5HRUA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
305
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
molecule keywords L-lactate dehydrogenase
total genus 117
structure length 305
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hruA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hruA02
2ZB7A 5B1YA 1P9LA 3UCFA 1NFRA 4ZGWA 3K5PA 3JQAA 1PR9A 2PNFA 3FNEA 1GEGA 1X1TA 2H1SA 3MZ0A 1SBYA 4YAGA 2I6TA 2VHWA 3DTYA 1ZK3A 3AFNA 1MC5A 4TRNA 1TVEA 2VQ3A 4PLCA 3PXXA 3GRKA 1DAOA 2AEMA 3WB9A 3MJCA 4NBUA 1GV1A 3ENKA 4RVFA 3KSZO 4TVOA 5JMPA 1Q0HA 1HXHA 2GASA 5KKCA 4ONEA 4BNTA 4OHUA 4MIYA 3ZWNA 1CYDA 1ARZA 3DOOA 4EEXA 3T4EA 2J6IA 4CQLA 5L9AA 3RAJA 1QYXA 1B14A 1XEAA 2YFQA 5L53A 2VRBA 1LQUA 4ZRNA 1PR3A 1CWUA 4BGIA 3NUGA 2OXIA 5BSEA 2O3QA 3Q0EA 4LSMA 3RUHA 5A5FA 3RC9A 1J5PA 4BOYA 3E18A 2P68A 2GGSA 2I3AA 4ID9A 4RVSA 4BKRA 3WMWA 3HDYA 3WGQA 1NWHA 1Y8QB 4YAEA 3VZQA 4NNJA 4Z3DA 3H6KA 4UAGA 1JTVA 3EHEA 4M49A 4OL9A 2NQTA 5CAEA 2Y66A 4J91A 4E0BA 4LCJA 2VT2A 1XG5A 3D1LA 1DSSG 3DMTC 1WAMA 1C14A 4F45A 3I1JA 3JQEA 2NTJA 1QYWA 1F12A 4EJ0A 2Y1EA 3JQ9A 2BI8A 4WCFB 3KUXA 2ZB3A 4WGGA 2DBVO 3GN1A 4WCFC 2BFOA 4XDYA 4E5NA 4O59O 3T4XA 3V5NA 4BKOA 3PGJA 1HETA 1M2WA 3UCXA 3VKVA 1MP0A 2ZTUA 1PJCA 2C2YA 3ON5A 3K73O 5CPBA 1SNYA 2ZK7A 1PS8A 3HN7A 3ZWCA 3HQ4O 3NTQA 1PGJA 3I9LA 5AOVA 3QE3A 2RH8A 2VUSA 4LRSB 1XLTA 3IUSA 2D2IA 5F5NA 4YJGB 5BNIA 4FFNA 1O0SA 4U7WA 3WWYA 3A4VA 3L6OO 3ZNOA 3PJEA 4BO2A 4QFCA 5F1KA 2NADA 2Q45A 1QYCA 5G4KA 2WJPA 3WXBA 4BB5A 4YRBA 5G0TA 4FPXA 3CZMA 3EZYA 1SC6A 3WMXA 1T4DA 4DLBA 4Q3CA 4O1MA 1IZ0A 1BW9B 1RKXA 1K6XA 3BYZA 3W4IA 2JD0A 1UZMA 1KEVA 4WLNA 3EMKA 2AMFA 2BGMA 4TKMA 1MG5A 4R1TA 4HFMA 1ID1A 2UYYA 4C7KA 3TF5A 4FJ1A 1D8AA 1VKNA 1HDXA 4XQ9A 1Z75A 1UAYA 4DQUA 3PK0A 4UVEA 5DZSA 4II3A 4G2NA 2D59A 2HU2A 5TJ9A 4BNIA 1R0LA 3QV1A 2EW8A 4U0JA 2Q2VA 4J4HA 1TT5B 2HCTA 4BQPA 2XAAA 3QSGA 2GNAA 4YB8A 1D1SA 3D5TA 2X8LA 4U0KA 2FY8A 3AM3A 2I66A 2YW9A 2NWQA 3SBOA 2AXQA 2J5QA 4E2ZA 4OJNA 5C37A 4AJ1A 4ZN6A 5A05A 1L7EA 2BMAA 3MJEA 1AHHA 4M54A 4OYRA 4F6CA 4YAKA 2A94A 3QA9A 1T1RA 2X86A 5FFFA 3OETA 4BL5A 2BHLA 3WFIA 1BXGB 1DOHA 2GUGA 4DLAA 2OMEA 2EEZA 2XXBA 4FFLA 1PJ3A 4IDCA 1ENOA 1ZSYA 1PTJA 1YQXA 2DM6A 1OBFO 5DBFA 1I2CA 3OHSX 4JROA 1EDOA 2CVQA 2PFGA 2YV1A 3LDHA 4FDAA 4RPJA 5ENDA 3JV7A 2NU8A 1NM5A 1SOWA 3E9NA 5TJHA 4BO1A 1YL7A 2W2KA 3RU9A 1P1KA 3M1AA 1DB3A 3V2UA 2V6FA 1VJ0A 1OC4A 1P31A 3L77A 3EW7A 3KEOA 3GDOA 4IDAA 2OP0A 2FSVA 4HX5A 3ZV3A 2Y0DA 1W8DA 2J8ZA 4L4RA 3TZKA 1VL0A 1KERA 3E8XA 1I2BA 2I5PO 4Q9NA 2EF1A 1IL0A 5THKA 4KDFA 3NRCA 2D5CA 4ESOA 3FCOA 3H4VA 4XRRA 3H65A 4NFSA 1JQBA 2WD7A 4OQYA 1WP4A 1QYVA 2VHYA 3NDIA 1SEVA 2POQX 2B5VA 5CDGA 4KWHA 3GHHA 4J16A 3U3XA 3OJLA 3WGZA 4D45A 3B1KA 3F5QA 3KHUA 4NJMA 1ISIA 4E32A 2J3JA 1I3LA 4YACA 3OQ6A 1O9BA 3AUAA 5F1PA 4DC1A 1JW9B 1PJ4A 4KP7A 3IMFA 1A4IA 2VN8A 3KYCA 1N1GA 3GGOA 1GV0A 2PLAA 4Z0PA 3GPDG 1Z82A 3WGIA 3ICCA 4UEOA 3WNQA 1HDCA 3PGXA 1ZXLA 2F00A 3LQFA 1MFZA 2VHVA 1SAYA 1XR3A 3BTOA 1LSSA 1V3TA 3AY3A 3GZNA 1JWAB 4GKBA 3K2BA 5ENVA 1KEWA 2CD9A 4QXMA 4Y8VA 4GPD1 2ZATA 3JQ7A 4O6VA 4AVYA 1T1SA 2R2GA 1H6AA 4GQAA 1B3BA 2I76A 2UAGA 3WQQA 4QO8A 5TT0A 1ULSA 1H0KA 1QLHA 3WFJA 2JFGA 4NHEA 3FTPA 5CDTA 2NU9A 1KVTA 2O3RA 5MGBA 1JLLA 4WOJA 1YL5A 3HG7A 3I83A 4XYEA 1UR5A 3OFSA 3VH1A 2HRZA 4BQRA 4LW8A 4RF3A 2GN4A 2NV6A 3C7CB 3GMSA 4I5GA 3ZWVA 2BGLA 2E82A 4XYBA 3VVBA 1VE9A 1NTOA 3DTTA 3ZI0A 5JYDA 1LSUA 2YFHA 2Y68A 4RVUA 1SO8A 1UDBA 4Q3DA 4PN3A 1EFLA 3VPXA 4J6FA 8LDHA 4HFRA 3M6IA 5KJEA 1P1HA 3RUEA 4UVDA 4YA6A 1PJLA 3AJRA 3DMYA 2R00A 4UVGA 4BMVA 1GZ3A 2Q3EA 1T2FA 4MVJG 3U62A 4G65A 5JXWA 4Z9XA 3M2TA 2PZKA 4QQRA 2FOIA 4OIMA 4CODB 1VI2A 1FDVA 1TEHA 1BWSA 1ZK0A 4AJNA 4ZQBA 4R9SA 1U28A 5TX7A 3RJ9A 1IULA 1MGOA 4YDRA 3MTJA 3OSUA 1E6EA 5IDWA 5JYEA 1LRKA 3JSAA 3DZKA 1L1FA 3I4FA 1F17A 3LC1O 4PLHA 1R37A 4AJOA 1HDOA 1DC5A 3CMCO 4BO0A 3PDUA 2NLOA 4YJHB 4J3FA 2OOSA 1GCOA 2X9GA 2O50A 1NQTA 4TWRA 4DL9A 3U49A 4PLTA 2YV3A 3GGPA 4HWKA 1CQJA 4WASA 5HS4A 3BZUA 4WE3A 1LBEA 2Q1SA 4J1QA 4CV0A 4BB6A 3U4IA 4Y6PA 2LDBA 1HYHA 3GMDA 4Q39A 1I3KA 3Q11A 1HE5A 2FMUA 1X1EA 3EDMA 4B4VA 1YS4A 1EBUA 3AOEA 4OKIA 1E7YA 4ALIA 3RU7A 1ZBQA 3P2YA 1WXDA 4AJKA 4X54A 1CDOA 4DWVA 4OKNA 3PHIA 3ANLA 4CLOB 4WLOA 4Q3AA 3AOEC 4K6FA 4L4SA 4UULA 2B35A 3L6EA 1N7GA 1O5IA 3RBZA 3Q9UA 3G0OA 4JJFA 3W8EA 3GVHA 1T26A 1F06A 3Q2IA 4WPGA 1LSJA 1Y81A 2ZCVA 2AQKA 3E82A 2O7QA 5AXBA 1QV6A 3S2FA 4ZJUA 2YDYA 3O8QB 1IPEA 4ND1A 2PH3A 1BSVA 4BNLA 4AJ4A 4IZIA 3DBLB 3S55A 3R6DA 1Z7BA 1YH3A 3C1AA 3IP1A 1EVZA 3O38A 5KJCA 3DBRB 2RIRA 3NTRA 4CMEC 4YR9A 1PL7A 4J4BA 4KQXA 1GZ4A 5EN4A 5GMOA 4TMFA 2NNLD 1BXGA 2UVDA 1XIVA 2YV2A 7ADHA 1KVRA 1VSVA 1YVEI 4J1SA 4CR7A 4R5HA 4UVIA 3OH8A 2VNSA 4R5MA 3ZN2A 4WLEA 1CERA 2C2XA 3F46A 5JE8A 4BNZA 1GQYA 1PU2A 4CUKA 2AG8A 2NM0A 4XZ3A 1ADGA 1LA2A 4R1UA 3VVCA 2DFVA 3ZWYA 4CM9A 4JJGA 3WIDA 1LDGA 2VHZA 4EYEA 2VZ8A 1UJMA 4IJVA 2JFFA 1X15A 1DRUA 4BNFA 2VWHA 3D64A 3GN2A 1VL8A 2NTNA 4D46A 3W6ZA 4O0LA 1KC3A 2DPHA 4RDIA 1YOVB 4LK3A 3QVOA 3DBVO 1Q1NA 