5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
2VZ8A 3IUPA 1BRMA 4PLWA 5FFFA 3S2EA 1YQDA 2ZB8A 1UXGA 3G1UA 4Z0TA 1K3TA 2O3RA 1U2DA 3PHJA 3LVFO 3IDSA 3VH1A 5A3JA 2EGHA 4R16A 3DC2A 3ON5A 3V5NA 3KTDA 1B8VA 4WE3A 3ZU5A 2O4UX 5ADHA 2X0NA 2VRBA 1EBUA 4ALNA 2A35A 2OBNA 3EC7A 4RPLA 5IN4A 2YJZA 1YB5A 4IJVA 3JYOA 4HADA 4WECA 1VC2A 3I9OA 5IXSA 4DBZA 2W4QA 4BO8A 2W2LA 1SB8A 1SAYA 1Y5MA 2X58A 3MEQA 3ZV3A 4BO3A 2AQHA 4XJSA 4DIBA 3TDKA 1DBVO 5DBFA 3T4XA 1YXMA 2BELA 4IXTA 4YAEA 1PZHA 1DC6A 3WYCA 3FPLA 4NH4A 3GVIA 5ENDA 4WEOA 4IDCA 2EJWA 1GUFA 4XRGA 2P9CA 3DO5A 1L7EA 4BNTA 4YJDA 4TRNA 3TPCA 1B2LA 3NDJA 4BNHA 4Y6RA 5JMWA 5DCWA 3DAGA 1E92A 4PN3A 4J7CA 4GKBA 5I7FA 1LLCA 4W7IA 2C5EA 5A06A 4DQVA 2OL4A 4J4TA 4YQZA 3VZSA 4DRYA 1O89A 3OEWA 3U0BA 2P5YA 4KTVE 2Q1TA 2ZB4A 1LDYA 4HFNA 2R00A 3DFZA 4BV9A 1HE2A 2Q1SA 2QZ9A 3AY3A 3PK0A 4CMGA 4CM1A 1ZZEA 2NTVA 4R54A 4FJ1A 2BGMA 4I5FA 5T8KA 5HTOA 2JJYA 1P1JA 4ND4A 1LUAA 2Y0DA 4YDRA 4E2WA 3H9UA 4L75A 2I67A 2V7PA 1B8PA 1PZEA 4YT4A 4R1SA 5IN5A 5JW6A 2HMVA 2FOIA 1T1RA 2AMFA 4U0JA 4H15A 5AXDA 1KC1A 2D5AA 3FHLA 3JYNA 5DBGA 1GCOA 1E3WB 2BI7A 3BTUA 2PD4A 2Z1MA 5JPIA 3VOSA 1DLJA 4CR7A 3GAZA 1N2SA 1PIWA 1YOVB 3GMSA 3VKVA 5BSGA 4CMEA 3G0OA 4BNXA 4DIFA 4YAKA 1GZ6A 3LF1A 3ZHYA 3H7AA 4CLOA 1LDGA 1H93A 4I1IA 3KYCA 1KEUA 5I8ZA 2DTDA 3TOZA 3RSHA 4YRDA 4F3YA 4D41A 2CZCA 4XKJA 3ZH2A 1ZUD1 2Q45A 1UXIA 4I08A 3IS3A 2B4TO 3NT5A 1YOVA 3P5SA 4NFSA 5JO9A 1GQYA 4Z0HO 3EYWA 2JD0A 5AXBA 4GLOA 2ZJ1A 1E1NA 3UCXA 1ISJA 3X2FA 3LC2O 4LK3A 1NPTO 5I9NA 1YQXA 4ESOA 4WGGA 1B7GO 5JLAA 2NU6A 1I8TA 4XB1A 1JTVA 2EKPA 3L9WA 5ENVA 1B15A 1BWSA 2PKRA 2FR0A 5IDXA 4RPGA 1G1AA 3PQEA 3DXFA 2J5QA 1Y9AA 4XIJA 3FR7A 1BSVA 1XQ6A 4YXFA 3ASUA 3GK3A 4UREA 4RDHA 1DHTA 5EERA 2NVWA 2O23A 4Y9DA 2QRLA 4FJ2A 4RLSA 4A27A 4J4HA 4BKPA 4XR9A 3R1IA 3I4CA 5T64A 3ZWMA 1R12A 4ALKA 2BD0A 2ZQYA 4M89A 3O4RA 5DBIA 3ZV6A 4ZQHA 3MJCA 3DFUA 3N74A 1GPJA 3DZJA 4GQAA 2IEBA 5COBA 2FSSA 4EUHA 4M49A 1AGNA 4MINA 4FGSA 1ZXLA 4G2NA 4J9UE 3W8FA 3DONA 4IY1A 1E5QA 1XU9A 4A7PA 1HLDA 3R3JA 4RJTA 2GSDA 1IULA 1PWZA 5EPOA 4RPJA 3H9QA 4U8GA 3GLQA 5ITWA 1Y5RA 4CUKA 1SB9A 3V1YA 4W6ZA 4CM3A 4WCFC 1KC3A 1O9BA 2H9IA 2QZZA 2YQ4A 2VHZA 4BNMA 1P1IA 1NWHA 4AVYA 1VL8A 3INRA 2VOEA 3PRJA 3K5PA 4U7WA 2I3AA 3LYLA 1ONNA 4Z6KA 8LDHA 2VYND 2XOXA 1I2ZA 1Y8RA 4YJGA 2NACA 4B7UA 4C7KA 4XD2A 4CUJA 