  4DTO A;  4B9T A;  4CF1 A;  1XHX A;  3DRS A;  3RRH A;  3QER A;  1EXQ A;  4CK3 A;  1FXX A;  4FM2 A;  2PZS A;  4M3W A;  1UOC A;  4ZTF A;  1C0M A;  1WSF A;  1BHL A;  1A5W A;  4FLY A;  3TR8 A;  1RT2 A;  2A1S A;  3C6U A;  5HBM A;  1TK8 A;  3AVA A;  4W5N A;  3RWU A;  2ZE2 A;  4ZTJ A;  1YTU A;  1HNI A;  4CCH A;  3OYM A;  4O55 A;  1SL2 A;  3AV9 A;  4E7J A;  1HMV A;  3D45 A;  1CXU A;  1L5U A;  3SUQ A;  4OLA A;  1NK5 A;  3V1Q A;  4O4G A;  3KLE A;  3HJF A;  2D0B A;  2GBZ A;  2YHA A;  1BIS A;  3OY9 A;  1HJR A;  5HRO A;  2E6M A;  1JLG A;  4M42 A;  5JS2 A;  4CER A;  1DLO A;  2HND A;  1Q9Y A;  5CYQ A;  4M3T A;  3SZ2 A;  3U3Y A;  1NK8 A;  4I9Q A;  3NF9 A;  3PX6 A;  4HCC A;  1ZBF A;  1JLC A;  3NE6 A;  1CLQ A;  3AO1 A;  3NF8 A;  3LZI A;  3HK2 A;  3ZSV A;  3ZT3 A;  4DQI A;  2KQ2 A;  3FFI A;  4KRE A;  1JLB A;  1LAV A;  1ZBU A;  3ITH A;  3NFA A;  4C8M A;  3ZSZ A;  1NOY A;  4KAZ A;  2P1J A;  5FRM A;  3HVT A;  4CJK A;  1HYV A;  3PY8 A;  4BE2 A;  1KVA A;  1LAW A;  2Z1G A;  4FJG A;  4HCB A;  4KPY A;  2BDP A;  2IS3 A;  3VN5 A;  4GMJ B;  2E4L A;  3IS9 A;  4OKE A;  1ASU A;  4AHS A;  1TKZ A;  3ZCM A;  4N47 A;  3AO4 A;  3DYA A;  3PO4 A;  4DS4 A;  1EP4 A;  3KLF A;  3VQB A;  1TKD A;  3OYI A;  3WNG A;  1RDB A;  2FBX A;  3SUN A;  2BE2 A;  1J9A A;  5FDL A;  3QEW A;  2OA8 A;  4DSK A;  1ZBH A;  1HPZ A;  4KFB A;  3G0Z A;  4HVJ A;  3F9K A;  4CJQ A;  3EYZ A;  2XY7 A;  2OPQ A;  4LH5 A;  3QES A;  3SQ4 A;  4N76 A;  2A1R A;  3NH2 A;  4IDK A;  3ULD A;  1QSY A;  3VQ8 A;  2DTU A;  1BIZ A;  4BWM A;  1WSJ A;  1JXB A;  3QIN A;  4CHQ A;  4M3R A;  3LAK A;  3L2W A;  5KTQ A;  2ZD1 A;  1YT3 A;  1C6V A;  4CEE A;  5J2Q A;  4Z4G A;  4M45 A;  2HB5 A;  2AJQ A;  3O3G A;  1BI4 A;  5C24 A;  1GOB A;  4C8O A;  1A5X A;  4NCB A;  2FC0 A;  2P51 A;  1EKE A;  3JYT A;  3WNF A;  2VG5 A;  2OZM A;  2YNH A;  2W42 A;  4DQS A;  1NKB A;  2RF2 A;  1L3S A;  3T19 A;  3ISN C;  3ZSR A;  2OPS A;  4CK2 A;  4CFB A;  3SPZ A;  1NKC A;  4CES A;  3QEX A;  3M8R A;  4CJW A;  3LPT A;  2XO7 A;  3QET A;  4CJL A;  2HHS A;  1X9S A;  1T7P A;  4CJU A;  4KB0 A;  3S3N A;  4EP5 A;  4H4O A;  1S5J A;  4NYN A;  1U48 A;  4KHY A;  2GV9 A;  3HPH A;  3CFP A;  2YNG A;  1ASW A;  4OKK A;  1TK0 A;  1JL2 A;  4CJT A;  4E89 A;  4BE0 A;  4E7K A;  4O0I A;  3NH0 A;  1IO2 A;  2O4I A;  3QLH A;  3LWL A;  5HLF A;  1HYZ A;  1HYS A;  4CJP A;  1C1C A;  4CEA A;  4DFK A;  3K5N A;  4NYF A;  4ELV A;  2KZM A;  3DLG A;  1ITG A;  2FBT A;  5KGW A;  3TAB A;  4B9N A;  3ZT0 A;  4FJM A;  1BL3 A;  4JRP A;  3SUP A;  1VSE A;  2G8H