5HRUA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
305
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
molecule keywords L-lactate dehydrogenase
total genus 117
structure length 305
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hruA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hruA02
2ZK7A 5LCXA 3G79A 3ZHYA 2RAFA 3OJOA 4L4XA 4AJ1A 1HRDA 1I2CA 5BSGA 5JXWA 3FNFA 5A5FA 2P5UA 1VJTA 4TSKA 3JSAA 4ILKA 1XR3A 2BHLA 4A7PA 4YWJA 1ZBQA 3IS3A 1QYWA 4NFYA 3C1TA 1PJLA 1LNQA 4J1TA 2ZQZA 2IODA 4CM9A 5DF1A 1RWBA 1ZKMA 4BO6A 3CSDA 4FFLA 4CV2A 5DZSA 2HAEA 2PFGA 2HJRA 2PZJA 4ZD6A 4BO0A 4ZJUA 2JCXA 3L9WA 2HRZA 5K6AC 1XG5A 4E21A 5JAIA 4CQMB 4XGIA 3U62A 4IXTA 1T2EA 4WLVA 4YAJA 3RKUA 4EUFA 2YHIA 4PZCA 1M6HA 2V6GA 4AL4A 2G5CA 1DLJA 2OP1A 3PYMA 5FWNA 4U8GA 4ZQGA 4DLLA 1EUCA 3DHYA 5IN4A 2IZ1A 1PTJA 3VVCA 4UEOA 5ICMA 4CV0A 1ULUA 1R4MA 4XB1A 4Z0HO 4WLEA 1Q1NA 3FTNA 3KSUA 4G2NA 1KEVA 2WYWA 1G1AA 2ZCUA 2NU6A 4S3MA 3EYWA 1PS0A 1E1LA 2PD6A 1U5AA 3AFMA 3MOGA 3RFTA 3QV1A 1X7DA 5I8WA 5KVVA 2DPGA 2X1HA 4E32A 1HL3A 4PLFA 4OQYA 4YT2A 5C7OO 4R3NA 2X5JO 4DVJA 5H82A 4ZGWA 4ESOA 2PD3A 4U5QA 4D3DA 1NQTA 1E1NA 4L4RA 3ZV5A 2FN7A 1I3MA 3C3XA 1GZ4A 3PYXA 1HSZA 1P31A 1T2FA 3PDJA 3PXXA 1JWBB 3ADPA 2EKQA 2YFQA 5KVQA 5TGDA 4U6SA 2EEZA 2NQTA 1UZMA 2QYSA 4K26A 4WLUA 4CQLB 2J3JA 4N5NA 4CMIB 5CFZA 5BNIA 1Y1PA 1SB9A 2YDXA 2EKLA 2X0NA 3GH3A 1JDJA 2CFCA 3DO5A 4GPD1 3VDQA 1WPQA 4R5HA 1OBFO 2EP7A 3FPLA 4B8WA 4DTIA 3Q11A 3H6KA 3PGXA 1QG6A 2EV9A 3BAZA 1VL8A 9LDTA 1T1SA 3B20A 3CEAA 3GFGA 4R68A 1MXFA 1TT5A 2BFAA 2DU8A 5DDIP 4WCFA 4DBVO 1JAXA 1ULSA 2VWGA 2IEDA 4D0RA 4PLCA 1LDGA 4IDFA 5CDUA 1I24A 4OKIA 3VPXA 4PGFA 4CMEC 4E0BA 5B4UA 5MDHA 4K6FA 1E6EA 4E33A 1I01A 4TVOA 2GZ1A 1O89A 3I5MA 1QV7A 3ASUA 3QP9A 4JIGA 4XQCA 1GL3A 5F5NA 5IN5A 1UDBA 3I6QA 5ENDA 1U2GA 3K31A 3W4JA 2R00C 4RVGA 1N8KA 2Q4EA 3CXRA 3M2TA 4BO9A 1DRUA 2C5EA 1JN0A 2NV6A 5JDCC 3DZGA 4WOJA 4E2YA 3I83A 1ZO8A 4J0EA 1B26A 1CWUA 1PZEA 4JJFA 5CEJA 2P4QA 3O38A 4KQWA 1DDOA 1I0ZA 3BTSA 3CMMA 3E03A 4CJXA 1BTOA 3ICPA 4RV9A 3TWOA 5DOZA 4YXFA 3L07A 4EJ6A 5L7WA 2AQKA 4MIYA 1MFPA 1R66A 5TJHA 1NPDA 1BMDA 1LSUA 2AMFA 3HADA 3V5NA 1N9GA 1Y7TA 4EYEA 2O3QA 2FZWA 3D3EA 5ENVA 3Q2KA 1ORRA 1EQUA 4D44A 4E13A 4M1QA 3WMWA 2PA3A 4R1SA 3T4XA 2ZJ0A 4J0FA 3OBBA 3ZWVA 1NFFA 4FOOA 5TF4A 2GSDA 3ZWXA 5HS4A 3ZV4A 2UUOA 3GUYA 3QVXA 8ADHA 3K92A 3RC7A 1DRVA 4FDAA 1NVMB 2VHYA 5U1PA 2FPIA 5L7TA 2A92A 3P2YA 3R3SA 1VKNA 1C1XB 5DCWA 3C7CB 3QLJA 4G5HA 2Z95A 4Q3NA 5G4KA 4BKUA 2XF8A 1GEEA 5TIIA 1ZK0A 3KBOA 4TKMA 4XQGA 4BVAA 1EMDA 1NM5A 1YGYA 3QHAA 4RPHA 3TRIA 3NJ8A 4FBGA 1YBVA 4PCVA 3OJ0A 2WD7B 4N7RA 2RIRA 1WWKA 2HK8A 1OMOA 1SOVA 4YAGA 3ETDA 3H9EO 3JQCA 4ITUA 4ZVVA 3MJVA 4BNYA 1KERA 3ZWAA 3H3JA 3MEQA 1NPYA 3DEYX 3KEQA 1D3AA 1P45A 2OZPA 5I9NA 4R5MA 1OAAA 4J4TA 3AUTA 3RUDA 1B16A 4XYEA 3RCBA 2XPCA 4OOFA 4RPLA 1DIGA 4AG3A 4MKZA 4A10A 1SEVA 3GC6A 4TQGA 1UXHA 4CQLA 4NBUA 1O0SA 1W73A 3JD2A 5F21A 3GAFA 4CUZA 5BR7A 1Y8QB 1IB6A 1QYDA 5TT1A 1E5QA 1H6DA 4Y8VA 5FEUA 5K9ZA 3ZWWA 4CMJA 5ICSA 3D4OA 3NGXA 5U4QA 1Z75A 1GQQA 2ZYDA 4IZHA 1XDWA 2Y0CA 3AI1A 3GN2A 3GZNA 1B8UA 1LXCA 2O3SA 1IE3A 3GEGA 3ZNPA 4OXKA 4ALJA 4EEXA 3HN7A 2FOIA 2HMUA 1XA0A 3NV9A 4WPGA 3ST7A 1ADGA 4EJMA 1E7QA 1Z6ZA 4CMBA 2DLDA 3RSHA 1EK5A 5CG1A 4FFNA 3Q1LA 4PLYA 5DOVA 1AGNA 1NYTA 1PL7A 4AJNA 5IZ4A 4NQZA 1LDYA 4YACA 3DZFA 5C5IA 1EVZA 2EIHA 2QIOA 1UXGA 1E5LA 3L4BC 1YBMA 1V9LA 2O7QA 5TT0A 3DFUA 2VQ3A 3DZBA 4K9DA 1U8FO 4XGKA 1LDBA 1JTVA 3A1NA 3JQAD 4AFNA 3KOUA 3U4IA 2GN9A 2BFMA 3ROMA 1DJNA 3IKTA 4MOWA 2A35A 2V65A 1QORA 4PZEA 1HDGO 1D8AA 1C14A 1P74A 4BHTA 2D5AA 3CPSA 8LDHA 3AI3A 3PHHA 1SZJG 5I8ZA 2Y1EA 3BZUA 5L7YA 4CM8B 4O59O 3V8BA 3INTA 2VT3A 3RUIA 4NK5A 2HK7A 1EE9A 1FDWA 4DQUA 3ORFA 2PGDA 3K30A 1BDBA 4IJUA 1R4NA 4W99A 1K89A 1M76A 4Z0PA 3O8QB 3RASA 1P1KA 4QFDA 3ZI0A 1WW8A 1RYDA 4A03A 5JDIC 1PX0A 3GQVA 3VZRA 3W8DA 1LSSA 4CLRB 2BI8A 1TLTA 3KYDA 3KZVA 3U0BA 1KEWA 4IJVA 4O5OA 4OGWA 3WGTA 1YQXA 1NQOA 4MINA 5KKCA 4ND2A 3JV7A 4YB8A 2I99A 2RCYA 1V3VA 3U09A 1PQPA 1DIAA 2D1YA 3C1AA 4CLOA 1NBOA 3EDMA 1W4ZA 5A1TA 3RBVA 3G1UA 2B4RO 3L6OO 2C0CA 3VH4A 3FSRA 1PJBA 3B70A 1J5PA 3RJ5A 4E4YA 1VC2A 4FFPA 3SLKA 5I7FA 2W8ZA 1RM0A 4AJPA 3KXDA 4I08A 4B4UA 3UGKA 3O8QA 1XIVA 5BNFA 5KJ6A 4ZQHA 4BUCA 2NUAA 3BMCA 4GX0A 3H9QA 5T57A 2DBZA 5JPIA 3MWDB 3BMOA 1JVSA 5B1YA 1PGOA 3TZKA 4MVJP 2DKNA 3HSKA 4HFMA 1ADFA 3WYEA 3GNTA 1P1JA 1MV8A 4DL9A 2DUWA 1I2ZA 3WGIA 2VHXA 4DQXA 2HMTA 2O48X 4BNKA 1A72A 3LT0A 3WYCA 4B4VA 1DBVO 2AE2A 3ANMA 5DT9A 3TZ6A 2AG8A 1LQUA 2PGJA 4EGFA 3QSGA 4YRDA 4YAIA 4Z9FA 5GZ3A 1DEHA 1W0CA 3PFWO 4Q39A 4AJ4A 1UP7A 4FD3A 1PS8A 2JCVA 3JQFC 1XQ1A 3FWZA 1ID1A 1C0KA 3JQ8A 1WLYA 3ZGYA 3FNHA 4JXKA 3RFXA 3TDKA 4AJHA 3KVOA 1HDCA 1EK6A 1O6ZA 1X14A 1GAEO 1XYGA 4JJIA 2J5RA 4N54A 3VPFA 2VYNA 3JQDA 3WSWA 1ZIDA 3I9KA 1LDMA 2H5LA 5H81A 2Y1CA 2PH5A 1GU7A 1N5DA 2PY6A 4I5FA 3F1KA 1SCUA 4KWIA 1H6CA 1PSDA 1YVEI 4IIUA 3BMNA 2AHRA 3LLVA 4XDZA 1H93A 3GEMA 3IOYA 3JQGA 4OMUA 4II2A 4Z3DA 4LISA 1A71A 2R2GA 2GD1O 2F1KA 