5L51A 5ILOA 1ZEJA 4JJGA 4IDAA 3TSCA 4B4WA 3OM9A 4WOJA 3KUXA 1MX3A 1LRLA 1P1RA 4XZ3A 4A2CA 2O7QA 1LRJA 4UVIA 3ZW8A 4QO8A 5JE8A 3EZLA 3GA0A 1YE3A 2HAEA 3P2YA 3LT0A 1Z7BA 3SVTA 3ZNPA 3VDRA 4N7RA 4AJOA 2FR1A 1KYQA 2I9PA 1MP0A 3C8MA 3QRWA 3PJFA 1O0SA 1LLUA 1SEVA 3DHNA 1H0KA 2WE8A 4UVHA 4CV1A 4R5MA 5THQA 1P1KA 3KYBA 3VHRA 2DFDA 3TZQA 1HDCA 4AJIA 3KYCB 2IZZA 3CZMA 2ZTMA 4AJ1A 2I99A 4KZPA 3W4KA 2CD9A 2E6UX 3FWZA 1YONA 5JY1A 4ZA2A 3TZ6A 2FHSA 3H2ZA 5DP1A 4TRRA 4UVDA 2Q1WA 2NVUA 1R66A 2QX7A 3ULKA 1VLLA 1PSDA 1LQTA 3O03A 3RUHA 4CQLB 2BRUA 5U4QA 4YAGA 2UUPA 3V2HA 1HETA 1D3AA 2BF7A 2Q3EA 3WGOA 3WGZA 3ZU4A 4DPLA 1J4AA 5G4KB 1P3DA 2W8ZA 4BIIA 4BGVA 3FTNA 1H5QA 5DOZA 1LDMA 1DFHA 4CMAA 3D4PA 2Y1EA 3H9EO 4ZQEA 4DQUA 2X86A 2EHDA 3AY6A 1Q1NA 1WP4A 2OUIA 1DAOA 3ENNA 4BKOA 3AUAA 3ZWAA 2NADA 1ARZA 4HFMA 3RKUA 5G0VA 4LISA 2HQ1A 4YAIA 3WSWA 4UEKA 4AFNA 5I8WA 1A7AA 3HHPA 3U09A 4L8VA 1ENOA 2VN8A 1ML3A 5A02A 2Y66A 1U9JA 4R1NA 4EUFA 3Q9NA 5IZCC 3FR8A 3OECA 1V9LA 4ZRMA 1FDTA 3QVXA 1L1FA 2NU9A 4GX2A 4IM7A 4MVJE 1NR1A 1XA0A 1NFQA 4B7CA 2D2IA 4OAQA 2PK3A 2JAHA 3GFGA 3D0OA 3NUGA 2XPCA 1MFZA 1BW9B 3PYXA 4WCDA 3GNSA 2VHYA 1P9LA 3RAJA 5L4SA 1A27A 4WLNA 1V8BA 2Q2QA 3DBVO 3ZWVA 3DZKA 2VHWA 1Z45A 2AEJA 4JGBA 1BTOA 5JCJA 2F1KA 3VKUA 2WYVA 3B6ZA 1E3WA 3A28A 3ICCA 1G0OA 5TSDA 1LSUA 4NJMA 5KJEA 1ZMOA 3QWHA 2PV7A 3ZWNA 3HDHA 4NBWA 4QFCA 4E5YA 1VE9A 2HMTA 2VT3A 2GRAA 2G17A 4QTZA 1G0NA 5BNIA 2YYYA 3TN7A 3GN2A 1N5DA 3CPSA 2X7HA 4QEDA 3RJ9A 8ADHA 3S2IA 1W0CA 4YEDA 1A5ZA 1IL0A 3PYLA 5F3RA 5KVCA 1PX0A 2V6BA 4IXWA 2GZ3A 2CF6A 2G0TA 1N92A 3TNLA 1UDBA 2Q2WA 1DIAA 1EE9A 3VC7A 3E1KA 5KWEA 1SZJG 1PGJA 2DBZA 4DMMA 2VZ0A 3UF0A 3F5SA 2J3IA 4FJ0A 2WDZA 3NGXA 1Y6JA 4JP2A 3LLSA 1YJ8A 2IRWA 1GCUA 1U8FO 2GN6A 3WDSA 3KV3O 3WXBA 3GVHA 2O48X 1UR5A 1ZIDA 4XQCA 4OIMA 2ZB3A 2O3UA 3KXDA 4TROA 2JL1A 5EQFA 2DM6A 2BLLA 2DAPA 4BO0A 1T2FA 1I01A 2AEMA 3I9NA 3KBOA 1V6AA 3AW9A 1YKFA 4RCVA 2O4CA 1HKUA 1QG6A 3HG7A 1GFSA 4MJLA 2V6MA 3O8QB 1CEQA 3CH6A 2VYNA 1E0DA 4GH5A 4L4SA 4K28A 3ETEA 4N18A 5KOIA 5JDCA 2G5CA 5T67A 3GH3A 4JX8A 3HB4X 5T5QA 1PQUA 3V1UA 2FRDA 2YDYA 1B26A 4M87A 3WOHA 4BNWA 4AJKA 2C2XA 1E7RA 5G2OA 3G49A 3JYPA 1M75A 1NVMB 4YJGB 1N9GA 5CG1A 4JN6B 2ET6A 4YJFA 4ND2A 4PRLA 2B4QA 4J0FA 3I9KA 4BQRA 4M1QA 5GMOA 5K6AA 4YRBA 2ZIZA 1P44A 5EMHA 4FB5A 4HXYA 5IDYA 4JNKA 2C0CA 3TL3A 1B0AA 