4WKGA 2HUNA 3QVWA 5G0VA 4BMNA 3UKOA 3S8MA 1I3MA 1KVQA 1NYTA 2Q4EA 4UVHA 5EIOA 4IXWA 3FWZA 2C5AA 2VCYA 3QRWA 4NK4A 4BNJA 4PIVA 2DPGA 2OORA 2HQ1A 3GOHA 1BW9A 3TRIA 1IY8A 2WD7B 1DHTA 1R12A 3VAZA 4JK3A 4M89A 4RO0A 2X5KO 3JQDA 3QWFA 3VKUA 1NASA 2QW8A 5L7YA 3SC6A 1VJ1A 2ZB4A 6ADHA 4F46A 4E5MA 5DP1A 2FR8A 2B4RO 1LQTA 2PD6A 2CUKA 3AUSA 3HWRA 1UAGA 2ZTVA 3M2PA 1P45A 4C4OA 3S2EA 3OEYA 1B26A 1DLJA 1X7DA 1YJ8A 4MKXA 3IIEA 2V6MA 2RHCA 2RBEA 2W2KB 3WNVA 2AEJA 3DHNA 1YB4A 3WLEA 2QRKA 2PD4A 3BMNB 1WVGA 4D3FA 4PRLA 4FJ0A 2V65A 3PPIA 4YJFB 3WQSB 4DXHA 3ZWBA 5HA5A 3GLQA 4D3DA 4CMGA 3DHEA 4GSLA 5BT9A 3R0IA 2H5LA 1H6CA 1LRLA 5JBIA 1DIAA 3H9QA 2VUUA 2Q50A 4M86A 2W98A 1Y8RA 4RVDA 3TL3A 4DYDA 3P2OA 4LCEA 2JL1A 3FN4A 1ZJYA 4KTVE 1HL3A 1V9LA 1RYDA 1GR0A 1T2AA 2GYYA 3DZHA 4J7UA 4IDDA 2Y1GA 1JVBA 4A5OA 4ALJA 4YXFA 1A5ZA 1ZKMA 4PLGA 3G3EA 3VH3A 3CIFA 1DBVO 3NX4A 3PP8A 5IN5A 1DO8A 2FSSA 3PI7A 4BNYA 1ZK2A 3F4BA 5T57A 4NG5A 1V3UA 4I9HA 4R51A 3ORFA 1P1RA 4TRRA 5TGDA 2Y1CA 2O7SA 1Y1PA 3KSDO 1GYRA 4KMSA 4BO9A 3H5AA 1SEPA 3KYDA 2DAPA 4IZHA 5GY7A 1GD1O 1VL6A 2A92A 1AHIA 4XA8A 4Y9DA 4CLRB 4L0QA 9LDBA 2I99A 1Y6JA 3BMNA 2PH5A 4XKJA 2W2LD 5IDQA 4BKQA 5KJ6A 3E9QA 3QVSA 4EBFA 3B70A 2E48A 4MOWA 2WEKA 2GR9A 1DRVA 4WUVA 4NQZA 2HLPA 1IYZA 3F1LA 5KNLA 3VDQA 1C0KA 1XQ6A 4LISA 5C7OO 2EV9A 1B15A 4WNIA 4AJJA 3JQ7B 3RUIA 1TI7A 3L9XA 4MO2A 1MFPA 4DPLA 4I1IA 1E0DA 2JHFA 3O4RA 3SJ7A 1E3EA 1CRWG 1BMDA 1LU9A 3LT4A 3JYOA 1RYEA 3GH3A 3KYCB 9LDTA 2VZ9A 1GUFA 2HMTA 2FWMX 1E5LA 2EIHA 1GPJA 3RCBA 5H81A 4XIJA 1C1XA 3KV3O 1GZ6A 4OSPA 2DBQA 3WICA 3OEWA 1V6AA 4BHTA 1O89A 1HDZA 4KUGA 4U6SA 2HO5A 2DTXA 4FR5A 1A7AA 3GAZA 5CG1A 3PLRA 5IDXA 1NPYA 3AW9A 3GVXA 3O03A 4YBZA 5IJZA 4RLSA 1U3UA 1YRLA 1LDBA 1EQUA 4RZIA 4GSKA 3TJRA 1LLDA 1GCUA 1I2ZA 3JYPA 4FFRA 3V2HA 3MJTA 4OXKA 2CDBA 3CEAA 3FTNA 1H5QA 3JD3A 4XX0A 4MVJE 1I8TA 4HBGA 1JAYA 3SLGA 4IDBA 2WE8A 5IFLA 3U09A 1MG0A 1A71A 2V6BA 2JHGA 4W7HA 4YVFA 4IDFA 3KETA 3QWHA 4ZRMA 1EFKA 1PGQA 1RM0A 5FEUA 1UXGA 4CQLB 4GVLA 5A9TA 2VOEA 4LGVA 1QR6A 1KY4A 3I4CA 4HV4A 4ITUA 4DPMA 1LJ8A 5L95A 3TOXA 2UUOA 2VNAA 3WR5A 1EUDA 2X0JA 4RGBA 3H9GA 1B0AA 1IZ9A 3JQBC 2GZ1A 3I9JA 5FF9A 2QYSA 4DQVA 3GG2A 3K2EA 4XB1A 3GT0A 5DDIP 1U3TA 5ITWA 3DAFA 1CEQA 2VRCD 1TB4A 4JBGA 1DC4A 3R1IA 1E7SA 3U9LA 5FWNA 1LC0A 4E13A 1PZEA 4IS3A 2ZJ0A 3L4BA 3JQBA 1NVGA 1YBAA 3I6IA 4NBTA 1E7WA 4XYMA 3ROPA 2DBZA 3VPFA 1GL3A 3X2FA 1SCUA 4GGOA 3E5MA 2Q49A 1E3JA 3PJGA 2GN6A 3LC2O 3VC7A 4RCVA 1OZAA 5CEJA 1PQPA 2IODA 4P4LA 4CUZA 1PWZA 1K6IA 3EGOA 4BNVA 2YHUA 4B3HA 3U0BA 5U9CA 3JYNA 3WGTA 1NFQA 5LDGA 2ZTLA 3ROQA 1GFSA 3GEMA 3C1OA 3IJRA 2OBYA 3KO8A 3FD8A 1A27A 1EK5A 4NBVA 1SOVA 1R0SA 1M6HA 2B36A 3VPHA 2UDPA 2XXJA 3OBBA 1MUUA 3PQDA 1DFIA 1HLPA 2DU8A 1ISJA 3GZ4A 3PJDA 2D5AA 1EEHA 1XGKA 4ALKA 4N7RA 4JIGA 5T5QA 5K6AA 3KVOA 1RJWA 1H2BA 3LF2A 3CPSA 5AXDA 4BV9A 1DDOA 2PV7A 2PY6A 4O5OA 1PZFA 3FNGA 3GVIA 4GAEA 3RFXA 3DR3A 3PHLA 4CLEA 2X7HA 4CR8A 4A7PA 3BAZA 1EUCA 4L74A 1XU9A 4R68A 4XD2A 2FZEA 3GA0A 3JQGB 3DC2A 3GNQA 3I9MA 3VHRA 2E4AA 4BVAA 1DIRA 3MJVA 1DJQA 4E33A 4R4JA 3LLSA 3W4KA 1LXCA 1DEHA 3ZHZA 4FS3A 3FPCA 1NWCA 3HDQA 4PZEA 5EERA 3AUUA 3BHJA 3PWKA 2A9FA 4XJSA 2WM3A 4XYLA 3JYLA 1C1DB 1P1JA 3I5MA 1RPNA 1X7GA 1ZEMA 3BMCA 4EGFA 5IN4A 2EERA 4R01A 1PQWA 1T2CA 5DN9A 1QMGA 5EQDA 2GD1O 5L4LA 3IP3A 4YRDA 3E03A 5JMWA 1I3NA 1FK8A 4P38A 2Z1MA 4TSKA 2P2SA 3UHAA 4GGPA 1MXFA 3JCZA 1TT7A 4N5NA 3TL2A 2GN9A 3PQFA 5ILOA 2O3SA 3I52A 4XQGA 5CEEA 4HNHA 4CMKA 3K96A 5G2OA 1K5HA 2PZLA 4INAA 3NDRA 2FPPA 3JQ9C 1W6UA 4NJMB 2QYTA 3BA1A 2GDZA 4YT5A 3OA2A 3NEPX 1X7HA 3V1YA 1E1MA 2J5KA 5JS6A 1R4MB 4F6LA 4G81A 4KUHA 2DUWA 3SLKA 2PKRA 4UUNA 1YBVA 3K6JA 1E3LA 2BELA 1HT0A 3ANMA 4BKUA 2SCUA 4D41A 3DFUA 1FDUA 4CMAA 2IRWA 3PZRA 4H7PA 3OM9A 1ISHA 1EK6A 2RHRA 2Q46A 3PYLA 4FOOA 1C1DA 1ZK4A 2E6UX 5J23A 3OMLA 5JCXA 1NR7A 3FF4A 1AGNA 4CM3A 3INTA 4RF2A 2Q2WA 4S3MA 1VRWA 1NNUA 1DJNA 1XSEA 4R41A 1ZSNA 2O3UA 1HSOA 1NQOA 2BF7A 4EI2A 4W99A 4GX0A 2AQIA 2G0TA 4NPCA 3PIDA 3NKLA 1QORA 4PVDA 2WMDA 4IS2A 4PLZA 2CZCA 3WGGA 2UUPA 3TZHA 2B4TO 4FB5A 1TA4A 1C0IA 2I9PA 2I67A 2GN8A 2P91A 4CM1A 1V0JA 3ITDA 3DWFA 1ONNA 4IXTA 3DHYA 3UFXA 3O9ZA 4BKPA 5JCJD 3GZNB 2BRUA 3C1TA 1FMCA 2P9EA 3QWBA 2HMSA 4FOSA 5COQA 3W1VA 3MJSA 5COBA 3C7DB 4DGSA 1H9AA 3D5QA 2JFHA 3DQPA 3RBVA 3UXYA 1M75A 2Y0EA 3UICA 5I7VA 3AY6A 2CF6A 3AK4A 3D3WB 4P4GA 4Y6SA 1Z45A 1JU9A 4NDNE 4I5FA 3H7AA 2R00C 3FSRA 3PTZA 3RC7A 3ASVA 3GGGA 2VZ0A 3Q3CA 5I7SA 1PWXA 3O8QA 1ZVMA 2VTEA 3ST7A 2RH4A 1B8VA 5FI5A 4CV1A 4E3ZA 3RROA 5A03A 4BS9A 4OQZA 4IJUA 1BXKA 4E2XA 1UZNA 3T7CA 3HFGA 1K89A 4BGEA 5I7FA 2R6JA 3ZW8A 1B3RA 1GUYA 1VJTA 3TOZA 1G6KA 1Y8RB 2VRCA 4KQWA 3ZZNA 1ENYA 5LCXA 4DTIA 1Q7BA 1E5QA 4ZQEA 4BO7A 2JCYA 2X22A 3ZWMA 1ONOA 5CHEA 3R3SA 4HY3A 2GCGA 4I8XA 5KIAA 4EW6A 4UUOA 4IGFA 3CH6A 3GQVA 2PA3A 2HMWA 5DCUA 4J9UE 4KUEA 4E5KA 4YRAA 1EBFA 4OOFA 4BGVA 1YBMA 2IEBA 1R4NB 1LRJA 4QT0A 3ZU4A 4PLWA 3ZGYA 4RL6A 1AXGA 4M55A 1AN9A 2HJRA 3KYDB 4WCFA 2WWRA 3V2GA 2CNBA 4B4WA 4E4YA 2PK3A 3BMOA 3RWBA 5CP8A 5EQFA 