2E37A 5FI5A 1KOLA 1NQ5A 3NEPX 4P4NA 1BXGB 3GZ4A 2I76A 5HRUA 3JD0A 1J49A 3ONDA 4OHUA 2JL1A 3KHUA 3JQAA 5JC1A 2HSDA 5TJ9A 1NAIA 1HEUA 2VNSA 4RL6A 4BNXA 2GUGA 2EERA 3HN2A 1Y81A 2D3TA 4P4GA 4DC1A 3WGGA 4DXHA 1PJ2A 3F5QA 3IP3A 3DZJA 3I4FA 4YAEA 1SOWA 2WWRA 3AOEC 2IRWA 4I5GA 3OJLA 3I9JA 2C20A 1UAYA 4LSMA 1LBEA 3DBHA 4N5MA 3BXXA 5J23A 1NNUA 3RROA 2D8AA 5AXBA 1KY5A 1DO8A 3E48A 4HV4A 1M75A 3ICCA 4YPOA 4BMNA 1ZZEA 2NTNA 4B4OA 2I5PO 1TVEA 3G17A 4JP2A 3WFJA 4DWVA 4XJTA 3PDUA 2ZB7A 3W6ZA 2Y99A 3ABIA 3TZHA 1LLUA 1QYCA 4FFMA 1Y5MA 1PR3A 1E3SA 3I1JA 4Z0TA 4D3FA 1JKIA 1WAMA 5H83A 4Z9XA 4CMHA 1NAHA 2Y1OA 2D4AA 4ZICA 2JJYA 3EC7A 4A26A 1H0KA 3SLGA 1FK8A 2H63A 1ARZA 1WDKA 1L1FA 5CAEA 1XCBA 2J3HA 2W98A 3JQEA 4PG6A 1HLPA 4OSOA 4TRRA 4GMGA 1E77A 3IKVA 2YV3A 3QRWA 5EERA 3GFBA 4UVGA 3ZWPA 3NTRA 4F45A 3PFFA 2Q99A 1T25A 3DXFA 4U0KA 4J1SA 4TKLA 2DT5A 4IQGA 3ZNNA 1BXZA 1ZXBA 3OP4A 1BWSA 3W4IA 3GRPA 4O63O 3JYOA 2VTEA 4NDNE 4AJOA 1ADBA 4MVJA 2BI7A 3AFNA 1GCUA 1P1RA 4XGNA 2NVUB 5KTKA 1WZIA 4J91A 2XXBA 2AQ8A 3DB2A 5KJ1A 4CL8A 3IDSA 3VZSA 3ANNA 1Q7CA 1YOVA 1R0KA 4ALKA 4PFJA 4IZIA 3LLSA 1E7SA 1E7WA 4NNJA 1QRRA 2PV7A 2YHIB 3WNQA 2W2LA 4E5NA 3ROKA 1NVGA 1O9BA 4RJTA 2BGMA 1MX3A 3I3OA 4ID9A 4UUMA 4RVDA 4WEQA 1YH3A 5IF3A 1YS4A 1BGVA 4BNJA 3H9JA 4R1NA 1SC6A 2B35A 4M49A 1LLCA 3JD3A 1R4MB 3AI2A 1IPEA 4DA9A 1AHIA 4GKVA 1SB8A 1NVTA 5DN9A 4M89A 2VWPA 3GVXA 3PHIA 5IAAA 1TT7A 2VWHA 4OL9A 4P4LA 6ADHA 3VTZA 3PQDA 1BXKA 4EUEA 4MP8A 1U5CA 4QXMA 5BSHA 4CM1A 3A4VA 2ZTMA 4ROSA 1ISMA 2PZLA 4IDBA 1NASA 4OSPA 1CEQA 3ZCXA 3VC7A 4EJ0A 2C29D 3C8MA 3W4KA 3WLEA 3D5TA 2FHSA 3PI7A 4PVCA 3GGOA 5JAQA 1DAOA 1ZH8A 1ZSVA 4FN4A 4PG4A 5KIAA 3R1IA 1T4BA 2VOJA 2NVBA 4YJHA 3GVPA 3E9QA 3S1LA 2I3AA 3AK4A 4GX2A 4I9UA 4DREA 1WNTA 2ZTVA 1BVUA 4KZPA 2Q45A 2DVMA 4WJZA 3WSVA 1ENZA 4IQ0A 5FF9A 4IGEA 3KSZO 4GVLA 5EQFA 1YB1A 3PRJA 4I9HA 4CMAA 2DTEA 3V2HA 3LT2A 1U3WA 1ZCJA 3IL2A 3HQ4O 2XOXA 4JJGA 1HYEA 1I32A 1LSOA 1ZUD1 3OH8A 3QWIA 1R6DA 1DIHA 3B6ZA 4PLTA 3RVDA 5CEEA 3ZWMA 4ZQEA 5I7SA 3OM9A 2DBVO 1SEPA 3OHSX 3VKVA 4TWRA 3SX2A 5COQA 2C07A 3D64A 4RF3A 4BNFA 3D3WA 4BS9A 4EUHA 3HB4X 4Y6SA 2ZKLA 1ZJYA 3H8VA 1ZEMA 1HKUA 4MO2A 4GKBA 3N7UA 3F46A 2DC1A 4AJJA 1TI7A 2QYTA 4BKQA 1D7OA 3WWZA 4PLZA 1H9BA 3V1UA 4R41A 2PK3A 4LRTB 2OXIA 1LUAA 3AUAA 2PKQO 4NBTA 4HKTA 1Z7BA 4CM7A 1P33A 5L3ZA 3D3WB 4NBWA 3V2GA 1HWYA 3DWFA 1EBFA 1CQIA 4MKXA 2X8LA 5L40A 3Q0EA 1B3RA 2VRCD 3GNSA 4IDEA 1NQAO 1VLLA 2NTJA 2A9FA 1DFHA 1K2WA 3IIEA 1V0JA 3RI3A 4FJ2A 4E31A 1GADO 2P4HX 3T7CA 2GPTA 2NM0A 5TS3A 4BMSA 2WSBA 2GN4A 3KSDO 4GQAA 3GY0A 1RJWA 1KVSA 4M55A 4A27A 3H5NA 2ZATA 1H9AA 1DHTA 3LDHA 1GY8A 4RCVA 5KNLA 3ZWOA 3LC7O 2UVDA 1N1EA 4XYMA 2NVUA 1ZK4A 1IZ0A 4HFNA 1RM3A 4GWKA 3OIDA 5IXYA 2B69A 3UCXA 4BB5A 4YTEA 4BGIA 3OEYA 4JBGA 3MOIA 2J3IA 4L74A 2DBQA 3ONEA 1SNYA 1ONNA 2YV1A 2OUIA 3PQEA 2AA3A 1E3JA 5I7EA 3AU9A 4PLGA 2P91A 2CD9A 1B3BA 1KS9A 3ZDFA 1V35A 4FCCA 3W1VA 2PLAA 3GMDA 3JQAB 4ZRMA 1ISIA 4IJWA 2NU7A 4F3YA 1F8FA 3DMTA 1R12A 2Y0EA 1KBZA 1PGPA 5CPBA 3S2GA 2B83A 1DC4A 3QA9A 1K3TA 1ISJA 1M67A 1RKXA 2HMWA 3BTVA 3GK3A 3I9OA 3ZNQA 5K0ZA 1UXKA 4FGWA 1Y6JA 5TRTA 3VKUA 4F6CA 1KVQA 4LSWA 3JQFA 1SAYA 1V8BA 4QTZA 3EY4A 4NJMB 4LCEA 2YY7A 2C54A 4TZKA 3ZWBA 3SVTA 2Q3EA 1V6AA 3AW9A 1UJMA 3T4EA 4Q3DA 5JAMA 5DP2A 1UZNA 2RH8A 1J4AA 1Y8QA 4EITA 1XU9A 3JYQA 2AE1A 2NNLD 2NQ8A 5HA5A 3SXPA 2BMAA 4BNGA 4XR4A 2JHFA 3DTTA 2OORA 3HJAA 4CLHA 4E3ZA 1TT5B 4BNHA 1HSOA 4H3VA 2HMVA 1BXGA 2O4UX 4R01A 2P68A 4BNNA 1X13A 5F1OA 3DBHB 3AOGA 4P38A 1DFIA 3UKOA 1UUFA 2C5AA 3CZRA 3EMKA 5T8KC 3TZCA 4R51A 3WDSA 5JCXA 3HFGA 4BKRA 4FQ8A 1H94A 1GUYA 2C59A 3P5SA 3GHYA 2QZZA 4ZQFA 4ALMA 3NKLA 4HBGA 2EG9A 4J90A 4BB6A 2OL4A 3S8MA 1NHWA 1YDWA 3UOGA 1DOHA 4YQYA 1KIFA 4RORA 4IDAA 4RVHA 3ZZNA 4A2CA 5KJFA 3T7EA 1HZJA 4E6PA 1N92A 3UCEA 1YJQA 1JKFA 2Q50A 1SBYA 2CZCA 3ZN2A 4CLXA 1HZZA 2WDZA 3OJFA 4XJSA 3E1KA 4YRBA 5A06A 2POQX 4YT5A 3NDJA 2FPPA 1EVYA 1NFRA 3UW3A 1Y5RA 3KO8A 3BTUA 3QWBA 4J3FA 3K2BA 2CY0A 2P9EA 3EGOA 3JD4A 3PHGA 4XQ9A 5EMHA 2DQ4A 1U7TA 2X4GA 4YA6A 4ND4A 3PEFA 3EK2A 3PLNA 2EHDA 1YOVB 4RF5A 4YDRA 5ER6A 3WBBA 1OI7A 2ET6A 4PLPA 3DC2A 4HP8A 5A3VA 3WQSB 3CKYA 2WEKA 4YAKA 3MWEB 1KVRA 5AYVA 4CMIA 5C37A 1PJQA 4JNKA 5A04A 4GGPA 4BNLA 1RPNA 2LDXA 4D46A 3L6EA 2VNAA 4WNCA 4MKRA 4URFA 4L0QA 1KC3A 4XKJA 4JQCA 3WGQA 4O1MA 3WNVA 5A03A 4DIOA 4E5KA 3PZBA 1GYRA 1KEUA 2I6TA 1BW9B 4J7XA 4WASA 2OFPA 5TQVA 2O2SA 1ML3A 3G3EA 3HDQA 4IUYA 4I1IA 4D7AA 3IJRA 2WE8A 3RJ9A 3WXBA 3L4BA 4BV9A 3GVIA 4CQMD 4XD2A 3N74A 2DBRA 3U5TA 2QRKA 1GZ3A 4OOEA 4E30A 4BO5A 2DFDA 3JQ9A 2CVQA 3LSYA 2CF5A 4RDHA 3DBLB 5ITWA 4XZ3A 1YJ8A 2OGUA 5JE8A 4E5YA 3KB6A 5A02A 1ISGA 4TRMA 1HYHA 2OMEA 3PZRA 3Q9NA 3HDYA 1X0XA 3HB5X 1UP6A 3ANLA 4F46A 1PL8A 4IBOA 4UEKA 1NXQA 4I9NA 2EJVA 5AXCA 3CIFA 2CDBA 4RPGA 4RO0A 4Y67A 3JYPA 3INRA 5EESA 1EFKA 2EGGA 2PWZA 4YJGA 3FR7A 3QJ5A 5A5EA 3A9WA 3PIIA 4RDIA 3HG7A 4ALIA 5L95A 1Q7GA 4H16A 3EHEA 1E92A 1ISFA 1OC4A 3AJRA 4J9UE 3VDRA 3WGOA 5C7IO 3KYCA 5T64A 2Y66A 2VUSA 2DPHA 2C7VA 3NGLA 2P9CA 3P19A 