3NRCA 2JKVA 5KKAA 4BO6A 1E1MA 3BXXA 2RCYA 3HQ4O 3HWRA 4J49A 4OXNA 3K8ZA 3BA1A 4S3MA 1Y8QB 1A9YA 4R4JA 4WUVA 2HU2A 2JHFA 5TJHA 3QA9A 3GGGA 3G3EA 2NU7A 4ALLA 3QWBA 5DP2A 2VHXA 3JQ8B 4CQMA 1KY4A 3PHLA 5U1PA 2DPHA 4MVJF 3RJ5A 1SOVA 5A03A 5C3MA 3JQCA 3JD4A 5K9ZA 5JAQA 3OICA 4RGBA 4PG8A 5DCYA 4II2A 5TRTA 4CLRA 1BMDA 5C7LO 1JAXA 1DPGA 1R4MB 2EEZA 4MIEA 3WQSB 1A72A 5JDIA 1T25A 4FQ8A 1C1DB 4CR6A 3AOEC 4RDIA 4IJUA 2GO1A 1UZLA 5EL0A 4NFHA 4XGNA 2BI8A 5F5LA 1R16A 3HNPA 1QV7A 4P22A 1LX6A 3VPGA 5A5FA 4EYEA 3SC6A 1XGKA 1Q0HA 3I83A 1I3MA 5H83A 4D44A 4GWGA 3WMXA 1F12A 1F8GA 4B79A 1DC5A 3AI1A 1SEPA 3GVPA 1A4IA 1BXGA 4I5GA 1EUZA 3ROPA 1GQQA 4CM6A 1K6JA 3IUSA 4LMRA 1U7HA 4NBRA 4B4VA 4OKNA 3GT0A 3WMWA 1KERA 1GY8A 1UP6A 3PFFA 1JAYA 2J5RA 4MIYA 1ORRA 1P0FA 5TX7A 2X22A 1V0JA 1LBEA 1UZNA 1DHRA 3E5MA 5TIIA 1HXHA 2VWHA 4EEZA 1ZXBA 3I52A 5HRUA 1QYWA 1ZK1A 3VVBA 4UEOA 1NTOA 1GV0A 2EWMA 5TF4A 1CERA 3A06A 4E32A 1NXQA 4L74A 3IJPA 3JQDA 4WKGA 3KSDO 2CF5A 4PCVA 5CEFA 3ADOA 4WJZA 5AOVA 4B4UA 2P4HX 1WAMA 1PEDA 3Q6IA 1ULSA 2UYYA 3SX2A 3PI7A 4MIOA 2E4AA 2JCXA 4CODB 4W9NA 1BGVA 5T57A 4JCOA 4PVDA 1RYEA 3CXRA 4EJ0A 1YVEI 4UVGA 3W4IA 4EBFA 5AVOA 1J49A 1Q0LA 1C1XA 2AQ8A 2PD3A 3ZU2A 4EZBA 2B5VA 2EG9A 1JDJA 3WIDA 4LW8A 2EGGA 1E3JA 2B37A 4J9VA 2TMGA 1UUFA 5GZ1A 3BMCA 4KWIA 1YWGO 2W2KA 4BKRA 3K73O 3E9MA 3U5TA 4CM4A 2RBEA 3OH8A 3EUWA 3AM5A 3WJAA 2ILTA 3PHIA 1NQOA 4KQWA 4ND1A 3RROA 3B1KA 4XRRA 5TS3A 2RHCA 1ADFA 3VDQA 2BFOA 4ILKA 4KP7A 3OP4A 4FFPA 2PD6A 1T4BA 4IQ0A 4YT8A 3PEFA 3NAQA 4C4OA 4LCJA 3FTPA 3PZRA 5KKCA 3OIDA 1HE3A 2AXQA 3WJ7A 1HSOA 4L4XA 1ID1A 3ADPA 3DDNA 4HBGA 1HYHA 2UVDA 5IZ4A 2C20A 3T7EA 3ZI0A 5TT0A 4S1VA 1GEGA 4G65A 1X7DA 4DMLA 4YB8A 1CYDA 4J43A 4JLWA 3IOYA 5GY7A 1CRWG 3W8EA 5KCZA 3TF5A 4E0BA 4FDAA 4A26A 4TKMA 3VPSA 1KEVA 1EDZA 4J1QA 2EERA 4GSLA 4BNKA 2E82A 2QHXA 4P8RA 4FC6A 1JKIA 2GF2A 1WVGA 4JBGA 4PG5A 4PLZA 4E5NA 3FI9A 3AUTA 3JQAB 4ZD6A 3IAHA 4I9UA 2C7VA 3D5QA 3KETA 5CDSA 3OQBA 1PGQA 4BNNA 4B3IA 2A4KA 1TI7A 2O3TA 4TWRA 4KOAA 5JBIA 2C2YA 4J4BA 4CLEA 5G0WA 4OOFA 4ZICA 1DO8A 1I36A 4EEXA 5CDTA 4NK4A 2B4RO 4DLAA 4YBZA 3HDYA 2C07A 3Q9UA 3G1TA 4I5EA 4RPHA 4O0LA 1JKFA 1ZK0A 3ZWXA 3MJSA 4WLFA 2DPGA 4Y6SA 4DQXA 5KVVA 5JCXA 3OHSX 4FS3A 4JXKA 3D64A 3RKRA 2NM0A 4CMEC 1UXJA 1DC3A 2W2KB 3OQ6A 1LDNA 5A9TA 4OSPA 3L07A 2I65A 2QYTA 1NQTA 4HKTA 4BNLA 