3TQHA 4NH4A 5JSFA 3MTGA 3PYXA 2JD2A 3P19A 3PIIA 2ZYDA 4P22A 5T6BA 3GUCA 1ML3A 1DAPA 4CMBA 4CM4A 2Y93A 4IGEA 5ILGA 4HP8A 4DQXA 1SZJG 3JYQA 4PCVA 3ZHXA 4URFA 4AJLA 2CSUA 1U8XX 4CQMD 2Y05A 3LYLA 4HADA 1JVSA 1YO6A 5CDYA 1F0YA 2GRAA 3PWZA 4CV3A 4WEQA 1DXYA 1UXJA 5JO0A 5TLSA 3JD4A 1VLLA 1S6YA 1ZK1A 3BMQA 3PHGA 1GAEO 2W2LA 1ISMA 4FFOA 1CQIA 2NSDA 2XPCA 4ZQGA 1NP3A 2Y0CA 3WQRA 1DIBA 3VH4A 2BFMA 4KDEA 3AI3A 3G49A 1ISGA 1T2DA 4WLFA 4MVJP 1LDEA 3WDSA 1IHXA 4E2YA 5AYVA 2Q99A 3KLPX 4ND3A 2VYNA 2B5WA 4ILKA 4U6QA 3WYBA 1R6DA 2C07A 3E5RA 1ORRA 4NBWA 4XEHA 2NU6A 3IUPA 4W9NA 3WBBA 3RUDA 2AE2A 1PJTA 2RAFA 4MKZA 4TRMA 1GADO 4FFPA 4QECA 2HMVA 2GERA 2VWPA 2EHDA 4AG3A 4H3VA 1Z6ZA 4RZHA 3IJPA 2DLDA 4CL8A 3NT4A 4UEKA 4DVJA 2XF8A 3WTBA 3PYMA 1C0LA 1R66A 1WWKA 3QHAA 4XDZA 4NR0A 2JCVA 3CE6A 3PWSA 5IAAA 1Z7EA 4BO6A 5TS3A 1M67A 3ASUA 1PJ2A 2BD0A 1HYGA 1OOEA 3GNTA 2CFCA 2PR2A 5L4NA 4BNKA 4I5DA 4OXYA 1UXHA 2IE0A 3S2IA 3ZWWA 1U7TA 5I9NA 1BG6A 1ZMOA 3ABIA 3Q6IA 3OECA 2AQHA 4MVJA 1EUZA 4Y67A 5KVSA 3BHIA 3IS3A 1TXGA 1R16A 1LSOA 2C29D 4R3NA 2HRBA 1Y5MA 4TRJA 3W8FA 1I0ZA 4JXKA 3H3FA 4J1TA 3CSDA 5HWSA 2DUUA 4JBIA 4L73A 3ETDA 3TZCA 3LSYA 4L75A 1NR1A 1W0CA 3P5SA 1XHLA 3H5RA 3ZU5A 3GPIA 4DREA 2X58A 5KTKA 1H93A 1I24A 4A03A 2XOXA 5C7IO 1WDMA 2OHXA 3RIHA 3GVPA 1HDGO 5L4SA 5TQVA 1H9BA 1T25A 4YJFA 1N9GA 4CLHA 3AFMA 3OIFA 2LDXA 1CJCA 1D7OA 1D1TA 2RCYA 5FYDA 3AM4A 3Q1LA 3WJAA 5BSFA 1PL6A 2IEDA 3OJEA 3OA0A 1GYPA 4FIZA 2OP1A 2IZ0A 2QRJA 5B37A 1OAAA 3JQAB 4XWYA 4HFJA 3ZDFA 4BNGA 2OFPA 3NT5A 2PKQO 2VYVD 1GQQA 1KVUA 1DRWA 3GRPA 3CMMA 4A26A 2QIOA 4BNWA 4JNKA 5A04A 2AQ8A 5BNTA 1QYDA 4Z0TA 3PHHA 4WCDA 1EVYA 4IINA 3VH2A 1CETA 3B1FA 3HHPA 4WLVA 1QKIA 1PS9A 4E30A 4RF5A 1E1KA 3C8MA 4CMIA 4ZU3A 1LEHA 2CDCA 1NVMB 3L9WA 4ZQHA 2X9VA 3X2EA 3ZWPA 4CLXA 1YJQA 2B4QA 4MJLA 1I36A 3PJFA 5CEFA 1U8FO 3DDNA 4N5MA 2EG9A 3HDHA 3AI2A 4D7AA 5FI3A 2H6EA 4FJ2A 2WE7A 2X0NA 2D0IA 1B8PA 4OH1A 4DIOA 5JAIA 3I23A 4I9NA 1Y8QA 3OP4A 4M87A 3KZVA 1EMDA 5JAQA 3IQDB 5I8ZA 1ONPA 2Y1OA 4CM9D 1H2HA 1E7MA 4BUCA 1NQAO 3ZWAA 1GUZA 4ZICA 3TN7A 4PVCA 4RV9A 3K92A 2UV8A 4CM4B 2F1KA 3WG9A 1BHSA 3OJOA 3FNFA 3UOGA 3GUYA 1P0FA 1X0VA 3RKRA 4CMHA 4YPOA 1P1IA 2EKPA 5KCZA 3EYWA 1CIVA 4IY1A 5TRTA 4LVUA 5EJ2A 4XR4A 1UDAA 3B6ZA 2VWQA 4BV8A 1CF2O 4XCVA 1LI4A 3GK3A 1PSDA 3E6AA 3S2GA 2EJWA 4CUJA 4LSWA 1V8BA 4PGFA 4YT8A 1TLTA 4IDEA 1ZMTA 5EPOA 4I9UA 4DUPA 5B4TA 4J7CA 3Q9NA 1RM3A 3ROKA 5G0SA 4IJKA 4MVJF 5U4QA 4MVJI 1YE3A 1KOLA 3VTZA 3GY0A 1PIWA 3CXRA 1BRMA 1H6BA 1BDBA 1XWFA 2HMUA 3KOUA 2E37A 4IM7A 1ENZA 4R1SA 2EP7A 3LT0A 5G4KB 1JDJA 2ZQZA 4M1QA 2J3IA 3FR8A 3WYEA 3B1JA 3WOHA 4MINA 2P4HX 3VZRA 4L4XA 3HDJA 2GF2A 1N7HA 4YAJA 2PWZA 4RPGA 4W7IA 4DRYA 3BXXA 4ZA2A 1WZIA 3V1UA 5JC8A 3STHA 4L9RA 5GZ6A 1LLQA 1GTMA 3JD1A 5ER9A 5A06A 2G1UA 3DL2A 4CMIB 5C7LO 2IZ1A 1ZSVA 4J49A 3NJ4A 3SXPA 1C3VA 3AU8A 1E3SA 3RBXA 2PGDA 3WSVA 4EDFA 3W4JA 2IZZA 3HUDA 3L6DA 5CG2A 4BNNA 2P5UA 4DC0A 1O8CA 5K6AC 2YDXA 3ZV5A 3GVCA 1B8UA 1J6UA 1E7RA 1W4ZA 2QRLA 3IDSA 4AICA 4ALMA 4PZCA 1UP7A 3C7AA 3DOCA 2WDZA 3KM0A 3F47A 4WOKA 3VPSA 2AEFA 2EWMA 3H2ZA 4YEDA 2QQ5A 4TZKA 4PZDA 4YQYA 1J0XO 4S1VA 3JQAD 5A9RA 3BMOB 3D3EA 4OXNA 4IJWA 1HZZA 2O4UX 4LN1A 4DIFA 3DZFA 2JKVA 1YONA 5C5IA 3FI9A 2YZ7A 4IIVA 1NHGA 4ZQFA 5JO9A 1UH5A 2DTEA 4E5YA 4K9DA 3F1KA 2X5JO 4IBOA 3H9JA 5G0UA 3UGKA 4CPDA 5K0ZA 2EGHA 1ADFA 1YDEA 4KWIA 1V35A 1OMOA 4B3JA 1DIHA 3CTMA 3WGYA 3UN1A 1HE3A 4JLWA 4TROA 2CMDA 3ZU3A 4WECA 1EE2A 2PKQP 3H3JA 5IG2A 2W8ZA 3KSUA 1I01A 4XR9A 1JKFA 3IKVA 3KEQA 3DAPA 1EZ4A 3TFQA 3UUWA 2H63A 3G1TA 4BO3A 4GX1A 4XGNA 4GMFA 5KVVA 1E77A 1A4UA 1NHWA 1RWBA 2IYOA 1YQDA 2FPIA 1QP8A 3TZ6A 3WX0A 1JN0A 4LMRA 4CM8B 1IUKA 2WD8A 4NMHA 4Q3NA 4XRGA 1PJBA 1Y9AA 1ADCA 3ZWOA 4A0SA 4RLHA 3RVDA 4A73A 4MIEA 2B83A 5KJFA 1R4MA 1ZUD1 4XQEA 1R15A 1VPDA 2ZKLA 4EJ6A 4MP8A 4MP6A 4B4UA 5AVOA 1WNTA 1DPGA 4KZPA 5IF3A 1WLYA 3GEGA 3QQPA 4EZBA 1JWBB 1ZCJA 4UUMA 3KYBA 2FR0A 1DLIA 4N18A 3RI3A 1XDWA 2GPTA 2VUTA 5L40A 4OSOA 3U4HA 4EUFA 4GKVA 3ZCXA 1K3TA 1D4FA 4OM8A 5L7TA 5TF4A 1MV8A 1PGPA 3RSHA 4ALNA 2IXAA 4EITA 1Q0LA 1Q7CA 4WEOA 5JAZA 4D0RA 4QUKA 4RPHA 4YYZA 4DYVA 1NBOA 2G17A 5F1OA 3L0DA 3EC7A 4II2A 1RM5A 3ZNNA 3BTUA 3PRJA 1ZO8A 1MXHA 1P74A 1PZGA 1M6WA 2EXXA 1XA0A 2VYVA 4O63O 4R3WA 1I32A 4RF4A 4GI2A 5JPIA 3CUKA 1HF3A 3WJ7A 4K28A 1N2SA 3AM5A 2G82A 3BTSA 1V3VA 1YDWA 4WNCA 3LU1A 2GZ3A 4GVXA 4B4OA 2O3JA 1U5CA 3LC7O 1LDYA 3G17A 3OIDA 4KTTE 1HE4A 2D8AA 4IDGA 3BMQB 4J2OA 3F4LA 4YCAA 2I3GA 1FDWA 4BGUA 4JP2A 4CM7A 5A4DA 1MX3A 5DCYA 4CR6A 1HWYA 1PEDA 3EZLA 3MOIA 1U1IA 3HJAA 4MVJM 1WMAA 1HKUA 2Q1WA 1Y7TA 5IDYA 5IZCC 2X6TA 1FF9A 3JD2A 3ICPA 1MB4A 4AJPA 3H9EO 3SJUA 3VDRA 3ONDA 3DFZA 1BDMA 4ROSA 3HB4X 4ZHSA 1ZFNA 5F3RA 5KOIA 4HNGA 4JGBA 3DMTA 4IMRA 1G1AA 2X0RA 4IQGA 2PD3A 1KEPA 5DBIA 3D4OA 4W4TA 4J0FA 1EE9A 2ZQYA 4LVCA 5COAA 2Q4BA 2HJSA 4CM8A 1P3DA 5ER6A 3VPGA 3KRTA 4Z6KA 1E1NA 3I9KA 3JQFA 3PZBA 1LTHR 3QVTA 3PFWO 1O94A 4CLDA 1J49A 1T24A 2OBNA 4DA9A 1K0UA 5HS6A 5T8KC 3ZHBA 2EJVA 1OI7A 3ENNA 1K2WA 3D7LA 1E6UA 3GFBA 5A3VA 