1EVJA 4XIYA 3WGZA 1YBAA 1C3VA 1NWHA 3GG2A 4BO7A 5JMWA 4IDCA 3C7AA 2RH4A 4GMFA 1AXEA 4BO8A 1H6AA 3AWDA 3GG9A 1VJ1A 1LDEA 1ONPA 3PP8A 1UAGA 2Q1SA 4FOSA 2ZYGA 3DOOA 3R0IA 5TC4A 1Q0HA 2AQHA 1WDMA 4CM8A 1HDOA 7MDHA 3C7DB 2NU8A 3U4CA 2I65A 1RYEA 2WE7A 4DIBA 3BHMA 1P0CA 5CEFA 4IJKA 2VTDA 1BDMA 1DLIA 2Q1TA 1U1IA 5AXDA 1PEDA 3UAGA 3BMOB 2HUNA 3OEWA 4FIZA 4OM8A 3U49A 5ILOA 1QXSA 5B4VA 3GN1A 4XCVA 1PJ3A 3U4DA 3C1OA 3LVFO 5A3JA 2EKPA 1YL5A 2FSVA 4I8XA 1DJQA 4IGFA 3SJUA 2ZCVA 2B4TO 5FYDA 1NTOA 2Z5LA 5JY6A 4Q9NA 1IOLA 1JAYA 3PK0A 1IY8A 4LCJA 4PIVA 5C3MA 4Q3BA 3GDFA 3IMFA 1Y8RB 1DSSG 5F5LA 4NR0A 3L0DA 4CV1A 4B7CA 3DBLA 4DBZA 5T5QA 3BIOA 2YV2A 4FJ1A 1DC6A 2GDZA 2PR2A 4MPDA 4RQUA 3TZQA 2B5VA 4D43A 1Z73A 3I52A 4L76A 4NMHA 1W8DA 4L8VA 4BO4A 3I9MA 4C7JA 1GCOA 3KYDB 4NFSA 2EP5A 1JKJA 3ZWCA 1GFSA 1QV6A 4FJ0A 2YZ7A 3FBGA 2IXBA 3EZYA 2BLLA 4DIFA 3PWKA 5I7VA 1FMCA 1M6WA 2YFHA 2QRLA 3GF4A 4LVUA 5JBIA 5K6AA 2GYYA 2H6EA 1K6IA 2HU2A 3JQBA 1K5HA 3GA0A 1GD1O 4MVJI 2IZ0A 4RVUA 4E12A 1LRLA 2GZ3A 3ZU5A 1WMBA 2UYYA 4BNUA 3E9MA 5JSFA 1E1MA 2J8ZA 3GAZA 1UDCA 4J1QA 1UR5A 4OH1A 4B4WA 2V6MA 4LMRA 3WIEA 5TLSA 2B37A 4IMPA 3RC1A 4EDFA 2PGLA 5IFLA 1PJSA 1B8PA 3GMSA 2SCUA 1ZFNA 4HFRA 3WWYA 3G1TA 3F3SA 5L53A 3G49A 5KVCA 3A28A 1T2CA 4K1LA 2JFFA 3UFXA 3IJPA 1DIBA 3DZKA 4BNVA 3K73O 1PL6A 2X0IA 3EVTA 4IXWA 5G0TA 5FFFA 4NIMA 2VZ9A 3O9ZA 1TEHA 3GOHA 5A9SB 3SC4A 1ZSNA 3LF2A 1XU7A 2IDZA 4NBRA 4Q3CA 2YUTA 3ONFA 4Y6PA 3ON5A 4GH5A 4NBVA 2OOSA 3IQDB 4FFRA 4G65A 3ADOA 4FC6A 4J6FA 4DMLA 2NVWA 4FW8A 4II3A 3ZHXA 5A4DA 1YKFA 5EJ2A 4UVDA 4JP3A 1NWCA 5TNXA 1F17A 3QY9A 1LI4A 1KVUA 2R6JA 5CHEA 1P1IA 1D4FA 3ASVA 5CG2A 2AEMA 3BMQA 4GSLA 5JNLA 2UV8A 5B4TA 1PZHA 5EQDA 2FSSA 5I9LA 5EN4A 2BF7A 5ADHA 2D2IA 4IS2A 4A5OA 5JDIA 2I9PA 1YRLA 1PGNA 2ZJ1A 4NPCA 4MDHA 2VHZA 3UVEA 3OICA 1PS9A 2G1UA 4L75A 4HADA 5LDHA 3NX4A 4YT8A 5DNAA 3GDOA 3TF5A 1HYGA 3ZW8A 3RIHA 4UVHA 2W4QA 1RM5A 4BNZA 2G17A 4N5LA 1YB5A 3DHEA 3PHJA 4DYDA 2X9GA 2Q2WA 4UULA 2H9IA 4R69A 4MVJE 4E5MA 1UXIA 2I3GA 5L4NA 3P7MA 1BSVA 1VL0A 3ZU3A 1EEHA 4UUPA 5EPOA 4XA8A 3UF0A 1E6WA 3VOSA 1MP0A 1HE3A 4UEJA 3QVTA 3DDNA 1VE9A 2DFVA 3HFSA 3VZPA 2HK9A 4MP6A 1E3EA 3ZV6A 1LQTA 3WICA 3LT4A 3D0OA 3Q3CA 3K96A 3Q9UA 3JYLA 4BGVA 1HT0A 4QO8A 3OIFA 3RBXA 1U9JA 2NU9A 2BFOA 1DFGA 4J9VA 5JO0A 2PZKA 2HLPA 2C82A 1LLDA 1PGJA 2FR1A 3JTMA 4AJ2A 1C0IA 3S2IA 4JX8A 3G0OA 1FF9A 1A5ZA 1R15A 3ZH2A 4UVEA 3RU7A 4J2HA 1MG5A 1A4IA 4MVJF 3V1YA 3VPGA 3DOJA 5HWSA 4GAEA 3HUDA 2GR9A 4RPKA 2BELA 1XSEA 5KKAA 4YR9A 1Q0LA 2J6IA 3BHIA 1LSJA 3LK7A 4YRAA 4JBHA 1IYZA 1V3TA 3ROPA 4ZN6A 3RKRA 4BGUA 1KEPA 2E4AA 2JHGA 2NTVA 5BT9A 4YVFA 4TRNA 3EZLA 3HZZA 5ER9A 4LK3A 4D41A 3FD8A 4Q3AA 4DRYA 1ENOA 1L7EA 1I3LA 4HNHA 1P9LA 4I5EA 4N18A 4WEOA 2V6FA 5CDGA 3TFQA 3A14A 2FRDA 4WGGA 3ENKA 4GLLA 2I66A 2GO1A 4MVJH 2BRUA 5JLAA 5L45A 1WDLA 3EUWA 5DCYA 5AXAA 1PJ4A 4CM3A 1NP3A 3ENNA 3IP1A 1O8CA 1ENPA 4BNTA 4BNIA 4UUOA 4YEDA 2O7SA 1UDAA 5DULA 4CMCA 1JVBA 1DB3A 1PQWA 3IUPA 4O6VA 4BQRA 2AQIA 2GLXA 1WVGA 3RUAA 4E2ZA 4W9NC 3JCZA 5KJCA 3SEFA 2GGSA 1IUKA 3TFOA 2DAPA 1QMGA 3KYBA 4RF2A 4YJHB 4TVBA 4RQTA 4DQVA 4B3JA 6LDHA 4D0SA 1SO8A 5G0SA 4TRJA 4EI2A 2ZYAA 1BRMA 4WCFC 1VSVA 3CZMA 1K6XA 5T6BA 3COSA 3CTMA 1AN9A 3NT5A 1C0LA 4FR5A 4WCFB 4A73A 5BNTA 3RWBA 3E18A 1JQBA 3O4RA 2G82A 4E5PA 3VVBA 5GY7A 1O5IA 1XQ6A 2O3JA 4XB2A 1F14A 4L9RA 4OAQA 1M66A 1EUZA 3RAJA 4BQPA 3U3XA 2EWMA 1JLLA 1R4NB 2H1SA 4WOKA 3VPHA 3ZV3A 1MC4A 1U3UA 1ZK2A 2FR8A 4WE3A 2RBEA 2PKQP 3AUUA 4HY3A 2FP4A 4E2XA 5JYEA 1U2DA 2C2XA 2IE0A 3KV3O 3PJFA 4DPKA 1FDTA 4XR9A 2Z1MA 4CV3A 4EBFA 5C7LO 4AJLA 5IDQA 2Y1FA 1Y8RA 1HF3A 1GEGA 2D59A 3GPIA 3WJAA 4KMSA 1U3VA 4IDGA 4J16A 4K6CA 1IL0A 3ZHBA 3AM4A 3WB9A 1OZAA 1LX6A 2E6UX 3DL2A 2V6BA 3QW2A 4AJEA 3AY7A 4FC7A 2P9GA 3S2FA 4RZIA 2JKVA 3K2EA 4Q3EA 2WYUA 4L4SA 1ZMOA 2X5KO 4R1TA 4XIJA 3VTFA 3OF2A 3VAZA 2E82A 4DLBA 3QWFA 4P22A 4PRLA 5ILGA 5B37A 2D0IA 3N58A 4DPMA 3AY6A 2QW8A 4DGSA 5JCJD 1P1HA 3JQ8B 4BO2A 1EDZA 1LEHA 3LQFA 1GUFA 3DZHA 5F1PA 1LRJA 1TB4A 3F4LA 3KLMX 3NUGA 4BO1A 2IYPA 1A9ZA 2HKIA 3GRKA 3NYWA 2QHXA 2X0JA 1A27A 3DBVO 4XWYA 5CDSA 4PLWA 4Z6KA 2LDBA 1YQGA 2AW5A 4QO7A 2QQ5A 2NWQA 3FNEA 1MUUA 4RGBA 3WTBA 1EQ2A 4OXNA 3JQ6A 1EDOA 1VRWA 3DAPA 1R16A 4PN3A 5CDYA 1B7GO 2WMDA 4CMKA 1Q0QA 3VH3A 4FFOA 3QWHA 3BTOA 4R1UA 5THQA 4O0LA 1GYQA 4CM6A 2PZMA 3KYCB 3GGGA 1U28A 1Z82A 5JS6A 1NX6A 1G0NA 3K9QO 4IS3A 3RD5A 4CR8A 4WLNA 2PTGA 5L4LA 4M8SA 4ZU3A 1ZEJA 3EW7A 4PG8A 3GHHA 3KUXA 1X1EA 4MIOA 4B8ZA 1YWGO 3NTQA 1M2WA 1U3TA 4MVJG 1LA2A 3FPCA 1I36A 4W6ZA 3S55A 1QLHA 1ONOA 2NLOA 4AVYA 4TROA 4QSMA 3NT4A 3QQPA 3RBZA 4D45A 3JQ9C 1VPDA 2WD8A 1NR7A 5LDGA 1HE5A 3HNPA 1I8TA 1F8GA 3DZIA 4JK3A 4NH4A 1WZEA 5LC1A 3H4VA 4YJDA 1K0UA 4CUJA 5AQ1A 1C1XA 3HDJA 5IZCC 1LC3A 2Q1UA 1S6YA 2ZQYA 3TNLA 1YONA 3DAGA 4PG7A 1QKIA 1E3IA 2HMSA 5DCUA 3STHA 1ZK1A 5IG2A 3V1TC 4JGBA 5JCJA 4J1NA 5CDTA 3L4SO 1PU2A 1E7MA 3I6IA 3W8FA 1DC3A 3FCOA 1TA4A 4J4BA 2A4KA 3DBRA 5JDCA 3GDGA 1DC5A 2EJWA 2CNBA 1F12A 2GRAA 2ILTA 5IDXA 3MJ4A 2X5OA 5U9CA 1CJCA 2JFHA 3GT0A 