1YL6A 3HDJA 5BSHA 1YRLA 1C1XB 2CMDA 3GG2A 3BMOA 4XQGA 1DXYA 5BR7A 3INTA 3QP9A 2X9GA 4YPOA 3OJOA 3AM4A 1B8UA 4FPXA 1IHYA 2YQ5A 3GNTA 5B1YA 4IMPA 5JSFA 2V6GA 1E7WA 2FWMX 5A9SB 1PJCA 3I23A 4KTTE 5ER6A 1PQPA 4WASA 3GMDA 5EJ2A 4CQMD 5F1PA 1ZMTA 4GL4A 4EJ6A 2ZQZA 4QXMA 2WMDA 4BNIA 4XGIA 4YWJA 1FK8A 3I6QA 2FN7A 3MTGA 3QWFA 1I24A 2WJPA 2X5KO 2J5KA 1WLYA 5G0UA 2VOJA 4WCFA 4BO1A 2JCVA 1YB1A 3DBHA 2PWZA 3FNFA 1EMDA 1HL3A 3HFGA 3ZGYA 3F46A 4Z3KA 3C1TA 4BO7A 1GUYA 1M76A 4IS3A 1LSJA 1SNYA 5L9AA 4PLHA 3H3JA 1KY5A 1P1HA 2OOSA 4YJHA 1LXCA 3RWBA 2NV6A 1WW8A 3WS7A 1T1SA 1XLTA 2PGLA 3IP1A 1DC4A 3JQ7B 3OEYA 1MG5A 2Y1FA 4CM5A 2CVOA 2JHGA 2H63A 3PLRA 3WG9A 1ZEMA 3ABIA 3BHJA 3I4FA 4IS2A 1F17A 3VPFA 3M6IA 2VZ9A 2I66A 4ZGWA 1MFPA 2QG4A 4PLVA 2DUWA 3TZKA 1GYQA 1KS9A 3RVDA 1JQBA 1SPXA 3WX0A 4NJOA 4FFMA 1ZSVA 4TRJA 3C24A 2ZTLA 4J6FA 4JBHA 4I8XA 1VKNA 5C7OO 4DYVA 4B8ZA 3U9LA 1HE4A 4KUHA 4E6PA 3EAGA 4ZN6A 2YY7A 3CTMA 5L3ZA 2GERA 3WSVA 2ZKLA 3O38A 3MWDB 4CMIB 2AQKA 1I2CA 1LEHA 2HK7A 1BDBA 2VNAA 1IPEA 3QW2A 1E3IA 3WWYA 1NVTA 4MDHA 4IGFA 4TZKA 5GZ6A 4A5OA 4G5HA 3PYMA 1X13A 5DNAA 5B37A 3T4EA 3JQFC 3WR5A 3RC7A 3BAZA 4GSKA 2NVBA 3BTSA 1X0XA 1K5HA 3FWNA 4J16A 4D3FA 2PZLA 1IYZA 1DB3A 3R6DA 1PJ4A 1GEEA 2IEDA 1ZSNA 3JYQA 1MB4A 3C7DB 1CETA 4ALIA 5CEEA 1EVIA 2ZATA 4IPTA 1VKOA 3LU1A 1YH3A 3QV1A 3SC4A 2C29D 2Q1UA 6LDHA 4A0SA 1GYRA 1RM5A 1NPYA 2NTNA 3MJTA 4NG5A 4AICA 3TFOA 3WBBA 3QHAA 4MVJI 3TRIA 3I6IA 4LVCA 1NQAO 3Q2KA 3V2GA 4TVOA 2G1UA 3JQ6A 4XYLA 3MCVA 3KVOA 2HRBA 3DMTC 2Y1OA 5FYDA 2PA3A 1EEHA 3IL2A 2I76A 3E5RA 3K96A 3MTJA 1KIFA 3PGXA 4IDEA 1EVJA 3U4DA 1OOEA 3S2GA 1GZ3A 4A03A 1U5AA 2VUSA 5JCJD 3O8QA 3DBHB 4XCVA 1FDUA 2X9NA 3GHHA 3JQAD 3PQFA 4LGVA 3IKVA 2SCUA 3K30A 1LDBA 1QYVA 4W4TA 4UVEA 4CLRB 1OC2A 3DWFA 5FEUA 4O5OA 3B1FA 5L7WA 2JAPA 1E1LA 4ZVVA 3QE3A 2VYVA 4HX5A 3PLNA 4GMFA 1KEWA 3DOCA 4ZU3A 2IDZA 3FF4A 1DAPA 1J0XO 2NNLD 5TT1A 2WEKA 3GVCA 1VSUA 1XKQA 3D1LA 4I9HA 1E3SA 3H5AA 4M55A 4NIMA 1KVTA 3K9QO 4JK3A 5FWNA 4IJKA 2HMSA 3D3EA 5IDQA 5L7YA 2QQ5A 4CM8A 1EFKA 4WLOA 3K2EA 1K6XA 1E77A 3DEYX 2BGLA 3QWIA 2ZCUA 3VPXA 3ZU3A 1IUKA 3ANNA 1PGPA 1J5PA 1CJCA 2O3JA 2EXXA 3PJGA 1U8XX 2Y93A 3WTBA 4MVJA 1JWAB 1SBYA 1Z82A 4U5QA 3C85A 4H3VA 1UDCA 4CMHA 3AUUA 3WFJA 3WGGA 1JU9A 1PL7A 2BFPA 1C3VA 3QVSA 2AA3A 1ENZA 1BW9A 1R0LA 2PH3A 4OKIA 4D79A 4ROSA 4E21A 5JC1A 1NHWA 