5TT1A 3RC1A 5GZ3A 1DIGA 1YB1A 2BKAA 1HDYA 4ND2A 3N74A 7MDHA 5B4UA 4CMEA 4EUHA 5A1TA 2GO1A 1NAIA 1UDCA 2TMDA 4BNMA 1XKQA 3CZRA 1PL8A 5K9ZA 4PLVA 4HKTA 2P9GA 5ICSA 1YOVA 4RQTA 3PDJA 4JBHA 5JNLA 2P4QA 1GPDG 1HRDA 1M66A 3FRJA 5H82A 4A2CA 2VT3A 2HDHA 1HSZA 4Q3EA 3ZNPA 5BNFA 4M8SA 2IYPA 5JLAA 4B7XA 4XJTA 3INGA 3RFVA 2BH9A 3ZV6A 2EW2A 4FQ8A 2FRDA 1LDNA 1O95A 2DFDA 1NAHA 4YQZA 2PZMA 3Q2KA 5ES3A 2ZYAA 3HB5X 3AOGA 3RJ5A 2EP5A 1G0OA 3KLMX 2ET6A 3AWDA 4FN4A 4OO3A 1MA0A 4AJEA 3JQGA 1KETA 3EY4A 5BQFA 1JKIA 6LDHA 1J4AA 2FN7A 2PTGA 1VSUA 3L07A 3DBRA 4JN6B 1N9GB 1R4NA 3PHJA 3DEYX 4E5PA 3GAFA 4BNHA 5L7WA 4J2HA 2WYVA 3DBLA 2J3KA 4P8RA 3NJ8A 3UH1A 4QFDA 4MP3A 2Y67A 3DBHA 4J0EA 5L45A 5A02A 2O48X 3K31A 3IOYA 4FBGA 1U2GA 3TNLA 3QW2A 3JD0A 1KEUA 1JA9A 2Q2QA 2Y99A 3JQ6A 1ZJZA 4PFJA 1LUAA 4CQMB 2Y1DA 2HSDA 5CPFA 1C0PA 3WTCA 4OAQA 1IPFA 3EK2A 2FHSA 4J1NA 4DIBA 4PG7A 5KWEA 4W6ZA 5TC4A 1HLDA 3WIEA 1P77A 4WK6A 1UP4A 2W90A 4Y6RA 3WGHA 3EAGA 2NVWA 3ZWXA 3RUAA 4Z3KA 2GLXA 3ZU2A 3F3SA 1H94A 2P9CA 2HK7A 4CQMA 1FDSA 3QWIA 1NX6A 1I5RA 4C7JA 2QG4A 2Z95A 4N54A 1GEEA 4DMLA 2A35A 4B8ZA 1BVUA 1UUFA 4D44A 1FXSA 4UEJA 5HTOA 2Z1NA 3D4NA 1LLCA 4NJOA 1KY5A 1YL6A 3QY9A 5A9SB 2CY0A 3I9OA 4GBJA 2AA3A 1SB8A 2VWGA 2W4QA 4NZ9A 1U3VA 4Q3BA 4QEDA 2C7GA 4XGIA 2C54A 3C3XA 3WWZA 4B3IA 5EL0A 5A5EA 3OJ0A 4RPKA 3I3OA 1U5AA 5DOVA 2X9NA 5JDCC 2IXBA 3H5NA 4BNUA 1Z73A 4JQCA 1SB9A 3U4DA 3OQBA 2VYND 4R69A 1NFFA 1OC2A 3LK7A 4PLFA 4W9NC 1D3AA 4RQUA 1U3WA 2DQ4A 4D42A 3ROMA 1E3WB 1K6JA 4K1LA 3EUWA 5DOZA 5HRUA 3OIGA 3VZSA 5GZ1A 2O3TA 4XIYA 1BTOA 2BLLA 4GWGA 4I5EA 2ZIZA 2V6GA 4GX2A 3JQ8A 5L51A 1O6ZA 1WW8A 3DZBA 1ZEJA 3C24A 1PQUA 1UXKA 5A3JA 1NPDA 3TPCA 1GY8A 1PX0A 3LT1A 4PLPA 4E6PA 3QIVA 2JAPA 1AXEA 1W73A 3PEFA 4RORA 3N58A 4YWJA 1OFGA 4N5LA 3MJ4A 4MVJH 5BSHA 5LDHA 5MDHA 4BIIA 5JDIA 1Z74A 1P44A 3DAGA 2X5OA 2JJYA 4NFHA 4UUPA 4D0SA 4YT2A 1Q2XA 3KBOA 1U4SA 3SC4A 2EKLA 2O2YA 1DFGA 1B7GO 4GLOA 5TSDA 5AQ1A 3DO5A 4Z0HO 2QZ9A 1QG6A 1SMKA 1E1LA 4OOEA 3RASA 4AJIA 4FC6A 2A4KA 2DT5A 4CL3A 4Z9YA 3OJFA 4WLUA 1RM4A 3SX2A 3OF2A 3KXDA 4ZVVA 1X13A 3D4PA 1PS0A 1KBZA 3P7MA 4D79A 1N5DA 2WSBA 4RJTA 3W8DA 2Y1FA 4AFNA 4BNXA 5T67A 3JQFC 2HAEA 3NV9A 4CMCA 4YAIA 2DKNA 1YKFA 2WYWA 4CJXA 4LMPA 4Z9FA 4DMMA 1ZZEA 4UREA 3INRA 1PJQA 4AL4A 4GLLA 2X0IA 4CV2A 3GR6A 5DT9A 3VTFA 1NPTO 1F14A 1XQ1A 4QSMA 1IHYA 2QHXA 3ADPA 1B2LA 4R16A 1ZNQO 1QRRA 4TKLA 1YB5A 3TFOA 1A72A 3IAHA 2CF5A 4Y98A 2HKIA 1QXSA 1S7CA 1WPQA 4ALLA 3ONFA 1VKOA 3GHYA 4QTZA 5L3ZA 5KJ1A 1TT5A 1DFHA 5DULA 3COSA 2YY7A 2D4AA 4LRTB 1T4BA 3BHMA 2PZJA 2BGKA 3D0OA 4FD3A 3MCVA 4R9RA 2NTVA 2X1HA 2B69A 4PLYA 3IKTA 4MVJD 1L7DA 2NVBA 4BO5A 2X4GA 2YHIB 1PGOA 3PFFA 1YXMA 4L8VA 3JTMA 3H8VA 3AI1A 1C1XB 1N8KA 5DNAA 4RDHA 2D3TA 5HM8A 5ADHA 1X0XA 4FSHA 4GL4A 4E12A 5JAMA 1ADBA 2JCXA 3TDKA 5JFOA 2E49A 3QWAA 4NU6A 5TNXA 4A10A 4CMJA 1DC6A 3MWEB 3ZH2A 4A27A 3IL2A 2QZZA 1WMBA 1U4OA 2DVMA 3G79A 2EGGA 1KYQA 5DF1A 1GU7A 2AE1A 1PGNA 1ZXBA 2CDAA 1AE1A 1LDMA 2DC1A 3LT2A 4TQGA 5G0WA 2C20A 4YJGA 3KB6A 4ZD6A 4BO4A 1E6WA 1KS9A 4JJIA 3HZZA 5B4VA 2ZJ1A 4PRKA 3WLFA 3UVEA 4RPLA 2PGJA 2FP4A 3ANNA 4DBVO 4EUEA 1KIFA 5JY6A 1DC3A 1HYEA 2NVUB 1XYGA 1M76A 4B8WA 2X23A 3GNSA 5G4LA 1N92A 3PVZA 3DZGA 2OL4A 3DXFA 3RC2A 2ZTMA 3V1TC 3WS7A 3ZHYA 2C5EA 3HE3A 1A9YA 2VHXA 3F6YA 1P1FA 3E9MA 3A1NA 4NU5A 1HE2A 2YHIA 1MC4A 4ND4A 1Y5RA 1E3IA 3F9IA 3NTOA 4AJ2A 5KVQA 5CDUA 1MLDA 4DPKA 3LZ6A 1QLJA 4TVBA 4R1NA 1IB6A 3T7EA 3G1UA 4NBRA 3K8ZA 2CVOA 4RVGA 1ZW1A 2Q1UA 5BSGA 4I08A 3QVXA 1E3WA 3A28A 5DP2A 1LC3A 5T64A 4U5QA 2HK9A 4D43A 3TZQA 3LF1A 1WDKA 2O4CA 4CLOA 2HK8A 3GF4A 1LX6A 2OGUA 1YGYA 3HN2A 4EEZA 3O26A 5JDCA 1PZHA 4PG5A 3L4BC 1EVIA 2YQ5A 4F3YA 5IXSA 2J3HA 4XQCA 4E31A 5KVCA 2NQ8A 5JDIC 5EINA 5AXCA 3DB2A 1ZIDA 3FPLA 1BVRA 4CM5A 4DBZA 1YQGA 4W82A 4IIUA 4WJZA 1H6DA 3TWOA 2NU7A 3RD5A 1YWGO 4OGWA 2Z5LA 3GC6A 4H16A 1GQ2A 1P0CA 2PGLA 1SPXA 3GG9A 3ONEA 4FCCA 1JAXA 4JP3A 3CKYA 2JAHA 5JY1A 1Q7GA 3B20A 5I9MA 4P4NA 5BR7A 3AUTA 3FBTA 4R54A 4FGSA 1U9JA 3MEQA 4OMUA 1E7QA 3E1KA 5F21A 2JD1A 4NI5A 3NGLA 4J7XA 4QX6A 5KKAA 3RUFA 4B79A 4E2WA 2B0JA 2EKQA 1BGVA 4NIMA 3ULKA 5IXYA 1I30A 3CINA 5I9LA 2ZCUA 3DZIA 2H9IA 3BMCB 5F5LA 1NQ5A 3UF0A 3A9WA 3I6QA 3NYWA 2ZYGA 4JX8A 1BXZA 3C85A 2C59A 4J90A 4KOAA 3EVTA 2D1YA 4XB2A 3WGOA 5A9SA 4CLRA 3FHLA 2C7VA 2BI7A 4G5HA 1HDRA 5DCWA 4U8GA 1B16A 5EMHA 1HZJA 4B7UA 2YYYA 1Y9EA 3JQCA 1F8GA 1I33A 3VZPA 2NUAA 3NGXA 5JC1A 4J43A 4PG8A 4XYGA 1U2DA 1ULUA 3FWNA 2ZB8A 4PG6A 1XELA 4IPTA 2Q1TA 2O23A 5C3MA 1ENPA 2OO5A 1A9ZA 3ETGA 4BO8A 1EVJA 1N1EA 3FNHA 4MDHA 5THQA 1HTBA 4HFNA 2J5RA 3LVFO 1ISFA 1UZLA 3AY7A 5ICMA 4YT4A 4FGWA 2FPGA 1QV7A 5I7EA 2CVZA 3FR7A 4IQ8A 1A7KA 4BMSA 4YTEA 2WYUA 1AUPA 5B12A 1XCBA 1Q0QA 3K30A 3RQSA 2AG5A 3I9NA 2P5YA 3ETEA 3GFGA 1QSGA 5CDSA 5TIIA 1F8FA 5JW6A 3GDGA 3HFSA 2BFPA 4J4TA 3BTVA 3ITKA 3HADA 1T2EA 1HEUA 5IZ4A 1X14A 1JKJA 3HNPA 4MPDA 3ZNQA 4GX5A 4HXYA 5CFZA 1EQ2A 3M1LA 2B37A 4FC7A 3R3JA 1DHRA 1P33A 2DTDA 4K26A 2ILTA 2AHRA 5AXAA 3F5SA 3GEDA 1G0NA 2TMGA 4JCOA 5H83A 2IDZA 1FJHA 3PLNA 