1H6BA 4Z3KA 2JFGA 1U8XX 3U9LA 2X7HA 3CH6A 4MIEA 1T2AA 4MJLA 1T24A 3ITKA 2FWMX 1QR6A 3PQFA 3F5SA 5KCZA 1EVIA 4YYZA 1F0YA 1MGOA 3P2OA 2CVZA 3TOXA 2WTBA 2Y1GA 4WUVA 4GX5A 2VYND 1IULA 1GR0A 2VWQA 2C7GA 3H9UA 4DMMA 3E8XA 1OOEA 1SPXA 2HJSA 2DTXA 2FZEA 2FY8A 1HDYA 1E3WA 3INGA 3QWAA 1N7GA 3LF1A 1LRKA 3E9NA 3MCVA 2JD1A 1GV0A 3WG9A 4B3HA 4CUKA 5AVOA 4DC0A 1ZK3A 1FXSA 1VSUA 2EF1A 4LVCA 4IMRA 4CM9D 3VPSA 3AU8A 5B12A 1XGKA 3EVNA 1DHRA 3JQ7B 3LZ6A 4IQ8A 4IY1A 4YJFB 4J43A 4EEZA 4PVDA 3GEDA 3VH2A 2JD0A 3WTCA 5IDWA 4NK4A 4M87A 2PNFA 1T1RA 3OJEA 4GL4A 3GLQA 2AEJA 2B5WA 3JQGB 4RVSA 4ZQBA 1DXYA 2ZB3A 1Z7EA 1CQJA 4OKNA 3LT1A 3QVWA 3WGHA 5L51A 1I3KA 3VH1A 4CM4B 4LN1A 3GVHA 4UAGA 4BKPA 4NFHA 1EUDA 4H15A 3MJCA 3WBFA 4WCDA 1P0FA 3FR8A 5COAA 2OO5A 1XHLA 2F00A 3E5MA 4KWHA 4U0JA 1EE2A 2W2LD 3RUEA 3ZWYA 1DPGA 1PQUA 1ZW1A 3QE3A 1I3NA 4LGVA 3KTDA 1EBUA 5IJZA 1YO6A 4XRRA 2ZTUA 2NADA 4CMEA 1UP4A 3CMCO 4W7HA 2VUTA 1KVTA 1H2BA 2G76A 2XAAA 1U4SA 4UREA 4XRGA 4RF4A 1GZ6A 4QT0A 3MJEA 2PD4A 3DBRB 2CDCA 5HS6A 4CLRA 4HX5A 2YQ5A 4HXYA 2YHUA 2AG5A 2O3UA 3SJ7A 4MVJD 5A9RA 1YL6A 1LTHR 1N2SA 2WD7A 1IPFA 1B2LA 4ZRNA 3DFZA 3WMXA 4LMPA 4BNMA 5KWEA 4NJOA 3IC5A 1FJHA 3NT2A 3ROQA 4HNGA 5JYDA 3K6JA 3PWZA 3D1LA 2HDHA 5G0UA 1UXJA 2IZZA 2VHVA 3NAQA 5FI3A 4INAA 3ITDA 2Q49A 5GZ1A 2Y05A 1VM6A 2Y67A 2O3TA 5KJEA 4R16A 2YYYA 1HE2A 5CPFA 1E7RA 2VN8A 3MZ0A 1PZFA 3RFVA 4D3SA 3IUSA 5L4SA 1GUZA 2CVOA 2B4QA 2CDAA 2Y1DA 3RQSA 3GPDG 1E3WB 4OYRA 1O95A 4J49A 3NTOA 1A7KA 4MVJM 5A9TA 1B0AA 4CLEA 3I9NA 2BGLA 5EL0A 3V2UA 1BHSA 2X58A 3MTGA 3PJDA 1Q7BA 2GCGA 1HTBA 4TZTA 1QYXA 3GNQA 4FGSA 3DMTC 4HUJA 1T2DA 5COBA 3CE6A 2NACA 3RU9A 2X86A 1LDNA 4QEDA 4WKGA 1V3UA 1WXDA 2G0TA 3NRCA 1YQDA 2Z1NA 1F06A 2OHXA 5DBIA 5A05A 3FBTA 3DHNA 4XYGA 1X7HA 1L7DA 1PJCA 2VYVD 2Q2VA 2BGKA 3X2EA 1VJ0A 1JW9B 3FN4A 2HQ1A 4OQZA 1ZSYA 3OA2A 4R9SA 3F1LA 5G0VA 2VHWA 1UH5A 2A94A 3M2PA 4MP3A 3BHJA 2ZTLA 3HE3A 4QFCA 3W6UA 4IINA 2W2KB 5JY1A 4FSHA 1YXMA 1VI2A 4FS3A 2J3KA 4WK6A 3VHRA 1HETA 1GQYA 1HE4A 3OMLA 3WGYA 3PJEA 2UUPA 2IXAA 2Q46A 3F6YA 4BMVA 5IZCA 3C24A 1ZMTA 5GZ6A 4ALNA 1B15A 1MG0A 3FNGA 4GGOA 4IIVA 4R3WA 4W4TA 1YDEA 4GSKA 3UN1A 1A7AA 3K8ZA 3L9XA 1P77A 2GERA 1ADCA 5T67A 1N9GB 3UH1A 1XKQA 1I5RA 1LLQA 2IEBA 1K6JA 1E7YA 5JC8A 2O2YA 1JU9A 5ES3A 1AXGA 1J6UA 3B1KA 1X15A 3FHLA 2P2SA 4JN6B 4PLHA 1LC0A 4XX0A 3D7LA 3M1AA 1PR9A 3LU1A 4A0SA 3RC2A 3R3JA 1FDUA 3HDHA 4CQMA 2EW8A 5IXSA 5JW6A 3WJ7A 2FMUA 3DAFA 1WP4A 4KOAA 4CM5A 1CYDA 3BA1A 4YBZA 3X2FA 3PHLA 2DUUA 1Q2XA 4HFJA 3UUWA 5HM8A 2VZ0A 2GN8A 2Q4BA 1P3DA 4AJIA 4ALLA 4CL3A 4XYBA 1OC2A 1O94A 2HRBA 2VCYA 1CETA 4GX1A 4BGEA 3ZU4A 2Q1WA 3WQRA 1E3LA 3AUSA 1Y9AA 4IM7A 5EIOA 1ISHA 1MC5A 3UHAA 4NU5A 1YB4A 2HO5A 2UDPA 4YQZA 1J0XO 2BD0A 2CSUA 1EZ4A 3PWSA 3JYNA 5F3RA 2V7PA 2VOEA 3EAGA 3NJ4A 3ETGA 4RPJA 4J2OA 5I9MA 4BKOA 2CUKA 4DUPA 1OFGA 2PKRA 1PJTA 2GN6A 2RHRA 1GYPA 1FDSA 3WFIA 3TL3A 3QIVA 3H7AA 3WLFA 3GR6A 1RM4A 3B1FA 3NDIA 5AOVA 4CLOB 3PYLA 3A06A 4H7PA 4M54A 5DP1A 3TJRA 2WM3A 4U7WA 4UVIA 2X22A 2VYVA 3ZU2A 4CLDA 2EW2A 5GMOA 4X54A 2X9VA 1BG6A 3AY3A 5TX7A 1IHXA 5G2OA 1T26A 9LDBA 3OFSA 2ZB8A 1LJ8A 3DR3A 4M86A 1YE3A 2C2YA 3L6DA 4PZDA 2HCTA 3ETEA 4XYLA 4XDYA 1X7GA 1E1KA 1AE1A 2OP0A 3PTZA 1QSGA 4R9RA 4DPLA 3GVCA 4GWGA 2TMGA 7ADHA 2JAPA 5EINA 1D1SA 1XELA 1U7HA 2XXJA 2J5KA 4Y9DA 4OIMA 3BMQB 4NHEA 1PZGA 3O26A 3TOZA 1KYQA 5G0WA 2VZ8A 1P44A 3GUCA 4NU6A 1ZVMA 2E48A 2YJZA 1Z45A 2FPGA 1E0DA 3PJGA 1HXHA 3OQ1A 3QVOA 3FWNA 1IZ9A 3JD1A 4XQEA 1CERA 1LU9A 3ZNOA 3TL2A 4B7UA 1P1FA 3RC9A 1YL7A 1G0OA 2DM6A 4GVXA 3OECA 4WNIA 5KOIA 2YW9A 1W6UA 3PGJA 5TSDA 4AICA 4B7XA 1R0SA 4LRSB 1CF2O 5JFOA 2B36A 4GBJA 4I5DA 2NSDA 1XWFA 2FR0A 2WYVA 2RHCA 4C4OA 3FTPA 4JLWA 1C1DB 3LC2O 2BFPA 1B8VA 1GPDG 2Y68A 1HLDA 4E2WA 4R54A 4UUNA 1NHGA 3KM0A 4J7UA 4OXYA 4WECA 1GTMA 4PG5A 1QYVA 4BOYA 1WMAA 1ZJZA 1E6UA 4KDEA 4IDDA 3ZHZA 4CM4A 4BIIA 3KETA 5G4LA 3DTYA 5BSEA 2VT2A 3QVSA 4W82A 2AXQA 1SMKA 1BW9A 5T8KA 3ZW9A 1KC1A 3UICA 1I10A 4QX6A 1EFLA 1N1GA 2QX7A 3H5AA 4KTTE 3H5RA 4AJKA 2W2KA 2B0JA 5JO9A 4CR6A 3H2ZA 4KTVE 3RUFA 1C0PA 2QZ9A 4JCOA 3VZQA 4OJNA 1TXGA 3FF4A 3K5PA 1A9YA 4C7KA 3RUCA 4KP7A 2QRJA 2DTDA 2QG4A 5IDYA 4CPDA 4ND3A 3RUHA 4J4HA 3H2SA 3B1JA 3AM3A 1KY4A 4OO3A 3OETA 4FPXA 3TPCA 1H2HA 2X0RA 4KUHA 4ONEA 3C85A 3OQ6A 4QECA 1MB4A 3PLRA 1CRWG 4RVFA 4YCAA 1AHHA 2E49A 4L73A 4W7IA 3WIDA 5A9SA 3D4PA 3WYBA 5BSFA 5HTOA 3DMYA 1HDXA 4ZHSA 4DLAA 5F1KA 2O3RA 4Z9YA 5JAZA 3SBOA 3BYZA 1T4DA 3S2EA 1PGQA 3D5QA 1CDOA 4KUEA 1KETA 4BNWA 2JAHA 1UZLA 3I9LA 4QUKA 3AM5A 4YT4A 3LC1O 1GQ2A 4DYVA 3F47A 1I30A 3E5RA 4PRKA 5L9AA 1D1TA 1N7HA 5DBGA 1IHYA 4PLVA 4BV8A 1Z74A 1ZNQO 2UAGA 3OSUA 1CIVA 4NG5A 3NDRA 3I4CA 4JROA 5DBFA 2X9NA 5G4KB 4D79A 5KVSA 3UXYA 4NI5A 3JQ7A 4F6LA 3KRTA 2O23A 1QP8A 2VRCA 2YQ4A 3O03A 1XLTA 4CODB 2JD2A 4QQRA 3OA0A 3HHPA 4ZA2A 4B3IA 2O4CA 1ENYA 2CF6A 1A4UA 3WX0A 3H65A 4J7CA 3U4HA 4WLOA 4XEHA 1DIRA 5ITVA 1NPTO 3AOEA 2J5QA 4Y6RA 4EZBA 3BMNB 1GPJA 3IAHA 5THKA 3JQBC 1AUPA 3DOCA 4YJFA 3PVZA 2R00A 3H9GA 2Y93A 3MJTA 2D5CA 1HDRA 1HDZA 4U6QA 