2Y1DA 3AFNA 1AXEA 3CIFA 4D42A 4QQRA 4R51A 5JYDA 1U3VA 1UP4A 2EW2A 1EUCA 2NU8A 1QLJA 2DQ4A 1N8KA 4M54A 3M2PA 3LT4A 4B8WA 4URFA 1DDOA 3RU7A 4OSOA 3GFBA 1YBVA 5F1OA 3I3OA 3KLMX 2VWQA 2FP4A 3DZFA 3U4IA 4FCCA 3GUYA 3ANMA 4NDNE 1NP3A 4C7JA 1R37A 4KUGA 5L4LA 1LU9A 1JVBA 3I1JA 1R0SA 1LJ8A 4L73A 2I6TA 5ICMA 1NR7A 3GC6A 5CAEA 5L4NA 3ONFA 5LDHA 2DLDA 4DBVO 2PZKA 5DULA 1WNTA 2POQX 3IJRA 3ZWPA 4F6LA 1NPDA 5G0SA 4CMBA 5THKA 1PQWA 5A5EA 2QW8A 1PJ3A 4YCAA 2EKQA 5A04A 2WSBA 5IAAA 2PKQO 1XDWA 5A3VA 4E3ZA 4EITA 1DOHA 3PXXA 2CDCA 1DJQA 3N58A 4YACA 3MJEA 1YB4A 3QVTA 3RC2A 3GNQA 4IZIA 3OF2A 2Q2VA 3L6DA 5MDHA 3TOXA 5TLSA 2D0IA 3N7UA 1VJ0A 2DT5A 2O2YA 2YZ7A 3A14A 1VL0A 3UHAA 4BOYA 1ENYA 1M66A 4INAA 3ZV4A 1UP7A 4AG3A 1NFRA 1QYXA 3DL2A 5L95A 2ZTUA 1HDGO 2ZCVA 1IB6A 1EDOA 2HKIA 3OIFA 3JQ8A 3F3SA 3FPCA 3UICA 3A9WA 3H65A 4OHUA 1E5LA 2H5LA 3EDMA 1WDMA 4NU6A 4QUKA 1HLPA 1PU2A 3PQDA 3ONDA 3V2UA 1XR3A 4ALJA 4YA6A 5JXWA 3E9NA 2GLXA 1ONPA 1PL8A 2D5CA 5EESA 1Y8QA 3F47A 2BMAA 5TC4A 4FFRA 1H6BA 2G76A 3AFMA 4AJHA 3IC5A 2AW5A 3Q3CA 2UUOA 1T2DA 4P38A 4UULA 4IIUA 3C3XA 3RFVA 3EZYA 3INGA 4J1SA 2OXIA 4UUNA 3RUFA 2DTEA 1HE5A 3P2OA 3RC9A 5HWSA 4IDBA 2GN4A 4YT5A 2NTJA 1QYDA 2WWRA 5KJCA 2AHRA 2Q46A 4RPKA 5L45A 4YQYA 1HTBA 4CL8A 2CDAA 5DOVA 4NJMB 5T8KC 3U4HA 3ZZNA 2Q4BA 3K31A 1BXKA 1KVQA 1MC4A 2NLOA 3AM3A 3ZWBA 4WEQA 3I9LA 2IZ0A 3L4BA 3ST7A 2IXAA 3IMFA 1E7SA 2X0JA 5JAIA 4IGEA 1HEUA 4CUZA 3STHA 5HA5A 2BFMA 1DFGA 2W98A 3LC7O 4FOOA 4XR4A 4RLHA 3S2FA 5FF9A 1NFFA 5JO0A 1X15A 5BQFA 2IYOA 1ZVMA 2CFCA 3D3WA 3F5QA 1MUUA 1AE1A 3K92A 5AXCA 2PY6A 3Q1LA 3FBGA 4DTIA 3WICA 3NT4A 2VUUA 5B12A 2QRJA 1YBMA 2HDHA 2OBYA 2ZYAA 2DBRA 1NQ5A 2HK8A 4RVGA 1M6WA 5HS6A 2RAFA 1Y9EA 1W73A 5KVSA 4ALMA 2Q49A 1I3KA 2O2SA 3GRKA 2OZPA 2YV1A 5BNTA 4JQCA 2OORA 4PLFA 1OZAA 1A9ZA 4W82A 4LSMA 1E7YA 1LI4A 3M2TA 1E6EA 1H2HA 1K0UA 3F1LA 3R0IA 1KOLA 4WK6A 4RVUA 3GDFA 1JA9A 1F8FA 1NVGA 2OHXA 4BNFA 1ZFNA 4FN4A 4XX0A 5A9RA 3I9MA 4GX5A 1QRRA 3G79A 1HDYA 4BO5A 3MJVA 4PG4A 4R3WA 1DIGA 4B3JA 1I3NA 1EK6A 1WDLA 2XAAA 3ONEA 2BH9A 4Z9YA 2AEFA 1TT5A 2VQ3A 4OM8A 2O7SA 4Q3EA 3E18A 3B70A 3HE3A 3WGYA 1ZKMA 2UDPA 4W9NC 3PDJA 2HSDA 3PWSA 1HDOA 2X5OA 4NMHA 1DIHA 4XIYA 1R4NA 3FSRA 3RUCA 1H9AA 3JYLA 3HADA 1G6KA 1HT0A 1BDMA 1UZMA 2JD1A 1VM6A 4DPMA 5IDWA 4TVBA 2Z5LA 2VYVD 4N5NA 1B16A 1BXGB 1H6CA 1C0LA 1NASA 1OBFO 2X4GA 