3E48A 4E21A 5HBRA 4QO7A 3OICA 4YJDA 3NDJA 3RFTA 3IC5A 3HSKA 4NFYA 4MKRA 4AJHA 4TZTA 4IQ0A 4K6CA 4MIOA 1EDZA 1I10A 2I65A 1KVSA 2G76A 3BIOA 3V8BA 3MWDB 5EESA 1FDTA 3L4SO 5JCJA 3FBGA 2NACA 5U1PA 2C82A 3LLVA 3VOSA 1VM6A 4EJMA 5ITVA 3PQEA 1UP6A 1XU7A 1ZH8A 4RVHA 4NK5A 2V7PA 4PG4A 4H15A 3NT2A 3GDFA 4J9VA 3N7UA 4D3SA 3TSCA 3H2SA 3EVNA 2YJZA 2NVUA 2BFAA 2FZWA 3DOJA 3AU9A 4ND5A 5T8KA 2QX7A 4XGKA 1LNQA 3K9QO 4GH5A 3SVTA 1VC2A 3QP9A 5IZCA 4DLLA 1IE3A 1WZEA 1KC1A 2FR1A 3H9UA 4L76A 3WBFA 2VOJA 2GSDA 4GWKA 3WYCA 1UXIA 3ADOA 1R0KA 3QLJA 4IUYA 3S1LA 1GYQA 2YQ4A 4HUJA 1PJSA 2OUIA 1WDLA 4CM6A 4GMGA 3SEFA 1IOLA 2GZ2A 1LLUA 2AW5A 2OZPA 3A14A 3NAQA 2C0CA 3UCEA 2O2SA 3U4CA 1NXQA 3DBHB 5LC1A 3UAGA 3A06A 3OQ1A 3U5TA 8ADHA 3DONA 2YUTA 3D3WA 3JQ8B 1U7HA 2DBRA 1GDHA 4YJHA 3WSWA 3ZV4A 4FW8A 3QJ5A 4IMPA 3UW3A 2VTDA 4B7CA 5I8WA 3W6UA 5DBGA 3DZJA 2G5CA 4FFMA 3KTDA 3ZW9A 1NVTA 2WTBA 3MOGA 1E92A 3RUCA 3RKUA
chains in the Genus database with same CATH superfamily
1U9IC 4HWPA 2IF0A 3QPBA 2O6HA 1JNXX 1YIAA 1O6FA 5TQJA 1L4FA 5FWAA 2BEKA 4RK4A 5K8TA 1ILEA 2ECKA 3CKKA 1SBYA 1VPLA 4BLQA 2XBLA 5G3ZA 2I6TA 1RRPA 2VHWA 4ZQIA 3UPTA 3AFNA 4XOIA 4TRNA 5C31A 1TVEA 2VQ3A 4PLCA 1T8PA 3PXXA 4KAAA 3ZWQA 1DAOA 4Q3OA 4Q93A 4HGRA 4REQB 2NO6A 4D8WA 3L05A 3SWWA 1Z2AA 1GN9A 3T5CA 4ND7A 1HXHA 1O95D 2GPBA 2VEDA 4MR7A 2X15A 4HLNA 5EIHA 3TTXA 4W5OA 2PS3A 2WZBA 1CYDA 3OY2A 3WYGA 3ZWNA 4TZ6A 3E8MA 4MUXA 2H51A 3L18A 3RAJA 1B14A 4EY7A 2D00A 4NZYA 5L53A 1H0SA 1U5BA 2VKTA 3BILA 1E9DA 3G82C 1CWUA 4BGIA 3NUGA 3N8DA 1GVHA 1NMZA 2FQWA 5BSEA 1AQNA 2O3QA 4JKYA 4U7DA 4LSMA 1JGTA 5CK5A 2I3BA 3RC9A 1ZESA 2RG7A 1ZUWA 2GH1A 1W2WB 4BKRA 3TRKA 3DFMA 1J9GA 3HDYA 2QNBA 1G4HA 1NWHA 1R2QA 2YS7A 4RH1A 1Y8QB 1R88A 4UAVA 4ZXPA 2KBFA 3VHLB 3AETB 1OXVA 2IS1A 3EHEA 4MV8A 5AOCA 1QX3A 4U2CA 2VHUA 3A9TA 4WVFA 3WK5A 1AA9A 4RE5A 2FZKA 2CFSA 4W5RA 3TG8A 4PAOA 1PLJA 2Y2UA 3ORQA 4ENSA 1FP7A 1DSSG 1OXUA 1Q44A 1TDJA 5CRIA 1OXKB 1WAMA 3LYAA 3NHFA 2IKSA 3I1JA 1HFEL 3C16C 2KM1A 3WLRA 2IUSA 4WCFB 5JQGF 1UOEA 3L40A 5J40A 3UBTA 1TCAA 3K1TA 4WCFC 2AK3A 3WGNA 3HA5A 1J2JA 2NZWA 3VNSA 4XDYA 1XD2B 1QQ7A 3MLAA 3OEHD 4TMWA 3CB4A 4TMXA 2LNDA 3EZ6A 4BKOA 5BW8A 1HETA 1M2WA 4B84A 3P32A 4YY3B 2IUUA 4C4RA 5FQNA 3VKVA 2ZUWA 3LUBA 5AKGA 4YO7A 1MP0A 5AHXA 2LD4A 5CPBA 1KR5A 3ZWCA 2V7VA 3EXFA 3HQ4O 3L7MA 3H04A 4FEGA 3HDTA 4PYLA 3T1NA 5CA0F 1PGJA 2PRJA 1DJLA 3EDRA 3I9LA 4O2BB 5AOVA 5AJWA 2VUSA 4LRSB 3IUSA 4LOIA 3LVQE 3DD5A 3LBAA 5BNIA 1OFHA 3IQGX 2NXJA 4DT1B 4C6TA 1RRGA 3IV6A 2QQEA 5D87A 1L5WA 2NU6B 2QX9A 1JSXA 2X0KA 1UBHS 3OQHA 4IIYA 3PJEA 4GF5A 1HLFA 2NZ8A 2PVCA 3ZNOA 2NADA 3IMKA 2BP7B 1QYCA 5CLGA 2WJPA 3HA3A 3AHHA 5H5JA 5GJBA 3UOAB 4POAA 5JCPA 3KBBA 3KL2A 3TYXA 1OV4A 3LDAA 1T4DA 1Q11A 2BDTA 4FUQA 4WXPA 3V8RA 4Q3CA 3PUVA 4FT4A 2WJAA 1OHHD 1NONA 4ES6A 1SBNE 1UK7A 1K6XA 3LY7A 4UHDA 1ONSA 1E2LA 1G5HA 5IUNC 2AMFA 2QG6A 2ZFUA 1N2CE 1Y63A 3W9YA 1JV2B 5EXPA 4B3RB 1A9QA 3TF5A 3PDIB 1D8AA 3R5HA 4YP7A 2JGKA 2PO7A 4BPBA 3BS4A 4QREA 2PNJA 4DQUA 1YRBA 4II3A 4ZVTA 4P5DA 4G2NA 2D59A 1CUFA 2HU2A 4QJ4A 1R0LA 1RPAA 3COZA 3QV1A 1USUA 1YDFA 2Q2VA 4J4HA 3FH0A 5SY9A 2RBGA 3IOEA 1UFRA 1EJBA 4EA6A 1OZHA 2P41A 1V41E 3I5UA 3KU4A 5JWRA 1RAHA 2GNAA 4H0NA 4YB8A 1BQ3A 3D5TA 1IVNA 3FYDA 3S4YA 4U0KA 2FY8A 2YW9A 4JSYA 3HKEA 3MMZA 5I7AA 5CYFA 3LGAA 3OZFA 5DM2A 5MFZA 3UMRA 2CNKA 1DZ3A 2QQGA 3VU1A 4EF5A 1HBJA 1SCIA 2NO5A 1QYIA 3WK9A 5FTLA 1UBGA 1USIA 2BMAA 2J9ZB 3FUVA 3Q0TA 4DR7B 3WNCA 4F6CA 2A94A 5ERGB 4MVXA 2GBCA 2EQ5A 3BDIA 1FBNA 5IVKA 4D96A 1F4PA 2GEFA 5GVSA 3PJRA 1CRLA 1Y37A 1YIOA 3FNIA 4KWCA 3HK2A 1BXGB 3IEIA 3MMPA 5IHXA 5KWVA 1RVDA 2DH5A 1ZL0A 4FFLA 1NUPA 5AUPB 2PX3A 2FPSA 2ZYSA 4XSHA 5E7MA 4KREA 5JS1A 5DBFA 1I2CA 3N8KA 4JROA 4MW0A 5IH7A 3RVJA 5KDDA 2WG1A 5IHPA 2PFGA 2V45A 2HZBA 3LDHA 3AEQB 4FDAA 1RNLA 1MJHA 1WB5A 4RPJA 3FWKA 3ELWA 1QH9A 4UTZA 3UATA 2H48A 3ZZ0A 3U40A 3E9NA 4BO1A 2W2KA 4B47A 3LA6A 2BIFA 4KSCA 2EATA 4PZYA 2DFNA 2I1WA 2XTZA 3RRZA 3DAYA 2GEDA 4YI3A 4FDVA 3QTTA 1BA2A 2FSVA 2OP0A 2R47A 1G59A 3VC1A 4NMMA 3SBXA 4YYEA 2Y0DA 1WCIA 2J8ZA 3Q10A 4L4RA 3GJ8A 2IP2A 1WXXA 2IYRA 5TS2A 3K09C 3E8XA 1I2BA 5K8UA 2OFOA 3QX8A 4B46A 2R6DA 4MCAA 3DLTA 4HYEA 1IL0A 5GONF 1E1CB 1SUSA 1P7YA 3C39A 5THKA 4MUGA 3NRCA 2D5CA 4GU5A 4R8MA 4CI9A 1LV8A 4TS1A 4O4IA 1YB2A 4GBMA 1T6ZA 2WKPA 4N8DA 3ZCRA 4G1CA 4NFSA 4FWTA 2WD7A 1VPVA 2A0FA 3TW8A 1QYVA 2VHYA 2VUHB 1SEVA 3NDIA 4KE7A 5E9QA 3GP8A 5CDGA 3IT0A 1MTZA 4J16A 1FQKA 3GJ6A 4X85A 5DX8A 5H7XA 5K3CA 3U3XA 5JH7A 1VHQA 1FZTA 2JFNA 3G8AA 1WEKA 4B48A 3MTBA 1P4SA 2VA9A 5HBGA 1GXSB 2J3JA 1Y9DA 3DVRX 1YD7A 3LY8A 4Y9RA 4ENWA 1NNEA 2CNNA 3EGVA 3BGSA 2PGAA 3OQ6A 4QXQA 3PKZA 5DWDA 4DC1A 5IEBA 1P60A 2C7OA 3PX3A 1AKYA 2VN8A 4AP5A 4GKAA 4BBPA 1NR5A 4EH1A 2E1RA 1XZGA 2FFJA 3K3PA 5DSZA 4KVFA 1U2DC 1Z82A 1FFAA 5KSZA 4S05A 2B8EA 4UEOA 1HDCA 4QM7A 5K0EA 3PGXA 2F00A 3LQFA 2VHVA 3GLTA 1SAYA 1WHTB 3BTOA 2GYUA 1LSSA 4AUNA 5CFLA 1GIAA 4W5JA 4G67A 1MNQA 4FFDA 3S68A 2C4UA 4I36A 1YMQA 3K2BA 1TJYA 4LF8B 1JR4A 4YV0A 4RA6A 2AD5A 1U0OC 4D4JA 2EKDA 