2GNAA 3HWRA 2W90A 2VUUA 1R37A 2BH9A 1U4OA 4ND1A 3TN7A 3WR5A 2Y0DA 1MXHA 2IYOA 4B79A 3Q2IA 1NR1A 2PH3A 1C1DA 1X1TA 4FB5A 5JMPA 2JCYA 3I23A 3M6IA 4D42A 2EXXA 4S1VA 3TQHA 1PWXA 1I2BA 1S7CA 2AEFA 4NJMA 2GASA 1JA9A 4RLSA 4BL5A 1X0VA 3KLPX 2OBYA 3LYLA 3M1LA 3OQBA 1H5QA 3PPIA 2BKAA 3MTJA 3GZNB 1NFQA 4K28A 1MLDA 4CMGA 4EW6A 3CINA 1QLJA 4R4JA 4RLHA 5MGBA 4JBIA 2Q2QA 3FRJA 3F4BA 3ZWNA 4P8RA 4ND5A 2YDYA 3FI9A 4CR7A 2GZ2A 2P5YA 3UCFA 1FDVA 1I33A 2EGHA 2O50A 2OBNA 3WOHA 3L77A 1BVRA 1VKOA 1DRWA 3PIDA 3E6AA 4GI2A 1MA0A 4W9NA 4WLFA 4NZ9A 1PIWA 3OIGA 2GF2A 4G81A 4KQXA 1PWZA 3BMCB 4IPTA 4HWKA 3KEOA 2I67A 3GGPA 3CUKA 4TMFA 2X6TA 4BO3A 4KDFA 3ULKA 4RZHA 3WS7A 1GDHA 5HBRA 3D4NA 1Y9EA 3DONA 4LW8A 3R6DA 1XEAA 1B14A 1DAPA 1R0LA 3DQPA 2TMDA 3MJSA 4GLOA 4KUGA 2WJPA 4YJGB 3TSCA 3WQQA 5CP8A 5BQFA 1GV1A 3E82A 1MFZA 1JWAB 2ZIZA 3Q6IA 3SC6A 3F9IA 1ZXLA 2X23A 3W8EA 3H3FA 4Y98A 1G6KA 2VRBA 2CMDA 1VL6A 2ZB4A
chains in the Genus database with same CATH superfamily
2IS2A 1EXWA 1KO4A 2WI8A 3BJIC 1FFAA 4BXOB 2VYQA 1SC1A 1JLLB 5HHTA 3RW9A 4L4XA 1I2CA 2OHHA 1KDTA 1WXEA 3DUFB 3FNFA 3TSAA 3ZD6A 3D59A 2YWGA 2P5UA 1K8XB 1ZM4A 4P9NA 4KO1S 3ZKWB 4ZYVA 4MICA 3BG5A 1TOAA 1JFRA 1WF3A 5SICE 1IM2A 2GVDC 2Q27A 4A7PA 2WSLA 3FDJA 4FILA 1Z5NA 1Z2OX 2K7ZA 5F9FA 4RUKA 1YB6A 4Q1EA 2DF8A 3RSFA 1QHEA 4NY1A 2IODA 1Z37A 4BBJA 1CUZA 1S2NA 3Q8XB 4FFLA 4Y2UA 4ZD6A 5K6AC 2IHNA 3IQFA 4LOLA 3UT6A 1XG5A 4MS4B 2DR3A 3K1YA 4Q15A 5C7YA 1KQGA 5DGDA 3TM4A 4POOA 1KI4A 3OIVA 1T2EA 3LCCA 4IXTA 2YIJA 4ON9A 4WLVA 5I5GA 5DM60 3V4PB 4ZVOA 3T5PA 2BGGA 2ZU0C 1T0PA 2VVTA 5HUHA 3RAEC 2QRVB 3L8CA 1K1EA 3ROGA 3PNKA 5FWNA 4IG9A 3RIEA 3KJQA 2BOVA 2V1XA 1UOQA 1EUCA 2IK8A 4U8GA 1FVXA 2F4NA 1H0RA 4OUKX 4RK0A 4W1RA 3N28A 3B1VA 3NHFA 1Y6GA 4D25A 2OC9A 3NHUA 5ITZB 1LI7A 3DR5A 2ZIXA 5FXMA 3RWOA 1ULUA 1PNQA 2Z83A 4CV0A 3EUFA 4Z0HO 3RO7A 2HREA 1Q1NA 5CLGA 1N57A 4C87A 2QJTA 1YS2X 3R20A 4G89A 2WYWA 5AH0A 4Z51A 1G1AA 4LV6A 4P54A 3PUHA 3I2HA 3T9DA 4TT8A 1Y1RA 3EYWA 3PSAA 2HFKA 1Z5GA 1RMQA 1E1LA 1X92A 4EAAA 5B1EA 2PZGA 3MOGA 4MA0A 5CB6A 3N9IA 3DDSA 4TVKA 2IZ5A 3GPBA 2JFZA 3RU2A 1VHTA 4OI0A 4ZGWA 3TJZA 4ESOA 2PD3A 2HU5A 4KN5A 4EFKA 5JXJA 3DPSA 3OT4A 4D3DA 3KE8A 1RVV1 3BJMA 1WP9A 3KYIB 4JC4A 5EAIA 4F38A 5T6MA 2W8BB 4LDQA 1C50A 4MIKA 4LUCA 4OXQA 3ZV5A 4C1BA 5HP4A 1IBMB 1GZ4A 1AG9A 3U3DA 1HSZA 2VP4A 3PDJA 2REOA 2EKQA 3O8OB 4G37A 1Q12A 1Z7YA 1CQPA 4F4UA 1XQXA 3K4PA 1IN8A 2EEZA 4CQLB 3RTCA 3RJMA 1WCV1 1JEJA 4CMIB 3IUNA 1KFBB 1EP1B 1O2DA 2CL5A 3QE2A 1KRXA 3DFKA 2RGWA 3ICQB 3AEYA 3FJ1A 2OORC 5JH7B 4GPD1 4IQFA 3IVXA 5BMVA 2NXJA 2QXUA 3THWB 2XWPA 3IQIX 4U6QA 3FB1A 1U7WA 1K5DA 2EP7A 4KNWA 3T54A 1OT3A 3CF2A 2G5TA 4BVLA 3PGXA 1QG6A 5JEDA 1Y82A 1I4TD 3WMEA 4DF3A 4FLFA 3MN1A 2JB9A 3QYPA 4QARA 4CF5A 1MXFA 1Q50A 2BFAA 2DU8A 2IHKA 2XZDA 3BB1A 4GSYA 4INZA 4KGXA 1JMVA 3RSGA 3TTYA 4DBVO 3LC0A 5CYGA 2IEDA 5EWJB 4PLCA 4R9VA 1IXRC 1HYQA 1PBTA 2ZIWB 3Q7QA 5DV9A 4OKIA 2FA9A 2J30A 3TLKA 2Y4NA 3ET4A 3DP7A 3R5TA 1WD7A 3E05A 3VPXA 2WJVA 4CMEC 4HDKA 3ONWA 1ID8A 1E6EA 5E6UB 1O89A 1XFDA 3I5MA 1M54A 1QV7A 2QTMA 3K0AA 2QPTA 3NO4A 3NWEA 3QP9A 4GUDA 1I4DD 4XQCA 2JLVA 3TNYA 3KKOA 5IN5A 3Q72A 2TRSB 5ALWA 3AP3A 5KYVA 3Q0TA 2R00C 3JWGA 5AM0A 4NAHA 4HRXA 1E0AA 1N8KA 3BFJA 3CXRA 4WDRA 3F9RA 3JAMA 2C5EA 1JN0A 3MPUA 5EPUA 3N2NA 1DWQA 4WOJA 1FNCA 5JJBA 4EL5A 3ISVA 1ZO8A 4QPZA 5TPWB 5CEJA 4JJFA 1PZEA 3GD7A 2ODWA 1FYFA 2P4QA 3PFCA 4DA6A 5KVAA 4G1FA 1DDOA 4MYUA 3UK2A 3ZIAA 2VXCA 1NF9A 1P7VA 3KUKA 4EY5A 4XRGA 3E03A 3ICPA 3EBLA 4D4GA 1WX1A 2BHRA 3TWOA 4DDHA 2F4VB 2YBEA 4OREX 4EG0A 2AQKA 4UQPA 1EP9A 1MFPA 5FJJA 1O0CA 1SVWA 2O8FB 3W0LB 4G1BA 2HDNB 1BMDA 1LSUA 3HADA 4ER3A 5CJPA 1LPPA 4A8PA 3ZQJA 1I3OA 1Q1AA 2FZWA 3VOBA 3Q3IA 4E1VA 2QTTA 2DUNA 2VEOA 1Q0UA 5HUJA 4JC8A 3T4XA 1FVHA 1Z12A 1UPCA 3OBBA 4X44A 5DTMA 5F73A 5FBLB 3KVRA 3WWOA 4F86A 1G6OA 4GVPA 5AVTA 4RZSA 5K8JB 4TMTA 1JZQA 3MMXA 2CFOA 2UUOA 2VJBA 4GMDA 4QXPA 1T2VA 8ADHA 2ZPAA 1JIKA 1LPOA 3A1CA 3QLUA 3ZTTA 4G5QA 4QM7A 1E0KA 3KELA 1NVMB 3A05A 4OK3A 2XCQA 3RYIA 1ZR2A 4MUAA 3VC2A 3DLIA 3GWGA 3B8EA 1WKCA 3UGQA 1C1XB 5BY2A 3AIMA 1KZ1A 1SD1A 2VF2A 1FSGA 1GZDA 3T35A 4IUCS 2ZIVB 2ZULA 3QLJA 2ZAOA 3DT8A 2Z95A 4G5HA 5G4KA 1KFJB 3LP5A 1TKRA 4BKUA 3RYHA 1JWLA 1ZK0A 1BN6A 3WNBA 5HMMA 4BVAA 1EMDA 1NM5A 3QHAA 4OIFA 3TRIA 1D6SA 1H1DA 4IVNA 3PRHA 4ZVNA 1W25A 4MS3A 3RFUA 3QZUA 4F3CA 4LE2A 1HA3A 1XTRA 4Z8XA 2FSHA 3VR6A 4PSDA 4LRYA 2OV8A 2XZLA 3NXSA 1YA4A 4YAGA 3H9EO 5JVDF 4Z53A 4Y2GA 2QN7A 3MJVA 4ZVVA 3R7SA 3B6JA 3ZI7A 2OSVA 3NIDB 2YWCA 5MN5A 1MEEA 3VSBA 5JZMA 1OH5A 4HMOA 3MEQA 1M6EX 5HJ7A 2PM8A 5CTAA 1DCKA 4TV9B 5DM1A 1OAAA 1E9CA 1NNI1 2XPCA 2HEGA 4OOFA 3RCBA 1E9AA 5KTSA 3IT2A 3V7FA 2PRJA 4GNKA 4MWCA 3OZVA 4R6XA 2C7RA 4IJ5A 4BRZA 3K2QA 1E1DA 1ODCA 4MKZA 3GC6A 1GGEA 4TQGA 4D2IA 1HMPA 1O0SA 1KI7A 1XXHB 1K7YA 2B1QA 2Q4TA 3MD9A 3NBAA 4RESA 4DSZA 1E2LA 3DHWC 5F21A 4MV3A 2NU8B 1KJJA 3UJAA 4RFVA 4Q4AA 2Y27A 4X8LA 5IVIA 1PUXA 2GAIA 5FEUA 5K9ZA 1T8TA 3OX2A 2QW0X 1ULZA 1Q84A 1NQWA 2ATVA 3H5LA 3NGXA 1HPLA 2QJRA 1MVOA 1XDWA 