1EQ2A 3H5NA 3JQBC 2JFFA 4QECA 3RUEA 2J6IA 1ZK2A 4Q3CA 4DIOA 5CFZA 2GASA 2GUGA 4HWKA 3NDRA 3H9JA 3PGJA 4TRMA 1QLHA 2HJSA 1XEAA 1YO6A 2HMWA 3CUKA 3L6EA 5JS6A 3Q11A 1FDVA 4IMRA 2EW8A 4CL3A 4J91A 2GZ1A 4Y8VA 3S1LA 1SCUA 1U1IA 4QO7A 2GCGA 4XA8A 4OMUA 2YFQA 3GN1A 5EQDA 4OH1A 2Y1CA 4DYDA 4PLPA 4R3NA 3WIEA 4CM9D 4CLDA 1HZJA 3V8BA 3OIGA 3UVEA 3B1JA 1C0KA 4D0SA 3AU8A 2WTBA 1S6YA 3DBLA 1WZEA 1LSSA 1ZJZA 2YHIA 5COAA 3L77A 3GY0A 4CM8B 4XB2A 4IZHA 1PGNA 1LC0A 2PGJA 3C1OA 9LDTA 2QYSA 2X1HA 1QKIA 2ZK7A 1IPFA 2OGUA 4XEHA 4ZQFA 4W99A 4GX1A 4WNCA 2P9EA 3WGTA 1GV1A 4CR8A 1O8CA 4DGSA 4F6CA 2Y0CA 1YL7A 3QIVA 4RV9A 1DJNA 4O1MA 4PRKA 3PTZA 3VZQA 3DMYA 1C0IA 4AJJA 1MC5A 1PJSA 4F45A 1EFLA 3BZUA 1I32A 3CSDA 2QRKA 5CG2A 1GYPA 1H2BA 2JFGA 5A05A 1UH5A 1XQ1A 2EP5A 1HYEA 2PNFA 3COSA 1I2BA 2GNAA 1F14A 4OJNA 1P45A 1HDRA 2IXBA 2FPIA 2NSDA 1D7OA 4XYBA 1YL5A 4ZQBA 4PLGA 3ZHZA 1MXHA 2X0IA 3IIEA 3QSGA 1XIVA 2J3HA 5JYEA 3NKLA 4E2YA 1RWBA 4D43A 1VJ1A 4TMFA 4P4NA 3RCBA 4UUOA 3ITDA 2H1SA 3OJ0A 4BNYA 3ICPA 1O94A 5CDUA 1HSZA 1ZCJA 1EK5A 2NQ8A 1MA0A 4MO2A 5TNXA 2B5WA 4CLXA 4D46A 5K0ZA 4PZEA 2RH8A 4GGPA 5A4DA 3FNGA 3IKTA 1E7QA 1H6AA 3AOEA 3E8XA 4KWHA 3AOGA 1ONOA 2DFVA 2JD2A 4Q3DA 5ITVA 1LLDA 1X1EA 3PWZA 4LRSB 5FI3A 1P31A 3NTQA 1WZIA 1P0CA 1UDAA 2BHLA 4G81A 4ITUA 5JC8A 3L6OO 4OL9A 3GDGA 3V1TC 4AJ2A 1IOLA 3GGOA 5A9SA 2GDZA 3HUDA 4BQPA 1AUPA 4OXKA 1W6UA 1U4SA 1I3LA 4PLCA 5IFLA 2GR9A 3H3FA 3K2BA 4Q3BA 2IODA 3NT2A 4OGWA 4CJXA 5L53A 2PZMA 4J1TA 4RF5A 1YJQA 5KIAA 1YDWA 4J7XA 1QSGA 1JKJA 3WQRA 4GLLA 1NAHA 4DXHA 3VVCA 3DTTA 5J23A 1V3VA 4GMGA 4AL4A 3AUSA 3NJ4A 3SLKA 3UGKA 2C7GA 3EVTA 4DC1A 1UXHA 2D3TA 3L4BC 4MVJH 4WLEA 3WBFA 5JY6A 2J8ZA 4YTEA 2TMDA 1Q7BA 4LCEA 3QLJA 4BMNA 3D7LA 1U4OA 5I9LA 2HUNA 3JCZA 4MKRA 1T2AA 1QV6A 3HJAA 3KYDA 2FY8A 3BYZA 4NI5A 3SEFA 5T6BA 4CMKA 5LDGA 4BO2A 2C82A 1U3UA 1O5IA 3TL2A 3HZZA 1ZJYA 4E2ZA 3LZ6A 3GGPA 1BHSA 3RASA 2IYPA 4K1LA 1I33A 3EMKA 4Y67A 5JDCC 3HN2A 1M6HA 4NBTA 3U3XA 3FBTA 3UOGA 3ZNNA 2ZYDA 1EVZA 2OP1A 3WNVA 3GZ4A 1U28A 3QY9A 3GZNB 2CY0A 2P9GA 3SJUA 3H6KA 1C0PA 4GX0A 1IY8A 1U7TA 3DTYA 1M67A 4Q9NA 4HV4A 1J6UA 2WYWA 1GU7A 2FR8A 1C1DA 1XHLA 2PZJA 5F1KA 3RFXA 4R5HA 4LN1A 1SOWA 3UKOA 3MZ0A 5CPFA 1A7KA 3TZCA 3WB9A 2YV2A 4GVLA 4DL9A 2A92A 3OJEA 3FNEA 3ZNQA 5AXAA 2IE0A 2P5UA 2V6FA 1HRDA 1EBFA 4TZTA 5EN4A 3JQ9A 3KEOA 4RF2A 4BNGA 1TT5B 