4EFDA 2OBMA 2R2GA 4MTLA 1B3BA 4NESA 4EG4A 1BYIA 2IHBA 3G9UA 1K5GA 5JPDA 2FSUA 1W75A 1C9NA 4B6QA 3OP1A 1QLHA 2IY8A 1TUBA 2Q3FA 4QUBA 3I01A 3TGLA 3FTPA 1WCWA 1JG1A 4EYSA 5CDTA 2NV0A 4DIUA 3EPJA 4Y1EA 1E60A 1QUFA 2Z9BA 3VH1A 4BQRA 4JB0A 4P3KA 2TYSB 1IEVA 3IOCA 4LW8A 5KSWB 3BPSA 1D0IA 3C7CB 3GMSA 3UV6A 2B94A 2KJQA 3CBQA 2H4JA 3M9XA 1XZIA 5JYDA 1UMCB 4PO9A 4DMRA 4KX3A 1B76A 2YFHA 1TAUA 4LXYA 4RVUA 3KT8A 4RKRA 2ANBA 4QNNA 1Z2EA 4Q3DA 5M3BA 1EFLA 1M6EX 4J6FA 3K70C 4QL3A 4EHDA 3M6IA 1OYOA 1P1HA 5ITZA 1EWTA 4ARBA 4UVDA 4V3BA 1W30A 2IYAA 5HUJA 1BA3A 2R00A 4UVGA 5K3EA 4BMVA 2ZLBA 1FX0A 1RQ7A 2ZANA 3CFYA 3I5XA 4PCAA 1FPMA 1RKVA 3U62A 2LCFA 5JXWA 2OK7A 1N3YA 4UXIA 4MZXA 2JA1A 4QQRA 1TEZA 1KIMA 5CM2Z 5BSRA 2FEMA 2ZCJA 1QKKA 5J5VA 4M98A 2B1GA 1TEHA 1KI8A 3QEKA 3TTWA 1ZK0A 2REOA 1NW5A 2H0AA 4HVAA 4DY4A 4R9SA 1K6MA 5TX7A 1BHJA 4CNBA 1H0HA 1T3SA 1MGOA 3G0BA 3MTJA 2A1IA 3V4SA 4CIBA 2VJYA 3IAUA 1E6EA 2RHDA 4ZIRA 4HGQA 5IDWA 5JYEA 3RJTA 3ADDA 2JIRA 4XUGB 4AJOA 3CMCO 3P9IA 4E7OA 5AVVA 2VLBA 2VPXA 1B6TA 4R2JA 5K3DA 4AUKA 2O50A 1NQTA 4G1VA 5IM5A 2PS9A 2CD7A 2SICE 3GGPA 1Q12A 3N2YA 1GHTA 1RTTA 2JJ1A 2K2QB 4HWKA 3SYMA 4C3UA 5BN1A 1ZHHA 4WE3A 3TW4A 3U4IA 3E4CA 1C3XA 4RY9A 4Q39A 3TB4A 3SVLA 5FAKA 4LKOA 3WQBA 1KI1A 1O9HA 1YS4A 2Y27A 1E7YA 5DPMA 1NBWB 4LC1A 1JKXA 2Z2YA 4IZ6A 4BP9A 2PFSA 5FX2A 3P9PA 1P18A 4EY6A 1CDOA 1OUMA 2C8JA 5A3QA 4OKNA 1YE5A 1L5QA 4I4TA 2GCEA 2QAJA 3VA7A 2OGZA 4P0PB 1E96A 1P72A 3AOEC 4K6FA 1E9BA 1RTKA 1ZRMA 2B35A 4L4SA 1O5IA 4WIAA 1EZZA 2H5IA 4FDMA 4HLCA 5BWMA 3HJHA 3W8EA 3I1YA 5BV7A 3Q2IA 2FN9A 4LYGA 1DRJA 1LSJA 1VIAA 1YC5A 1F5NA 2ZCVA 4KYUA 4ZEOA 3UTCA 4KGVA 4E03A 1TMYA 4XLZA 5D85A 1EQAA 1V45E 4MKHA 1NV8A 4RXTA 4A8JC 2BHTA 3PFNA 1BCSB 1QH8A 3GRZA 2YDYA 1R8QA 4EI9A 4V0ME 1IPEA 1QGUA 2Z3ZA 5E6UA 4BNLA 4AJ4A 1WQ1R 5CJPA 3OHMA 4WUTA 5CMLA 1OKKD 3R6DA 1Z7BA 1YH3A 1Z0ZA 3P52A 4EGQA 1EVZA 4Z53A 3DBRB 3BE6A 4J4BA 4KQXA 1RXVA 3U1TA 5AK5A 1OX4B 1GZ4A 1XMPA 3VSAA 3U4QA 3GCXA 4GLBA 4TMFA 2ID9A 1TRHA 2OBFA 2UVDA 3Q7IA 4Q7LA 7ADHA 4QA9A 1YZQA 1VSVA 3PRYA 5I8PA 4CR7A 4DCSA 3H84A 1ND5A 2E4XA 1RZ3A 3D8BA 2XZPA 3I32A 3OH8A 1VHJA 2VNSA 4LV5B 4R5MA 5FBQB 5C8DA 3L7OA 2PZEA 1RR6A 2QTBA 2C4VA 3F46A 3LYHA 2OXCA 4P82A 5JE8A 2P1ZA 4HUQB 4Z4FA 3UQYS 2NM0A 1M6VA 2QTNA 4P53A 4KO4S 3BF7A 1QH1A 1ESMA 2DFVA 4RY2A 3CONA 4CM9A 4HDKA 4JJGA 4EA9A 3PNSA 5K09A 2VHZA 1JWLA 5HF8A 4N82A 2R85A 5B2EA 1ML4A 2ZSEA 3D64A 3ESZA 4D46A 2HBRA 3AWIA 5LVAA 4RDIA 2HADA 2CBGA 3DBVO 2B98A 2EP8A 4WKGA 4GNRA 2CEKA 1VG1A 4QOHA 1W5SA 4DANA 1XUOA 2RBKA 3EFOB 4RA9A 4RIGA 3F71A 3FWZA 4OYHA 2VCYA 1FVXA 4NK4A 1O1YA 4CN8A 4TLEA 1QK5A 5FPHA 1I9CA 1FTQA 2FCRA 2HHCA 5UKDA 3T12A 1L1EA 4GR4A 4JI6B 5ALKA 1BW9A 5EEGA 1R12A 1CUCA 1YIDA 1R3UA 3VAZA 1IVSA 2QD2A 3MA0A 2X5KO 4S2EA 3NH9A 3JQDA 2WR8A 3WL7A 2OEPA 5MFPA 3QWFA 2O59A 1M8GA 1S2IA 1U6IA 2ZB4A 3D6FA 3M4ZA 2E55A 1SBZA 2J6CA 3HZOA 4AY5A 3IV7A 3OAAD 1CB7A 4YALA 1UODA 4KNVA 3T0GA 1LBIA 4BB0A 4LVOA 2QM3A 1IWOA 4WACA 2V7XA 2P4SA 2LRHA 2CE2X 2VK8A 4N8SA 3V32A 3N70A 2ADFA 2I2XB 1UAGA 5A2QA 2PCJA 1ZS9A 4L9WA 1Z5VA 1OB2A 2HRQA 3OEYA 1DLJA 3R5SA 4HAIA 4CFSA 2FYTA 4P5PA 1XZPA 3V1NA 2RHCA 2RBEA 1A2QA 2RGEA 2RONA 5HYVA 3O4HA 3MWLA 3F78A 1YB4A 2QVZX 3A6EA 1JHOA 3NWBA 1W76A 4GZ6A 1U7DA 4O4HB 4P3XA 2PD4A 3BMNB 3MTEA 5KTOA 1ZI6A 5LZ9A 1U4NA 2J59A 2Q0XA 1J00A 1OBCA 4TKZA 1NJGA 2V65A 1U0RA 3KXIA 1MB9A 1T0HB 2ZT8A 2JIZA 3O8OB 2W93A 3PPIA 4GI5A 3UK7A 4EYKA 2H2DA 4B6EA 4BP3A 3HGTA 3DHEA 1XOIA 4GSLA 2XT0A 3HEAA 5AFSA 5IXJA 3R0IA 1YTUA 2XVYA 1RQRA 1OIVA 5JBIA 4LDAA 2D1FA 3HJUA 3M9WA 5EE1A 4QJ3A 1DRKA 2VUUA 4LA4A 4GMDA 2WKSA 3MMSA 1FXWA 4DYDA 1WBJB 4LCEA 4RFSA 4BQIA 1KTIA 1VE1A 2JA2A 1HL3A 5EXXA 5I7HA 1E1CA 2BUBA 3F97A 5JSKA 3GEEA 3OJCA 2WAAA 4KXQA 3JRNA 5AW5A 4A5OA 3BFXA 4NAHA 1ZKMA 2YJNA 4PLGA 3KDAA 1ZW6A 1DC7A 2NYUA 2WRZA 3CIFA 3NX4A 5ISMA 1UFQA 2ACVA 4LDQA 5C8VA 4BNYA 1UBMS 3F4BA 2FGKA 5BN5B 4PFSA 1V3UA 1KA9H 1D2CA 1TFRA 3OEHA 3NNSA 3QXXA 1ZJ5A 1M34A 2F64A 2QUHA 3ORFA 4LIPD 4WL0A 3TW0A 2WF6A 1T9HA 5TGDA 1Y1PA 4BO9A 1KI9A 5KYWB 2O8DA 2IT1A 3NG1A 4KAFA 2RHBA 4TUYF 1JA1A 1PFQA 2DAPA 4K1XA 3BL6A 1VFNA 4IWYA 1V9CA 4WFJA 1NULA 4L0QA 2I99A 9LDBA 1Y6JA 2HF9A 3BMNA 4DUGD 2W2LD 3IP8A 2W6ID 3MYRA 4LBVA 3QVSA 1JHMA 1PEKE 2R7LA 5BSWA 4UTRA 4RWEA 4MOWA 1CR2A 3HN6A 4W5HA 4WUVA 4NQZA 4HTFA 5CLLA 1IYZA 1OA0A 3F1LA 4L8LA 5KNLA 3HA7A 1XQ6A 1PVOA 1E4OA 2V0NA 4LISA 3VKGA 3O4GA 2EV9A 4RA6B 2Q3LA 5FULA 2XCRB 2GM5A 2RCNA 5BWCA 2P8SA 3DE6X 4ZJPA 4O4LF 1TUIA 5D8DA 4K6MA 2REBA 1MFPA 2ODNA 2W71A 4X90A 3USCS 5IABA 5JRZA 1JFTA 2ILVA 2XCOA 1JR3E 3C4QA 4K86A 4XVQA 5EMLA 2VATA 1X7WB 3O4RA 4P3YA 3R2JA 3NBXX 3BWVA 5ETJA 3KTFA 2VK4A 2ATEA 3KYCB 4PAWA 3W3ZB 2VZ9A 2FVXA 1GUFA 2FWMX 1GZHB 1ODCA 3CR3C 3G68A 5H70A 5BT8A 1POWA 4UPDA 2I8AA 1JE1A 1Y48E 2O2DA 3HDGA 3ILSA 1M34B 3EZ9A 1YGPA 5EJIA 1CNMA 4GC9A 3UWKA 2WAYA 4OSPA 2WIBA 3CLRC 3GLFA 3BBLA 1V6AA 4G0NA 4EECA 3HKDA 2IYEA 4JY7A 1R5JA 1S4QA 4KUGA 4U6SA 1AXRA 3H42B 3ZZUA 4BP1A 4ZCIA 2OZKA 2EFYA 2ZXUA 4LZWA 1MRZA 4M60A 4P3PA 4EW2A 