2Y0CA 3GN2A 4I8DA 3TR0A 3A4IA 5D51S 5JS1A 4CFZA 1S8NA 1W4RA 1IE3A 2JATA 1IOWA 4KJXA 2IPOA 1VPLA 1VDZA 2FOIA 4IKPA 4REQA 4TYPA 4EEXA 5EHZA 4JYMA 5J47A 1VIMA 2GM4A 4KQ1A 4EJMA 1CS0A 5EP1A 5BUZA 4O25A 3NC1C 3RSHA 2OCAA 3SBDA 4A9AA 1U1FA 2AN5A 3O1IC 2A2ZA 1NYTA 3Q1LA 5AIAA 5DOVA 3ZXXA 4P7KA 4BP9A 1PSWA 4YACA 4ENPA 2F90A 1QP0A 1TTQB 4GP7A 3DZFA 5DK6A 4TYNA 2C4TA 1EVZA 2YJ3A 3LKZA 1W85B 4PSCA 1K66A 1UXGA 1E5LA 1V5FA 3L4BC 4K46A 2K7FA 4K8RB 5F52A 5LZ5A 1RAAA 5FB3A 3VR2A 3RVJA 2NO0A 1NOJA 1LDBA 1UC5B 1JTVA 4B17A 3ZWXA 1N2CE 4G5SA 4M0LA 4I36A 2GN9A 3FYUB 2BFMA 4A0FA 4XX1A 2HWUA 3CW9A 1XMXA 3I8SA 1Y6QA 1J9ZA 1DJNA 1K75A 3A4TA 3TR5A 3CNLA 2BV3A 4MUJA 4EZBA 5KX5A 4M7WA 4Q7JB 1ML4A 2EC5A 2PYIA 4Y0VA 5FR2A 4HAVA 5TQ2A 1M3SA 3KKPA 4PZEA 5FOVA 2AJTA 1O4VA 1QCYA 3R5KA 3M4ZA 1GUDA 4IW3B 4RD0A 3W06A 4C06A 4OLBA 2D5AA 1YR3A 3QKUA 3CPSA 3GBVA 4M1EA 5KC9A 3GFRA 3T5CA 2ZAYA 2E5WA 1OJLA 3INTA 2JIBA 1NUUA 2VT3A 4D4KA 3RSZA 2A33A 5BORA 3P9QA 2BSXA 3S40A 4M9CA 3TL6A 1NW3A 4DQUA 1IEQA 1NLFA 3HCDA 3STXA 1Z2PX 2HIHA 2PVCA 3BJZA 3LI2A 5J5CA 3HXTA 4FM9A 3FMVA 4QBTA 3IMEA 2M1XA 2OCKA 1BX1A 2R60A 1M76A 2IDJA 2O2ZA 2VCHA 3AKCA 2FX2A 3O8QB 1E2KA 3KS9A 5I4CA 5EZYF 5JS7A 2NU6B 1C1YA 4IIYA 3W8DA 3VZRA 3ZWQA 5B7GA 2QVGA 2BI8A 1NVXQ 1MB3A 3CXUA 4HDCA 3VMMA 5FEMA 4IHQA 4CLRB 5C8DA 2ZZNA 2C4UA 3TBHA 2R1ZA 5CYOA 3G85A 4B6RA 5LP6F 4TUYA 3CNNA 3MG9A 4PSUA 4ZI7B 5K5EA 3AVYA 3ETCA 1WKBA 1TMKA 2H0RA 5DCLA 1S4QA 1F6DA 4YB8A 2I99A 1V3VA 4F2HA 4AN0A 1PQPA 4OG2A 1T9DA 4RHEA 4ACAA 3LGSA 2YASA 3C1AA 3QNWA 3B3AA 3NBXX 2IW1A 5BNWA 1VXRA 5HQJA 4B8YA 1W4ZA 4FT4A 1R0RE 4IYJA 3D6NB 3L3BA 3TPZA 2FPRA 4JLOA 1FLDA 3VH4A 4B48A 1XCGB 1PJBA 3RJ5A 1T36B 3HV0A 4HX2A 4XVQA 3W1VA 3UJNA 1QF6A 4N76A 3EGDA 3KXDA 4LQCA 4I08A 4QOIA 2JEYA 2WJ4A 2J3QA 3VR6H 1QTRA 2XUOA 4ZJYA 4N5IX 1GUBA 5B6PA 5ELXA 1ADJA 1RHRA 4FE7A 2CVPA 2QDXA 2DBZA 2QAGA 3F74A 5C8YF 2FX5A 1IBKB 2G1PA 4TYQA 5EOVA 3ERCA 1Y7PA 1PG0A 2HU7A 1E18A 5A4JA 3QBJA 3THYA 1A5SB 2GCNA 1TU4A 4H08A 1VCHA 4MVJP 1EYZA 1IXKA 4HFMA 1RPTA 3GFSA 3O83A 4RFSA 1OXSC 5I51A 2G1JA 3IVAA 5C51B 1MV8A 1O08A 3P9ZA 4R1PA 4DL9A 1HI9A 1M7GA 1I2ZA 1SH7A 2VNIA 4RETA 5IU6A 2RJOA 2VHXA 3WGIA 1I94B 3EXIA 5JWRA 2HMTA 1T3LA 2O48X 4EOGA 3IVMA 3TLEA 1DBVO 2AE2A 5LUBA 5I8PA 3TZ6A 4PAWA 1RRGA 4EGFA 3VVMA 4BC0A 4YAIA 1NQVA 4Z9FA 3K9LA 5GZ3A 4DR7B 1QVRA 1T0IA 2VR1A 2FEOA 3AEQB 1UP7A 4FD3A 1M33A 1VE3A 2B5OA 3T7AA 1KIAA 2AJLI 4MI6A 1FW8A 1Q92A 1XQ1A 2H8KA 2I7VA 3FGNA 4H1TA 3PDCA 2IGBA 3EFHA 4QUEA 4IRUB 3VR5A 5ARBA 5AM3A 2XQGA 4JMLA 3TDKA 1VMIA 3KVOA 1HDCA 1G20B 1C5KA 4MRMB 1PFYA 2IL1A 3SZMA 1VIDA 1X14A 2H5IA 4RY8A 4WFIA 1N34B 2J5RA 5AM1A 1WVIA 4Q01A 3LP6A 4HUQB 1V8OA 1Y80A 1LDMA 3Q9SA 1J09A 1GU7A 1PAUA 3QVLA 4ZVRA 4I5FA 3T7IA 3F1KA 1W34A 3O2QB 3QBTA 5FT9A 2E1RA 1CY8A 2GBLC 1PSDA 1TIBA 3THXA 1N3LA 3AFIA 4IXMA 1U6IA 2CUZA 2JCSA 3QI2A 4IIUA 1QFMA 4KQCA 1JQJC 1OYYA 1JI3A 3G2IA 3WMRA 1F1BA 3NXKA 2BL4A 2AHRA 3IP5A 3PFKA 2EBHX 2F3SA 4IIBA 1H93A 2GOYA 1UKZA 3RF7A 1LW7A 4C6RA 1RBYA 3KHKA 1MX1A 3HKCB 4ZI7F 4II2A 5CM9C 5EJEA 1T9BA 1UXOA 1HTTA 2X13A 2XT0A 3JZFA 4QBFA 4LISA 4CF6A 4BE7B 1R88A 2R2GA 1DNPA 5DLQC 1WNFA 2VS1A 3MGGA 3KQVA 3H05A 2YJ4A 3SR3A 3BWEA 2I76A 5G53C 3OQMA 4F9TA 5IBQA 3JQAA 1R5BA 5J59A 5JV5A 4K0KB 5SV2A 4G5OA 2Q41A 1EXNA 3WJ7A 1N2HA 4LXGA 1J24A 3BOSA 3PX3A 4MUFA 4CYMA 4MKIA 3AHIA 3C48A 2A1UA 4CIWA 1NMSA 3F5QA 4HT3B 5BMOA 1UBUS 3KDAA 5JPDA 4V0QA 5L8VA 3KZXA 4LSMA 1USUA 4JSRA 4QU0A 1KA9H 3THRA 5J23A 1RRCA 4KWTA 3Q3JB 4RCZA 3SZUA 4RKYA 1R0BA 2D8AA 4BMCA 1YBHA 1KY5A 1OLUA 1DO8A 1WA5A 4HGYA 4DSAA 3B1XA 3MSCA 1ZD2P 1M75A 4LZNA 4QOSA 4BMNA 3K9NA 4RD3A 2P7HA 1N2OA 5A4AA 2IYAA 1TUEA 4UQOA 4RL4A 4CDNA 5JH7A 3ZDCA 3DOHA 2C97A 3WFJA 3PNMA 4R81A 4O08A 2O2IA 2XUGA 2ZB7A 3QVKA 2Y99A 3ABIA 5JD4A 1XJCA 2ZWPA 3DKKA 4RXTA 5EMMA 3R3WA 1YIAA 4H0CA 3ESRA 3D7NA 5DNDA 3R75A 1P2BA 2ZUDA 3RRNA 5L3SA 4FINA 2F3PA 1G5PA 2GFIA 2BM0A 2FWJA 3EGXA 1VL5A 3GUHA 1W48A 1S2OA 8GPBA 1DKOA 1KAEA 1MT0A 1FK8A 4IDPA 3WVNA 1ZCFA 1OBVA 1L1FA 1XCBA 2ORED 3AIKA 2E4ZA 4PG6A 1GGVA 4J16C 4OSOA 4TRRA 1E77A 5J2UB 1RHKA 3W5AA 1AKMA 1IN1A 1HM5A 2WWXA 3ES9A 3BWVA 5BWOA 4F45A 4N0QA 2CKDA 2Q5JA 2YYSA 2QX9A 3WAKA 1PFKA 4IIEA 2OV2A 2DHEA 1MR3F 4TKLA 2PX6A 1UM8A 4JP1A 1BXZA 3OP4A 4ZC8A 2D5LA 3RIMA 3JYOA 5BV2P 2CZQA 1QAOA 2NP6A 1QGUB 3EAFA 1Z36A 2BI7A 1GCUA 4JGGA 4MAAA 1P1RA 4XGNA 2NVUB 2IPXA 1VKZA 4HRAA 5KTKA 1P75A 1P60A 4W5OA 2ON6A 3EVCA 3JZDA 3OZDA 1GDTA 3BQMB 5E4YA 3TGWA 2XKBA 3EOZA 3ROZA 3UG6A 4YRJA 1BN7A 4GZMA 4X1OA 4GI1A 3VZSA 4RTRA 3SXJA 2X3UA 3HDTA 5EXDA 2HPAA 1NJ2A 2WW8A 5H7XA 4AZWA 1TTTA 4CT0A 3CRNA 1PYOA 3ICOA 4R3UC 3SZRA 4WERA 5DYIA 2C3OA 3BXHA 2HIGA 2OHGA 3K1JA 3LBNA 4M38A 3ZJ5A 5DI9A 1E66A 4RVDA 4WEQA 1ZN2A 1A97A 2WAYA 3OBIA 5AO9A 4DJ5X 3QIAA 1BGVA 1T3HA 1T1JA 4KQJA 4RYLA 1RQ2A 1W4LA 2BAGA 1JJBA 1S8FA 2V7BA 3H9JA 5DYNA 3USZA 4BZXA 2Q1YA 5JJCA 1M7BA 3GUZA 3DNMA 2ZXFA 1SB8A 1UJCA 1NVTA 5DN9A 3EMBA 1KKUA 5CT5A 3OQNA 3PHIA 5LD2C 3BPSA 4NTZA 1M6VA 2EZ4A 2PQ0A 121PA 1RCFA 3CN9A 3KJHA 6ADHA 3PQDA 