1DIRA 4IDGA 4DUPA 1OI7A 4MVJM 1LQUA 4J90A 4EUEA 9LDBA 1Q0QA 4L0QA 4OQZA 5H81A 1AN9A 4XWYA 4PG7A 5U9CA 4PFJA 3UCEA 1YDEA 1GPDG 4MVJD 4NU5A 4J2HA 2WD8A 2PTGA 3RFTA 2O50A 2WE7A 1KETA 1D1TA 1SMKA 4FW8A 5KJFA 1X14A 1SC6A 2VTEA 3ZNOA 4CM4B 4PG6A 3NTOA 3DZBA 1LA2A 4O6VA 4GWKA 1YS4A 1VJTA 4NBUA 1JW9B 4CMIA 5TQVA 4RVDA 3TJRA 1WPQA 3PHHA 1ZSYA 2R2GA 1TVEA 5F21A 1FMCA 1LNQA 4ND5A 3W6UA 5IJZA 1DLIA 4RVSA 4FIZA 4L76A 3D3WB 1KEPA 1Q7CA 5HM8A 4BO4A 5G4LA 1I0ZA 3C7AA 4XYMA 4EW6A 5B4TA 1WMAA 3PPIA 4IIVA 5ILGA 3BTVA 3UUWA 3WNQA 3BTOA 1FF9A 3OJFA 3PP8A 3WLEA 2H6EA 4JIGA 1P77A 5HS4A 3PHGA 1LDEA 3SJ7A 1MXFA 4P4LA 3F1KA 4GI2A 1Q7GA 1UXKA 4NBVA 6ADHA 1Z75A 1BG6A 1I10A 4MOWA 3E03A 4E30A 2XXJA 2I5PO 1V3UA 2I3GA 5IG2A 3ZWWA 3UCFA 1TA4A 3E9QA 3L0DA 3JD3A 3H9GA 4I5DA 1UAGA 4YT2A 2GYYA 4RQTA 4MP6A 4RL6A 4RQUA 5DCUA 1GTMA 3UH1A 4DVJA 5JDIC 2EF1A 5DN9A 2EIHA 1PJQA 3L4SO 3AU9A 3UN1A 4D3SA 1XCBA 1B3RA 1C14A 2Q99A 3MOIA 4BNJA 1NWCA 3EW7A 1IHXA 1YQGA 3RUAA 2B36A 5FI5A 3S55A 3BHMA 1GUZA 4FFNA 1V35A 4CV0A 1N1EA 5CDGA 4E5KA 3MOGA 2FSVA 4IQGA 4HY3A 2DBVO 1QR6A 2Y1GA 2OO5A 4MP8A 4EI2A 3GVXA 4P4GA 4OOEA 5IZCA 1P74A 1A71A 3CZRA 4XYEA 3WTCA 3WFIA 3ZWCA 4EGFA 2W90A 1PZGA 1Z73A 3FCOA 5BSEA 4YR9A 2PGDA 3GRPA 2AG5A 3MJ4A 1LLQA 2NVUB 3WGHA 2DVMA 1X0VA 2VUTA 2AQIA 4FOSA 3W6ZA 1KBZA 2B0JA 3F9IA 3NEPX 4TKLA 4Q3NA 5GZ3A 3KLPX 1EQUA 2WM3A 4KQXA 5A1TA 5F5NA 2Y05A 3LF2A 2VNSA 2W2LD 4KMSA 3PDUA 3GEMA 1PJLA 3LK7A 1ENPA 1RM4A 3QQPA 4J0EA 3AI3A 4E5MA 3JTMA 3GAFA 3ZV5A 4HP8A 4NR0A 1XSEA 3LT2A 2HRZA 4TSKA 3DZIA 2D1YA 3TFQA 4JJIA 4LVUA 4DLBA 4DREA 1PZFA 3JQ7A 2XXBA 2O3QA 3OA0A 4ZJUA 4Z9FA 2E49A 2EP7A 3ITKA 4R1TA 5HBRA 4DLLA 4J1NA 4UEJA 5G0TA 5ER9A 3SXPA 3ZWOA 4BS9A 3PZBA 3P19A 4R68A 5KJ6A 1S7CA 1T26A 4BGUA 4NFYA 4H7PA 5CPBA 2FMUA 3AJRA 2Z1NA 1T2EA 4PLTA 4IINA 1N1GA 3BHIA 3FN4A 3BIOA 4KDFA 2RIRA 3KHUA 3KRTA 3Q0EA 1PWXA 4JBIA 3TQHA 3CMCO 3CMMA 3KOUA 3ZN2A 2PR2A 3D4OA 4Y6PA 1DEHA 4DPKA 3DMTA 4CM9A 2RHRA 3JV7A 4ZRNA 3WLFA 4CV2A 2LDXA 3GG9A 5BSFA 3E48A 1D8AA 2B35A 3C7CB 4NNJA 2GD1O 1DIBA 1DRVA 2YDXA 2A9FA 2DTXA 3DBRA 4D0RA 3BMNA 3M1LA 1E6WA 2UAGA 1R6DA 1AHIA 4N5LA 4A10A 4BGEA 1P1FA 4N5MA 2CVQA 4BV8A 4WNIA 1XU7A 4RVFA 4BKUA 4R41A 5B4UA 4FGWA 3GHYA 1PJTA 2ZYGA 4GAEA 5I7VA 4ZHSA 1GR0A 1GDHA 1TXGA 3WWZA 1ISHA 3JQ9C 4QFDA 3JQGB 1R15A 3OA2A 4AJ4A 5MGBA 1NX6A 2FPPA 2O3SA 4L4RA 