1AKRA 1FFGA 1K3FA 1JXQA 1R27A 1YAJA 3AXSA 1P19A 3CX4A 1LWNA 3GJRA 3GRVA 1GDTA 3EDQA 4OP1A 3VXKA 5TQ2B 1GCUA 2KPOA 4ZJYA 3ZXUB 3MJTA 1M6VB 3IPYA 4OXKA 4CCSA 2HRDA 1MJNA 3CTPA 3B38A 2H2IA 4BLOA 3JD3A 1XQWA 1I8TA 1P5ZB 1TLFA 3JZMA 3R44A 1JAYA 4G1BA 4HLUC 2BMFA 4I4NA 4JJ7A 2WE8A 3U09A 5B4VA 3CPJB 3SK0A 4HYYA 3WI7A 4H35A 1UEJA 4FMCF 1MG0A 1E59A 2V6BA 3JYHA 4W7HA 2Y9MB 3KETA 1W5TA 1Z5GA 1DBRA 2I4MA 3G5LA 5J4KA 5CM9C 1ZD5A 4CQLB 4GVLA 4Q4HA 1D2HA 1U02A 1DS6A 1T0IA 3QXSA 4GLJA 5TEVA 1XCJA 1A8SA 1Z88A 2WOJA 3BGWA 4FFVA 2AIRA 5BUSA 1KH1A 1LJ8A 3TOXA 4F5DA 2IXTA 3T95A 3WR5A 3ZE0B 1DADA 3TLMA 1NMQA 3FHOA 1IK4A 3IIMA 2XYRA 3JQBC 4O29A 5CNIA 1CE8A 2QYSA 1D04A 3CV3A 4HB0A 3P26A 5DDIP 3VYRB 3NC1C 5KNCA 2X77A 1KL7A 4IHJB 2J08A 4CEIA 4FGJA 3RT7A 1CEQA 4W5TA 2G70A 1NT4A 4GFDA 3HB1A 2G25A 1W36D 3VSEA 4JBGA 3IXMA 1NLZA 2W83A 4BNDB 3F6CA 3NO4A 1LC0A 1MA3A 1BAPA 3G8BA 4QDOA 1PZEA 2HJWA 3R76A 3AUKA 3L4BA 1SD1A 1J33A 5TARA 4J3JA 1CZHA 2YOFA 4M7OA 4MEAA 4R7ZA 5GAJA 1VIYA 2OV8A 3DLAA 3X2FA 1SCUA 3EA5A 1MQAA 5AK3A 2VYQA 1AMUA 2Q49A 3PJGA 4N39A 3RT9A 4DAEA 4YFYA 3LC2O 2IOQA 3MCWA 4NSNA 4RNCA 5K6TA 3ISVA 3NBAA 1JKJB 2RGYA 5CEJA 3H2BA 3H1PA 2GEVA 3JAWB 4H0FA 2XWPA 4DWWA 2PBFA 4MWEA 3EXAA 3KOMA 1VJ5A 2B3TA 1K6IA 4DNQA 3SIPA 2YHUA 2GYVA 4B3HA 5B3LA 4U2BA 3W0LB 4NG4A 1VPTA 3JYNA 4MMZB 2YVQA 4QGBA 1NFQA 2SKCA 3N5CA 1JR3A 3ROQA 4W9MC 2JJ8A 3WLQA 5JT1A 3GEMA 1G3IA 2AMJA 3IJRA 3KO8A 4C4TA 4NBVA 1SOVA 3DVAB 4C0SA 2WKQA 1R0SA 1I4DD 1CD5A 1M6HA 2QM0A 3OBBA 1MUUA 3NANA 1XYVA 1EH5A 1DFIA 4DLNA 1GGMA 1OLXB 1ISJA 2DU8A 1JQKA 2EYQA 4X00A 1DBPA 4U3JA 4YRPA 4WXEA 5IWCA 1G1MA 4HQKA 4R71A 2IYVA 3U60B 3ZJTA 4YH1A 1DQSA 2CXHA 1X9HA 3EIHA 2WVJA 4BV9A 1DDOA 1Z29A 4N48A 3EIFA 1CS0B 2VPIA 3IUBA 3KJHA 3E0QA 2FKNA 3FNGA 4GAEA 4O5OA 3EXHB 3FNRA 2XMDA 4TS4A 1I6KA 1UBNA 5H4GA 1O7JA 4L74A 4D8UA 4MULA 3GA0A 4O08A 2V3VA 1KOJA 4GQBA 3K94A 4Q1VA 1F6BA 1A9RA 1JT9A 3DOEA 3GNQA 3I9MA 2P4UA 3OPYB 4IQFA 4WK4B 4XJVA 3WDMA 5C32A 1DIRA 1UOPA 3X2SA 1P5RA 5AOAA 1LPSA 1RJDA 4E33A 1XKLA 5MN4A 4R4JA 4F12A 3MINB 2XMCA 1DEHA 1DMRA 1M7BA 2W6PA 2CFOA 2Z6VA 3M5WA 3QEOA 1NWCA 3QPVA 4RM3A 4KHPB 1TE2A 4NVRA 4F3YA 2N75A 2EJCA 3PWKA 4REMA 2A9FA 4FXPA 2EBUA 1J2EA 1I4WA 2CVHA 4HJXA 4J0KA 4XYLA 4XPIB 3LDFA 5BORA 4E15A 3WWEA 1Y1LA 1KI7A 4JQOA 1RPNA 2D0DA 2GI4A 3TE6A 5B7PA 3BMCA 5EC8A 2EERA 1P62B 5ADVA 3PEYA 1LF0A 1PQWA 1YUNA 2RGNC 2WUWE 3SC3A 5K0NA 1T2CA 3KOWA 2QENA 3S5JA 4Q7KA 5DN9A 3OQOA 2DJ5A 5KUTA 2VJLA 3IP3A 4JJZA 3VYTB 1I3NA 1SA0B 4P38A 4BQEA 5JMWA 2H2WA 5IBRA 3UHAA 2JLWA 4N5NA 1MXFA 1IK6A 1TT7A 3TL2A 4ARZA 5LIPA 4JLAA 2JLXA 2GN9A 4TN1A 3GXOA 2C03A 2YWJA 2AB0A 1JSCA 2A9OA 2QGNA 5EJFA 4BWVA 5F7OA 5KREA 1FJ2A 4XQGA 4C43A 2CJPA 2BKEA 2VC2B 1WTAA 4U7JA 1K5HA 5DYTA 1X86B 2FPPA 2DPMA 4J94A 2QYTA 2FRDC 4Z4QA 2GDZA 3ZGNA 3EHDA 3O8BA 3FJYA 2B21A 5PNTA 5JYBA 4D97A 4EGAA 2J5KA 5HVNA 5KTPA 1GPWB 1E79D 3M7IA 4P81A 4NQRA 4F6LA 5C18A 2CSXA 4P4SA 3JZFA 1B6RA 3SLKA 1SJ9A 3TM4A 2PGNA 4KPFC 4C07A 2IIQA 1E3LA 3IIJA 3RVQA 4B6GA 2IGTA 4B3XA 4BKUA 2HHLA 4HDQB 2FW9A 1N3LA 3HXKA 3PZRA 4H7PA 4IOLA 4JH0A 1EK6A 2RHRA 1CT9A 2Q46A 2B2XA 2QLMA 3BCRA 3GJ7A 3ESQA 2CJWB 2X3YA 4F2WA 2E6UX 3DO6A 2DECA 1L8QA 3L8ZA 2C00A 3U26A 5JCXA 1NR7A 2WNIA 4ZALA 3IH5A 4BAUA 2Y0PA 3FF4A 4CM3A 4Y2YA 1EXMA 3M3PA 2UYGA 2Q2WA 2NXWA 2B8TA 2F48A 1NNUA 4R41A 1ZSNA 1G5FA 1HSOA 1NQOA 3D8SA 3KYJB 1BD3A 1IWPB 2IZ6A 4H2DA 2AQIA 1QMPA 2G0TA 2KE5A 1GKUB 3G5MA 4PS1A 2XLBA 2ZSUA 5LUAA 1KK2A 1BVYF 3MUNA 1WLSA 3RVMA 4PVDA 3LL7A 3G0HA 4RAOA 3MBOA 1N7JA 1V95A 3JWHA 2UUPA 2C61A 3GXBA 3LYUA 1Y98A 4UNRA 3Q2OA 1XT6A 4WESA 4A8PA 1C0IA 1YB6A 2I9PA 4DQLA 4ZAGA 3LW8A 3QI7A 2YJ3A 1JNYA 5CDHA 1V0JA 4NV3A 4OXXA 4DG8A 1WSWA 4YN3A 2R79A 3PIRA 3DHYA 4TV8A 1U1FA 4D9JA 4Z2YA 5JCJD 3GRYA 2BRUA 3GZNB 3QWBA 5COQA 4B31A 4G97A 4UOZA 4WA7A 4AMBA 2NQ2C 4DGSA 1RRCA 1FFSA 3IP9A 3RBVA 1CZNA 4AIIA 4JA0A 1HK7A 2JBAA 3IHTA 3ECAA 3AY6A 4HYQA 3OOWA 2VQFB 4ZI7F 1PK8A 3FCXA 4RBNA 4GEGA 4HQ0A 3D3WB 4UM8B 4B3MB 3IO5A 1OYWA 2XMZA 4EAQA 2FPMA 4DEYA 1EFRA 3V2IA 1XP5A 5BQOA 4I5FA 3H7AA 3STTA 2IP4A 3JVUA 5JOQA 1AK2A 1E9EA 3AVXA 3H7IA 3UTDA 1ZHOA 1GZ7A 3BVPA 2F3QA 3FJ1A 4NS1A 3VR2D 1IIRA 3GGGA 2VI5A 3KAKA 3Q3CA 5F9MA 1FSZA 4ZHQA 2ZUDA 4UU8A 5I45A 5I7SA 1EYZA 2H9AA 4BMPB 5H02A 3B13B 4JP5A 1B8VA 1VZ3A 3E05A 1JG4A 4MYHA 4X44A 2YWDA 2XKJE 2FPIB 1MR3F 4RIHA 4Y2UA 3PB3A 5IM4F 5E2IA 1T3ZA 2R6JA 1VJTA 2AN5A 4BEJA 2IYYA 1FTWA 1SC3A 3N2KA 5IAGA 1G6KA 1Y8RB 4ESEA 2ZSIA 1NYRA 2QL9A 4H7FA 3TLBA 5ADUS 4X61A 5KYTA 3I2IA 1E5QA 2AR0A 4ZQEA 2O8CB 3O21A 1VMKA 3BJIC 2X22A 5LIRA 3ZWMA 5CHEA 4XVUA 4YRRA 3CO5A 4YXWA 2V96A 2OQVA 4G84A 2IVZA 3CH6A 3GQVA 3PXGA 2HMWA 3LPAA 1SKBA 5C80A 1J42A 4OOFA 4YDSA 5CT4A 4BGVA 5B5SA 3X1KA 1R4NB 4BUJA 5JTUA 4B8YA 1G8GA 2KBEA 4G07A 3KPWA 2J0SA 3Q3HA 1NUQA 2A8YA 1KFEB 2BW0A 2GAJA 3EOZA 4HN4B 5CNMA 3ML1A 3RRYA 2PBRA 1AUQA 2PS0A 3DVLA 3CF6R 2JLZA 1C3JA 3O1LA 4OFWA 4WCFA 5D86A 5AKHA 5K0TA 2JH9A 2AZMA 1J1UA 2JFXA 1NATA 4IP0A 2QDXA 5CP8A 4Q03A 5EQFA 1TKRA 4ZVLA 3UMYA 1N8NA 3T9EA 3P19A 