1BXKA 4EUEA 5M5BA 4MP8A 1I1QB 5J4VA 2JZCA 1FE8A 4QXMA 3KOWA 3A6ZA 4QPDA 3A4VA 2ADFA 5A0TA 2J3DA 2C2ZA 4O4JB 1Q57A 1P1CA 2A0UA 2FN8A 3ND6A 5D1HA 3RYCB 3CLSC 1FL9A 3I61A 3NEYA 2C42A 1GSIA 5LN1A 3ZCXA 4EJ0A 1KXJA 3C8MA 2WT9A 2YC4C 3CEHA 2MT9A 3GH1A 4KLRA 3BL6A 4XSGA 4Y18A 3PTLA 4OI1A 4BLTA 4EZIA 3HJFA 3KVVA 2JKZA 2Q5HA 3N0TA 3V00A 1BDJA 5CH5A 4PU0A 1H8EA 1PK7A 2ZDQA 4GEKA 1KI9A 5JAQA 4EDHA 2CNKA 3RABA 2NVBA 4KKVA 4NG4A 4YJHA 5E1DA 5F35A 2FDCA 3U4QB 4YCNA 1SU8A 2F64A 1K4MA 2NW6A 3GFVA 2PSSA 3EFBA 4TL8A 4WJZA 4RY2A 1X7YA 2DVMA 2Q45A 1YASA 3JXEA 3QKWA 3I2YX 5KMGB 2QN1A 2Q07A 2P6MA 2X5XA 4LSZA 1N8TA 1I5EA 1JB9A 3LS2A 3O3NB 3N5KA 2MSWA 1YB1A 3QFHA 4I9HA 4YAOA 4HYTA 4QVIA 2DTEA 3NHPA 2Z43A 4V0OA 1JHRA 4RQAA 3PVCA 1ZCJA 3WBJA 2FW7A 4N3BA 4YR7A 1I32A 1NNEA 1FU4A 1LSOA 2UXCB 1CY6A 1A2BA 3CCFA 3OLYA 3D8BA 1DIHA 3RVDA 1TRKA 3ZK9A 4JKOA 3ZWMA 1W59A 4ZQEA 1YB2A 1SOMA 3UWMA 3NETA 3B6EA 3HB1A 3OM9A 4K0RA 2DBVO 2W93A 3SC2A 1W47A 4XE5A 4P53A 2F1IA 4TWRA 2VSQA 3VO1A 5KYUB 1DIOB 3DVSX 4DQKA 4BNFA 3D3WA 4NZPA 1RXVA 2Q29A 3HB4X 4L3OA 4Y6SA 3CF4G 3I0ZA 3C5WP 4XPIB 3H8VA 2OBBA 1WO8A 1HFJA 4W5HA 3NYQA 4Y9RA 2H1HA 1E0SA 4PAGA 3GLIA 5AVZA 1QOZA 3VR1A 3ITEA 2BR5A 3CQ9A 4JODA 2ZUWA 1VLQA 3ELDA 1C7IA 2OKCA 3JWEA 4JHLA 1FU7A 1JE1A 4UNIA 3CHYA 1X80B 5JLJA 3C98A 4PZPA 2W6OA 3AIIA 2I87A 3BHNA 1NSFA 4P7FA 4PLZA 1C9MA 3BKWA 4BGDA 2CWDA 3TTSA 1XPJA 2AFIE 3AUAA 1A8HA 2PKQO 1Y33E 3V32A 4EI9A 1ACLA 1C30B 1GPMA 2ZUCA 3V2GA 1HWYA 2NXEA 4M1TA 4A0RA 1XJQA 1CQIA 4MKXA 1Y34E 4TV9F 2OQRA 2WZDA 3RJTA 4EF6A 3D43A 1JLRA 1DI0A 3H11A 3N70A 5BSKA 3Q0EA 1DV1A 2CE2X 4FCVA 5J4LA 4TTAA 2BKLA 3GNSA 4DDUA 1M34E 3CUSA 4LNHA 2BP7B 1NQAO 4URHA 3PXUA 5DU2A 2NTJA 3GLGE 2A9FA 2W6MA 1V0JA 2QR5A 2XGGA 3H2YA 3WK8A 2ZBQA 4ND8A 4RD4A 4QJ3A 2NM0A 1ZAKA 3OC6A 2VXYA 1IN4A 4GPIB 1Z29A 3KSDO 5TS3A 3K72B 5FOWA 5CH8A 5CW2A 1P3Y1 3ZDZB 5MF6A 4LF9B 1KVSA 2XUAA 2AVDA 1QAMA 2BZSA 3WDMA 2F1OA 2G09A 1FLNA 1G20A 2WINI 5KNLA 1M2OB 1CNFA 1T10A 4FHDA 4IIFA 1M2KA 2A58A 3UXHA 2QMEA 3EJ6A 3SPXA 3OCJA 1EVQA 1TIPA 2ENWA 1IMOA 3OE1A 3RC3A 2C94A 4BX9A 5IK2A 2ZYWX 5KVCA 2V9PA 4B46A 4UQLA 3ZDAA 2EOAA 2J3IA 3EXAA 4U2EA 1GOTA 4UPEA 3KP1A 3KOMA 2WZBA 2A88A 3DHVA 4QICA 4Y1FA 2WKRA 5LFAA 1TX4B 1M2VA 2OUIA 3PQEA 4TKUB 1CUEA 5MGNA 3G5LA 1ZVVA 2PXAA 4B6PA 3EPLA 4AP5A 1QB7A 4PLGA 2ERYA 4R2WA 2P91A 2P8JA 3UC5A 3B82A 2X41A 4IIXA 3EMVA 4MW0A 4UOZA 4DV0B 1L2TA 1P9OA 1W29A 1DEOA 4TUYF 3GMDA 4MVXA 1U0HC 2A1IA 4ZRMA 1F4VA 1N6HA 2BGWA 1QYRA 2WWGA 4KX5A 3DMTA 4LXHA 1R12A 4LJ4A 3OQIB 1XLUA 1DC4A 1Z6XA 3H19A 3E0QA 4M37A 4RWEA 4F71A 1VJCA 1O54A 1V95A 3ZNQA 1HC7A 4Q1CA 1E4OA 1L1EA 1TL7C 4FLEA 1PQYA 4RVCA 1JS1X 5DTRA 2P8SA 4B4KA 2WAOA 4ZOBA 1C8VB 2YN0A 1SAYA 4OGGA 2ZBFA 3EY4A 2XUFA 4D4MA 3GFPA 3I37X 4NJMB 2YY7A 5HIMA 2C54A 3ZWBA 3OFNA 3OQHA 3AW9A 3T4EA 1UJMA 3TNDA 4LYGA 2WTMA 4V39A 3BRQA 4G26A 3EVAA 4DG5A 5JAMA 3N75A 5DP2A 1UZNA 3RGGA 5FFNA 4LBWA 3RIGA 2MMGA 5FJIA 1ZVJA 1XU9A 4LZOA 4EITA 1XRJA 4R8KA 1JG3A 1U2RA 3E3LA 3JW8A 2BMAA 5K3AA 4CQNA 4ERNA 2JHFA 3DTTA 3EIUA 4KV7A 1TM4E 4UDYX 2C0QA 3RHSA 4C0KA 1TT5B 1Q7TA 2AMJA 2DLNA 3O8DA 1JSRA 2HMVA 3N1UA 1CE8B 2PUVA 3L79A 5F1OA 3THYB 5DNYB 2RFLA 4KLCA 4FYIA 5EHQA 2HQOA 2CHQA 2C5AA 2MYNA 3VO8A 5T8KC 3OTWA 2XGOA 1RFLA 2QTBA 1RS0A 2WUGA 3I28A 3R3XA 1H94A 1GUYA 2C59A 2QTWB 1UMDB 2Y4OA 3P5SA 4N7MA 1YTUA 3QKSB 4ALMA 2HLDA 4TKVB 2I4TA 2I1LA 1I1HA 1QH9A 1TVKA 2XODA 2E0IA 3D81A 3OMXA 4BB6A 5FV4A 2JDIA 3IAS6 2QGZA 5FCDA 3RE1A 3T5TA 1NHWA 4MR8B 3EH2A 3U81A 3G68A 4AZTA 4BKMA 1E6KA 2QE7D 4YQYA 3WQBA 1KIFA 2F17A 2Q0HA 1Q0PA 1Z35A 2CK3D 3MTAA 4KXNA 1HZJA 4M1OA 5C5EA 5CA0B 3UCEA 1JKFA 2M6SA 3R3ZA 3F71A 3EXHC 4AYTA 3B3FA 2OD9A 2AFHE 1A98A 3J7TA 3E1KA 3EQZA 3M81A 3PR3A 2IT1A 4BN4A 2XTJA 4HJRA 3GA5A 3ILXA 1QM5A 4X0EA 2FPPA 2WJ6A 4JXJA 4DLNA 4ARBA 4S24A 2Z98A 3MOSA 4DN6A 2MINB 4J3FA 2CY0A 1U81A 2G1KA 3EGOA 4JI6B 3EW9A 2Q0SA 2QMUA 4QHTA 4MEAA 1SKYE 2DQ4A 6NULA 3ZD8A 1QE5A 4RF5A 1JR3D 2CB9A 2GTPA 2ET6A 3FUXA 3JVVA 5L3RA 3T95A 1XD2A 421PA 3QKRB 2BT4A 4Q34A 3DC2A 5A3VA 3WQSB 2F8TA 4PGMA 1I3CA 1VLMA 1Y0BA 1KVRA 4HWOA 3W5VA 3BFKA 1KP3A 2GPNA 1UPTA 4U7PB 4PYJA 2OXCA 2OENG 1JQKA 1CS4C 1M10A 2R68A 4JNKA 4EAQA 3AF2A 1FDOA 1QE0A 4QL3A 5IVHA 2JARA 1RPNA 1J7KA 1L7MA 3L6EA 4BFYA 3EEYA 4MKRA 2XCUA 2RGGA 4UU8A 1KC3A 3IJEB 4Q7KA 3WGQA 3S2SA 3X44A 4QQNA 2V9CA 1WMDA 3RNOA 5KOIA 1B93A 3T0GA 3EULA 3IB6A 4RHCA 2EHJA 2WQ7A 3SLRA 1ODSA 5HKKD 1ZINA 2YFKA 3P9IA 4PCLA 1ZJ4A 4J7XA 1I7DA 3OWHA 4F5DA 2IFTA 4Z4HA 4AMGA 1SCKA 5TQVA 4U3JB 5F7XA 1Y8AA 2FEAA 3U1TA 3HDQA 3VR3A 1FDIA 2CBZA 4I1IA 4IOLA 2WE8A 4AQYB 3R2JA 3HKEA 1CQZA 2DBRA 1JDSA 3U5TA 2ZBVA 5HF9A 2I1WA 3OMWA 3IKJA 5BQOA 3R7NA 4BO5A 5FAKA 3QX3A 2AZ4A 1E2JA 3FPHA 1D6JA 5HX7A 3AV3A 1W5BA 3BFXA 2QG9A 2FMKA 1AMOA 1QV9A 4CEIA 5ITWA 2LVBA 3KKNA 4E5YA 3KB6A 4UMEA 3SEZA 3GJRA 1XD9A 2R5NA 5E4TA 3ABZA 2QLLA 5JANA 1UT5A 1U6JA 4DCJA 3CEPB 2O8BB 3JR3A 3HDYA 1X0XA 3F5DA 1UP6A 2FOXA 4F46A 1PL8A 4IBOA 4Y1EA 4QPNA 3RS8A 1TQHA 3UJCA 3G8BA 4BQFA 2VQ6A 1RXWA 3O3OB 4I9NA 3LBIA 5AXCA 