A;  2LSN A;  4E3S A;  1JKH A;  3L2V A;  1HRH A;  3M8Q A;  4CGG A;  4CGD A;  4CHN A;  3KTQ A;  1QQC A;  1VK0 A;  3CFO A;  3ZT1 A;  3NHG A;  2OYQ A;  3RR7 A;  1L3U A;  2X6S A;  4CGJ A;  3V4I A;  1I39 A;  3TAG A;  4FJJ A;  1TKX A;  1B92 A;  4CJF A;  4QOZ B;  2XY6 A;  1BGX T;  4C8N A;  2DFH A;  4AH9 A;  4DFJ A;  3RRG A;  4FLT A;  3V9S A;  4DTU A;  3PX0 A;  4KI6 A;  3QIO A;  1VSJ A;  4W5T A;  3OYL A;  3RR8 A;  2X6N A;  3AA3 A;  4E19 A;  1KLN A;  1WSG A;  2RPI A;  1VSF A;  3AA2 A;  5EU7 A;  2RN2 A;  3AA5 X;  4I9L A;  1UAX A;  3SV4 A;  1LV5 A;  1KVC A;  3OYD A;  4BDP A;  2BGG A;  4FM0 A;  4CGF A;  1HQU A;  1U49 A;  4Q0B A;  1FKP A;  4M41 A;  5FRO A;  3OYJ A;  1S6Q A;  1I3A A;  4IFY A;  3DLB A;  1L3T A;  4ELU A;  4FZY A;  4QCL A;  4H8K A;  4F4K A;  3CG7 A;  2KW4 A;  3AVL A;  2YKN A;  4CIE A;  1RT6 A;  1N6Q A;  1KVB A;  4PUO A;  3AVB A;  5I42 A;  2PYL A;  3KLH A;  2D5R A;  3KK1 A;  4JS4 A;  2RKI A;  1HNV A;  4MFB A;  3RMC A;  1T05 A;  4J2B A;  3L8B A;  4RW8 A;  4AHC A;  4AHR A;  4TSX A;  4CHZ A;  1RTD A;  1CXQ A;  4CFC A;  4DTP A;  2IAJ A;  3AVC A;  4CEO A;  3JSM A;  2Y1I A;  4R5P A;  1S9G A;  2XY5 A;  2B6A A;  2P5G A;  3TAN A;  2PY5 A;  3SQ2 A;  3WNH A;  3THV A;  1W0H A;  2VG7 A;  3V1R A;  3OYF A;  3M8S A;  4KI4 A;  4DMN A;  3KJV A;  2DFF A;  3V9X A;  2G8V A;  3V1O A;  1Z25 A;  2G8F A;  2Q3S A;  4CED A;  4DFP A;  3VQC A;  3TAR A;  4I2Q A;  3TAM A;  3UIQ A;  2QKB A;  4FM1 A;  4FJN A;  5J2M A;  4ID5 A;  1S1W A;  3SJJ A;  4DTN A;  2YNI A;  4RG8 A;  4LSL A;  5T7B A;  4FLW A;  1J53 A;  4L8R B;  1CZB A;  2DFE A;  3AVG A;  1A5V A;  2HHX A;  4FK4 A;  1VSI A;  3AO3 A;  4DTS A;  2QK9 A;  1X9W A;  1KTQ A;  1Q9X A;  2YKM A;  1LW0 A;  1F21 A;  1IH7 A;  5JS1 A;  4DLE A;  1SL0 A;  4CHY A;  4ELT A;  1S1X A;  3SV3 A;  1QTM A;  1RNH A;  3O3F A;  4CIF A;  3IG1 A;  4FW2 A;  4B8C A;  4Z4C A;  5KI6 A;  4AIL C;  1XI1 A;  4CJ3 A;  3KK3 A;  1RTJ A;  4FJX A;  3OJS A;  1LW2 A;  1D5A A;  2YNF A;  1O1W A;  3MXM A;  4IFV A;  4NCA A;  3LDS A;  2KZZ A;  2NUB A;  3ZSQ A;  3L3V A;  3OYG A;  4FJ7 A;  1BQM A;  1GOC A;  4M3X A;  1JLF A;  3LPU A;  3K59 A;  3SQ1 A;  3DLK A;  4OKJ A;  4BWJ A;  3OS1 A;  2X78 A;  2YV0 X;  4FLV A;  4KTQ A;  3HL8 A;  1NK0 A;  3OYC A;  4FW1 A;  3T1A A;  4CJS A;  4ZHR A;  4B9U A;  2HHQ A;  1KRP A;  4Y1C A;  4DQR A;  3LAM A;  1EET A;  1X1P A;  1U4B A;  4B9M A;  4Z4E A;  2Z1H A;  1TL3 A;  3V9W A;  3TAF A;  1D9F A;  4F2R A;  3OYH A;  1S1T A;  5KRT A;  1RTH A;  3TI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...