4CM4A 4Q4DA 1DAPA 4N5DA 5DM60 1QG2A 2BUCA 1SZJG 2D13A 2PMWB 4YJ2B 4YCJA 1RIIA 5DGHA 3WYFA 2CSUA 1U8XX 3TD2A 3IRUA 2ZJ3A 1QO7A 2W6QA 3QFHA 3G9XA 5GOZA 4KFUA 4KXXA 1UMKA 5D5QA 5DHAA 3NCTA 3NPAA 4IX9A 3SDZA 1WKBA 1WXQA 3BQ9A 4ADSG 4MW5A 4GZLA 3SYNA 4AULA 2I8LA 5DNEA 2R1TB 3GQBB 4CV3A 4MKIA 1CY8A 1H2XA 2C3YA 3T15A 4WEQA 1TTTA 2QW0X 2Y8EA 3C1UA 1RSZA 5DYWA 3SS7X 5JO0A 4HRXA 1CQPA 3U44A 3JD4A 1VLLA 1GUBA 2AK2A 3FDFA 3AHCA 2HU5A 3TIFA 1D8TA 3EEFA 2W2LA 3H86A 4IUBS 1NSFA 3O9VA 2ZJ5A 3UGTA 5DM70 1VG0B 1REQA 2XPCA 1WDWB 4LXTA 2Y0CA 2Q9CA 4MQ5A 3U56A 1XU4A 2FMKA 1DBQA 3N53A 4XFKA 4E07A 4JI3B 1HQYE 1LWOA 4HAXA 4WLFA 5AOBA 3I04M 3VI3B 4QTTB 3E58A 4L50A 4UE3S 3KHKA 3O8RA 4KDCA 3WFZA 2I6GA 1K4MA 2HSGA 1Z4JA 3KLPX 5AYVA 1RWPA 3RC2A 1JIXA 1SIBE 1V16B 4ILKA 2AJDA 1R6DA 2C07A 3CG4A 3R3UA 2DT8A 1ORRA 1N5OX 4ZKDA 4L02A 1S8OA 3VNAA 1Y4AE 1VTKA 3IUPA 3C6YA 1IHUA 3RUDA 2REQA 2RAFA 4MKZA 4QASA 2HO4A 1JQ3A 2OBLA 3AVPA 3O0TA 2YIJA 5MHTA 2C9ZA 1K97A 2NZUG 1OLOA 4H1TA 3SEZA 4AYXA 2GERA 2VWPA 2VPTA 1LPPA 2ZSJA 4IO1A 3K0FA 4AG3A 1Z4IA 4EENA 4H3VA 3T7DA 1C9YA 4RZHA 3IJPA 4DCGA 1TAQA 1SHUX 2WIDA 5ALQA 3QE9Y 2VP6A 2XQGA 3JX9A 4A1FA 2XF8A 2QRNA 3ZLBA 4I1PA 1QHEA 1G21A 3EW9A 1K66A 1ID8A 1WWKA 3QHAA 2C31A 4XDZA 3AVVA 3PWSA 3W7VA 1R9GA 1U8CB 1Z7EA 5HFJA 3I5AA 5FOSA 5TS3A 1NOIA 3COWA 4QOGA 1OOEA 1R3DA 2CFCA 4BNKA 1IOZA 2WU4A 3KQQA 1P9RA 2IE0A 3AEXA 3L7BA 1E9RA 2Z8YA 3QENA 4HWRA 4RK7A 2QD5A 5AVSA 3DEJA 1V8PA 3FYSA 3GCWA 3IDQA 3Q6IA 2WFLB 3JWGA 4NDAA 2ABWA 2J33A 1ZOIA 1B93A 1XJCA 3N9IA 1VMIA 3BHIA 3DKPA 5AVUA 2W7TA 1LSOA 4EKEA 4X1KA 3FPGA 5DNWA 2DH6A 1HYQA 1Y5MA 2HRBA 3NCHA 3O4IA 3W8FA 1X8JA 3M5PA 5KX5A 2JIPA 3FOFC 3QLTA 1GKKA 1G42A 1LB1B 1MO5A 1KTVA 4ZARA 3KJGA 2DUUA 4B73A 4Q4JB 2QTVA 5SZKB 3LSYA 3UMMA 3K0SA 1FP4A 2CEAA 2W9XA 3TVTA 4H6WA 4TV9B 4NYJQ 1W0CA 3DFKA 3FG9A 3ZU5A 1WE2A 1I0LA 5CTJA 1PFGA 3SXJA 2HDNB 1N25A 4DREA 3FYUB 5CB4F 2JIBA 5C7IO 1RAEA 2C78A 1CUHA 1HDGO 4YONB 3WWOA 3K53A 5K5EA 4OHXA 5JARA 1T25A 2W6OA 4OXIA 5BSTA 3S27A 5ALYA 4YR7A 1UC5B 4RY8A 3A32A 4EX7A 4US2R 1JALA 4CLHA 2JK1A 4KC0A 1YU6A 1CJCA 1GTL1 2HPVA 2PGOA 3HU1A 5CURA 4HT3B 4QZVA 4B80A 3VJKA 3V7UA 4DA8A 3B2QA 4QRDA 4O33A 3Q1LA 3D6UA 5IAKA 5GWXA 3X1ZA 1JDBC 3F6BX 5BSFA 2IEDA 1O87A 3OJEA 1WIWA 1XBTA 1OT5A 2HJGA 4RJKA 2H52A 3KSBC 1R6AA 1UBTS 3EEOA 1CUXA 1R1DA 2IZ0A 1PJ8A 2QRJA 2WSSD 1ORIA 5CLQA 2PSSA 3WKAA 2X7JA 4M2LA 1UPXA 2E4VA 1OAAA 1QC5A 2ZIVB 3JQAB 1PO7A 4H7IA 3NHMA 3CF4G 1EP2B 4JVMA 4BNGA 1GGJA 2VYVD 1GQQA 4F60A 2CYBA 4WFIA 1P7VA 3GRPA 3O84A 4EB6A 1DO2A 3OCCA 4XVRA 2VSYA 1YHZA 1FFXB 2XE8A 3LQ2A 3T35A 5LQDA 4YRGA 1X1QA 4IINA 1X94A 3FRIA 3KT3A 3MM4A 1A9XA 4C6SA 2LKDA 4RFVA 4X66B 1CETA 2BE7A 3HHPA 4WLVA 5BMVB 3FOZA 1QLWA 3GJZA 1WKVA 3QLVC 4RF5A 4DN6A 2R25B 4DMCA 4XWWA 1C7ZA 1G19A 3SF8B 3THWA 4B74A 5TQ0B 5HP4A 2XB2A 3EDYA 4CMIA 1MH9A 2MDTA 2CDCA 1NVMB 2J0UB 3U7EB 5HRAA 4AY4A 1XVIA 1LI5A 5JJ5A 3ZHOA 2WVAA 1RT9A 2B4QA 4MJLA 4U4AA 1I36A 3GJ3A 5CEFA 1Z3CA 1TUEA 3RYCA 1NVDA 3F7MA 4FJ2A 4GZ5A 4TPKA 5DHSA 5A6SB 3ZEIA 2V59A 1H2WA 3S70A 4BJHB 4IVNA 4F2PA 1I4EB 2D0IA 1B8PA 4LXGA 5C46F 2XLCA 3I23A 5JAIA 1DAIA 1W0KA 1M8FA 5FYQA 3GLIE 3A05A 5AVQA 5AT1A 4MQEB 3NFRA 3KOXA 4KGZA 3TNYA 5BQ3A 2IS4A 5JXIA 5FTMA 3IQDB 3UAOA 4IH4A 4PYKA 1E7MA 1BIFA 4ZICA 1NW8A 1Q95A 2V4ZA 2ZWIA 3PKIA 1KYWA 4IRMA 2MU1A 4F3KA 1Z12A 4ECEA 2BGIA 4WK2B 3V80A 4BX2A 1WRBA 4NE9A 3RVSA 2XI4A 2R8EA 3GI1A 3RKRA 4X8MA 2EDAA 2EFHB 4KVZA 4XVHA 3RSGA 2G9VA 1P1IA 4EELA 3KKOA 4AW9A 3PENA 1CIVA 2QZ4A 4IY1A 3U4QB 3ZK8A 4LJ6A 1LPMA 3SIXA 2A9JA 1UDAA 3B6ZA 2VWQA 4P2GA 1YUBA 1N6KA 3OZSA 4XCVA 3V8NA 1HNZB 3KE8A 2B20A 2ZM5A 1Z0SA 5KC8A 4GP9A 3THSA 4LSWA 4NCKA 3I28A 4YT8A 1ZMTA 4I9UA 2FFQA 4MWDA 3HLYA 3KQVA 3DPUA 5G0SA 5U4QA 3TQIA 2O8CA 4MVJI 5I9TA 1YE3A 4C2TA 1CIJA 3M6UA 3GY0A 4JYPA 1AB6A 1Q14A 1P5JA 3NVAA 1TYDE 1WABA 3GLFE 1L7BA 1BDBA 1OA1A 2HGSA 4KQKA 1KEEA 1K8XB 9MHTA 1U0TA 3LS2A 5F7JA 2J3IA 5B6IA 2Q9BA 3I1IA 3BG5A 1VLVA 3WOHA 1NRIA 4IVRA 5ALLA 4N6NA 1KP9A 3VZRA 2GF2A 1U3FA 1JJVA 2P9ZA 1PFUA 4UNIA 2L17A 4NKRA 1VIVA 4B17A 1XD8A 2FHPA 2HA0A 2XMBA 5FD8A 3BFPA 3O3NB 2VP3A 3V1UA 4FDTA 1D6MA 4L28A 1I3CA 1LLQA 1ZICA 2AI3A 2R1ZA 3IODA 5AKJA 5ALEA 1C9KA 1TJ5A 4MRAA 5A06A 2G1UA 1I1OA 3IPXA 4HDNA 2Q3JA 2NUTB 3D4BA 2C3MA 1QNLA 4QYTA 4X7PA 2QRQA 4AY3A 2WAOA 1E0SA 1RHQA 2IZ1A 3AIKA 1U11A 4J49A 3B7WA 2JJMA 3AU8A 2PGDA 4DLVA 4ZMBA 2PT5A 1ZNXA 5K51A 3WHPA 4EDFA 2OKCA 3I72A 1F6WA 2GPSA 5CXXA 5BV8A 3WLNA 4DC0A 3HUEA 2F67A 4JJ8A 4WY5A 1SUAA 2SBTA 2DQSA 1J6UA 1W4ZA 4UZSA 1DCMA 1O6BA 1IHPA 3N2LA 3RK0A 1OB5A 3F3YA 3B9RA 4GMXA 2GPJA 2NUBA 3GEPA 4AG5A 5ALOA 3LCJA 5HG0A 3WMGA 4LE0A 1XTUA 4YJ2A 4ZOLA 3VPSA 4HN2A 1QDEA 1KZ9A 2EWMA 4DM4A 1DXQA 4E94A 1HFJA 2HWWA 4ZTUB 1LK7A 1W85A 4NOMA 1PYDA 1NXPA 5A9RA 2VLIA 2EFDB 3AJEA 2OESA 2DHCA 3D3EA 2HPZA 4OXNA 5C4IA 1WZ2A 3KOZA 1HZZA 2QTMA 2CLOB 1A1SA 1KO4A 2P27A 2C2ZA 4DIFA 1I0IA 2JKVA 3QBJA 4KQ2A 4HDOB 5KAMA 3B7GA 1F2TB 1IEXA 4PQFA 4RPIA 5CH5A 4K9DA 1RXIA 4MQFA 2C98A 2FWIA 4IBOA 4GI3A 4JBYA 5IKEA 5D5PA 3OC0A <