4Y67A 4L8YA 2DOKA 2G06A 3MYRA 4LNUA 4RO0A 3G82C 2EGGA 4KVGA 2FEWB 4MRAA 5AD1A 1XTPA 3S99A 2XTMA 3K70D 3QJ5A 2IF0A 1LS6A 3K9HA 4RDIA 3NP7A 3K35A 5L95A 1P7CA 2MTBA 1Q7GA 3HZOA 1OBOA 3EHEA 3WGOA 1PNVA 2W2VA 1J20A 4J9UE 4RAQA 2V7QA 1Q1BA 2Y66A 4MR7B 1MAWA 4ILEA 2DPHA 1JQDA 3HJHA 1D2RA 4H18A 4OHFA 4TWJA 1L5ZA 1KHTA 4XIYA 3WGZA 1Z6GA 5I3ZA 3WV4A 5FWDA 5JMWA 1C29B 3QBEA 3S5JA 1BH2A 1W36B 2RH4A 4GMFA 1N6KA 3INNA 4TYYA 1U0OC 4KZKA 4OPMA 4RY9A 3B5IA 1O87A 1LDEA 1ONPA 4JCCA 1QIKA 2DQYA 1B0UA 2VZLA 1YMVA 3WLJA 1LBHA 3NC0C 3R0IA 1C3JA 4R40A 1KMNA 3VNSA 3PEYA 2CLMB 4X6XA 4O33A 1WDMA 1IDOA 3ZYCA 4CL2A 2QRMA 1U8AA 4M0PA 3PKIA 1F2DA 3NBQA 1T5LA 2I65A 1LS1A 5DXAA 2BFBA 2IHBA 3N76A 4M9RA 4EKDA 4EYGA 1RI3A 1Q3KA 1P0CA 2H2AA 4PV7A 1WV0A 1F2UB 3ZVMA 1MTOA 2VTDA 3HP7A 4MW5A 2C0PA 3E5NA 4B76A 4N9WA 3A9RA 1DLIA 2CL6X 3M82A 2L18A 3I01A 5LXTB 1NKSA 2V74B 5AXDA 3A4YA 2AUMA 5EIHA 2Y9MB 1QKJA 4ND7A 3JQRA 4FIZA 3CISA 1GNRA 3M6WA 1J8VA 2Q9CA 5B4VA 4UW9A 1EWKA 5DMHA 4O4IF 3ZCSA 3C1OA 1DADA 4YQEA 4JA0A 1CR2A 2H00A 1V7CA 3X1KA 2ZCVA 2SKDA 2IZ7A 2QP9X 3CX4A 3M4XA 5CVVA 5FYDA 4EMBA 1NTOA 2R2AA 3WL5A 4B84A 3FVRA 2Z5LA 4TS9A 4UHHA 4Q9NA 2VDWB 3F3KA 3PK0A 4PNHA 3KCQA 5JY6A 1KSJA 3IDFA 1GIAA 1P39A 2NAFA 2ZITA 3LKVA 5EJ6A 2JI7A 4IVPA 1TVMA 2ZE6A 2RHWA 1C80A 2FPKA 1YNOA 2Q4OA 3E3OA 3FVTA 3V1MA 2QLTA 5IANA 1G5QA 3CG0A 1BS2A 3ESZA 4FS8A 4B7CA 3EC2A 5DM0A 2V59A 1F2VA 1CX9B 1WCIB 3SC3A 2PR2A 3T3EA 3HBLA 5A7HA 2WR8A 3TZQA 4DV6B 1Z73A 3E9DA 3N8DA 1RKUA 4NMHA 2SICE 1BOFA 2RAPA 3D6VA 3KNZA 4BO4A 4C7JA 3ZK7A 1Y89A 4ZOEA 1SRRA 3BA6A 3VR5H 3KU4A 4FJ0A 5DIFA 3G89A 4P84A 1U8ZA 2IXBA 1UMBA 3CBGA 4P3KA 1IN7A 3PWKA 4ZAWA 2OGTA 5LUAA 2YFHA 4PAOA 3W5IA 3KQKA 4TT3A 3GF4A 5LVAA 3KALA 3OG9A 5JBIA 5G40A 2P3OA 1UQTA 2H6EA 2F67A 3TLAA 5DEIA 1V39A 2H65A 1ULTA 4NL4H 3B9BA 3D6MA 4E12A 3I62A 1IUNA 2PT9A 4Q82A 3ZU5A 1VHJA 4ZXPA 1A1SA 3SR4A 4BNUA 3E9MA 4QHYA 3T3DA 3GP8A 2CXQA 1E1MA 2Q62A 3N8GA 4OFZA 1T6NA 3WDLA 5DM70 1UDCA 2ZTSA 1ZU4A 3L40A 1EWTA 2ECFA 4B4WA 5DM2A 1ESNA 3WIEA 1GRVA 2HXYA 5TLSA 1ZCAA 4R2JA 1FDRA 4H1UA 3ADCA 3TNFA 4ZK6A 1KO5A 3WWYA 3JVEA 3SQNA 2A57A 4WVFA 3DAHA 2P41A 4B34A 5T41A 3K09C 4G85A 2PX5A 2WAMA 1YS6A 2A0WA 1DIBA 3IJPA 5F51A 4IH4A 4ETIA 4QBIA 4BNVA 4DG8A 3K73O 2BHSA 2X0IA 2OK8A 2ZQ5A 3EVTA 2ZI7A 4YLGA 3DC7A 1NVAA 4G97A 1ZM2A 2TMYA 3W7BA 2VZ9A 5FI0B 3GRUA 1Z68A 2KBFA 3GOHA 3T3IA 2GJKA 3SC4A 3WLNA 3LF2A 1UOPA 4CU2A 4HVLA 5A9SB 1XU7A 1NNSA 2W6QA 1VG1A 2JH3A 2YOFA 2Q7OE 1OLOA 3C3CA 4GH5A 4Z7QB 3IQDB 2XY4A 4G65A 4J6FA 4FC6A 1NRJB 4PQYA 4DIUA 4FW8A 3ZHXA 2QNBA 5A4DA 1P0QA 5EJ2A 1XJ0A 2P0AA 1TCVA 4CKZA 2A59A 2AN4A 2JK1A 1YK0A 2YX1A 3GJSA 4DQDA 3TB4A 1KVUA 1SQGA 1D4FA 4AZ0A 1JT2A 3BMQA 5C4MA 3IMGA 2VH5R 1JJVA 5JNLA 2UV8A 4PC2A 2ATXA 2FSSA 3CGWA 4AYXA 1TJ3A 2DECA 4PYOA 4B9EA 3ORRA 5CT8A 5JDIA 4HQFA 4LZWA 5LMCA 1PN3A 1N2JA 3VSDA 4US2R 2W11A 4NPCA 2RI1A 4MDHA 3V4FA 3A6LA 1OH8A 1D8TA 3OICA 1DE0A 3MQFA 3O5AA 4GZ5A 5B55A 1XYYA 2PMFA 2APJA 3N3AC 1RMTA 1MRSA 4MYDA 4JLKA 2WABA 4RX1A 4TMWA 4B75A 1OZHA 2VP3A 3ZW8A 4EJSB 3ELUA 3RIHA 1BU8A 1C4OA 2QN3A 1RM5A 2W4QA 3U6BA 1N3YA 3QLVC 3QVGA 2VIIA 3EWSA 3V1LA 3NHBA 3QELA 2H17A 2G08A 1MJ5A 4EJSC 5E1BA 5I6DA 1XNQB 1XTTA 2PTHA 1XKTA 2WSYB 1FX1A 4ETMA 1XN1A 1N1MA 1K27A 3M8KA 4UULA 5JH7F 5LR6A 1WY7A 4KN6A 4JBNA 5AHRA 1XMOB 1O0BA 4LTDA 4P4SA 4RE5A 1GQOA 3WIBA 3WV5A 1VL0A 5L4NA 1EEHA 4F72A 4UUPA 3AILA 1X1DA 5EPOA 1RADA 3HRIA 1W581 3UF0A 2Z4SA 2G07A 3DL4A 1CEYA 2IX3A 4F9FA 4ZT3A 1S9HA 2FFHA 2J9XB 3HA2A 1JAZA 3MBKA 3SHOA 1BKSB 5CBKA 5IYZB 3PFNA 4GZLA 4CBVA 2DFVA 3HFSA 2CLFB 4YJ2F 1IM8A 1RKBA 3HGTA 4ISCA 1ZKDA 2AGVA 4ND8B 4HX9A 4MP6A 1WVMA 1YQWA 1T6BY 3JSXA 5CLJA 3H04A 1NBMD 1ZU5A 3L0IB 2WWTA 2QY6A 3C3JA 2OGSA 1EB8A 3AZOA 5AJUA 5E6UA 3S1AB 3GCGA 1QHGA 2RDMA 4ZT7A 1YA8A 4ZODA 4LXXA 4C0WA 1Q74A 3KOZA 5BV1A 1U9JA 3AH8A 3P4UA 1FYWA 1NULA 4PO9A 5K8IA 1DKRA 3LCRA 2PZKA 1W5TA 3NHJA 4IH1A 2A5DA 5J63A 4L72A 1JH8A 1KJWA 3LPLA 2AW3A 5EWJA 5KWVA 1G55A 4P7JA 1P61B 2IZ6A 3GZJA 4TTVA 4EY3A 3B2QA 4M76B 1KJYA 1I2MA 2F3UA 5HG0A 3RS4A 2GMWA 3GFTA 4X1KB 3VOTA 4MEBA 2ZVPX 4TVSA 1XMVA 2C3UA 3DEJA 2FGKA 1ORDA 4LMBA 2OT3B 4H7FA 4MI9A 4OJTA 3ORQA 2IOQA 1Q0LA 4YR9A 4GC5A 5ED0A 4ZTBA 4B0PA 3WGLA 3RC8A 1J25A 2ZWIA 1PR5A 3Q3HA 3SZ3A 4OLFA 3NVDA 2HT6A 1SKBA 2E4AA 3KKZA 4RW0A 4YVFA 3MCUA 4D41A 3TDNA 3FSJX 1ST3A 2JEZA 1L7EA 1I3LA 1Z17A 4I5EA 4NWIA 2VCEA 3DAOA 4DJDC 2JLZA 3LUDA 1J9GA 1WTAA 1FY2A 3DV2A 2G4CA 2ODNA 4QULA 4RZUA 4AO8A 3LBAA 4AYWA 1N3BA 1YT5A 3A14A 5BSRA 4O3FA 1E62A 1AUOA 3CRQA 2X2PA 4N3NA 1MOSA 1X7XB 3QXGA 2I66A 4DMGA 4KN8A 4INPA 5L45A 2FLVA 3KIPA 3W9BA 2XVZA 5AXAA 3IX7A 3AVOA 3FSGD 4X7RA 3OPVA 4D3XA 1U9ZA 3Q5GA 3PUKA 4YALA 4BNIA 4HWTA 2DQKA 2O7SA 1UDAA 1QVZA 2WG1A 1BE0A 2Z3WA 1AQLA 1JVBA 3EYAA 4FKZA 3ECAA 1AGYA 3O75A 2O20A 2VDVE 5H5JA 1FYEA 2R7AA 1J2RA 2PVSA 3QUCA 1WVGA 4N6NA 2GGSA 1RAIA 3GU3A 1IUKA 3LOPA 5KTYA 4YJHB 3E5HA 2W00A 3B5JA 4I19A 4RF2A 4D0SA 1Z4LA 1NE2A 2VDPB 2PQ6A 1SO8A 3EIQA 3ND8A 4C6TA 3WLPA 4DADA 1BRMA 2YMPA 4LHWA 1RAFA 3QF4A 3ADDA <