5JFOA 4HNHA 4MVJG 1PGOA 3JD0A 3NX4A 3O9ZA 1JVSA 2HCTA 2V65A 2YW9A 4II3A 3VH2A 2CSUA 2IZ1A 3RD5A 5TJ9A 3O26A 3DZGA 3VH4A 4RORA 3OETA 1PTJA 1Z6ZA 5CHEA 4Y98A 4L9RA 3GF4A 3VZPA 4WLVA 4WCFB 2Y68A 5B4VA 4LRTB 3ANLA 2AG8A 4IUYA 1N9GB 4JJFA 7ADHA 3DZHA 1AXGA 5ICSA 1OFGA 1OC4A 3IP3A 4HFJA 4OYRA 1MV8A 1CDOA 4DC0A 1F0YA 2VHVA 4HFRA 4BNVA 2PH5A 1FDWA 3I9JA 1I5RA 4NK5A 3ZHXA 4E31A 3GZNA 4X54A 5I7SA 1WXDA 4OO3A 3UAGA 3VPHA 2FZEA 1DFIA 2ZTVA 3RUIA 3ENKA 5AQ1A 4UAGA 4FBGA 3ROMA 4RVHA 3JQEA 4NZ9A 3RQSA 3GOHA 2OP0A 1AHHA 1LRKA 3LSYA 2CNBA 3OMLA 1M2WA 3PFWO 5CP8A 4CMCA 3ROQA 4IBOA 5CDYA 4DWVA 5ES3A 4K6FA 1B14A 3ZWYA 1NAIA 4E12A 2YUTA 5LC1A 3BMCB 2CVZA 4ZQGA 3K6JA 4O63O 1E3EA 1E3LA 4R01A 3E82A 2BKAA 4WLUA 3RUDA 3UFXA 1VRWA 1PS8A 2DUUA 3VAZA 3GQVA 1Y7TA 3LQFA 1RPNA 1PR3A 3WQQA 4YVFA 4IQ8A 1VSVA 2J3KA 5G4KA 4CLHA 4BHTA 1W4ZA 1SO8A 5DZSA 1TLTA 3ETGA 3ZDFA 1VPDA 2RH4A 4XQEA 1XWFA 3KEQA 5K6AC 4B3HA 4PZDA 3OFSA 4DA9A 1WMBA 2C5AA 3VTZA 1IE3A 1ZBQA 3I5MA 2AE2A 3PIIA 4J7UA 2NQTA 1QORA 1X7GA 4BNUA 1ZK3A 2PKQP 4JROA 3W8DA 1H94A 1PJ2A 2YHUA 3KM0A 2JCYA 1QMGA 1E7MA 1QXSA 3QVWA 4EJMA 1E6UA 4HUJA 1NM5A 2JFHA 5BNFA 3NYWA 3KSUA 1R0KA 3S8MA 4AJNA 1NHGA 1T4DA 1ISMA 1PS9A 5JAZA 1N7GA 3EGOA 3DOJA 1YGYA 2Z95A 2GPTA 4LMPA 5IXYA 1ZNQO 4M86A 1BVUA 1X7HA 4QX6A 4BB5A 1A4UA 2FZWA 1ISIA 1ISFA 4MKZA 4XDZA 1PJBA 3A1NA 3T7CA 1L7DA 3R3SA 3VH3A 3OJLA 3GPIA 4A73A 1DRWA 1K89A 1LC3A 3SLGA 1RM3A 5KNLA 4Z9XA 1FJHA 4RZHA 4PZCA 1XG5A 2Q50A 2VWPA 4PIVA 1X1TA 3EK2A 4OXYA 1CQIA 3BMQB 1IZ0A 5C7IO 2F00A 4UUMA 5EIOA 1W8DA 5LCXA 4E33A 4K6CA 2R6JA 3AI2A 2VTDA 2HO5A 2D4AA 2BGKA 4RO0A 4TQGA 2ZB7A 3GEGA 2VT2A 4QSMA 3AY7A 3LDHA 5DDIP 3ZCXA 5C5IA 4CLOB 7MDHA 1T2CA 2OMEA 2Y99A 3CKYA 3ETDA 4M8SA 4U6SA 3NV9A 2P2SA 5C37A 3GR6A 3DHYA 2X6TA 4CPDA 5I9MA 3FRJA 1HYGA 3SBOA 1FXSA 1EE2A 1RM0A 3D5TA 2LDBA 1RKXA 3CE6A 2XF8A 4R9SA 1NYTA 2X0RA 3F6YA 4MP3A 3JD2A 4XQ9A 1B3BA 2P68A 3W4JA 3F4LA 3DBLB 1XELA 3PJDA 4FC7A 4GBJA 3DB2A 4IJWA 3KO8A 3B20A 1VI2A 3BMOB 3GDOA 4Q39A 4RZIA 3X2EA 3HSKA 2NUAA 3QVOA 1HF3A 2YV3A 3HN7A 1Z74A 2HK9A 3F4BA 3NJ8A 4YJFB 3RBVA 3DOOA 1O6ZA 3CEAA 3FD8A 4O59O 4BNZA 5KVQA 2EJVA 1JN0A 5CEJA 1D1SA 3BMQA 3CINA 1DRUA 4YAJA 5JNLA 2VCYA 3RU9A 3KSZO 1U2GA 4K26A 4LSWA 2AE1A 4H16A 3LLVA 3WGIA 4E13A 2CUKA 3BMNB 4ND3A 5IF3A 3H4VA 2YFHA 4K9DA 2B83A 1XYGA 2X23A 4XYGA 2GGSA 1U3TA 5JMPA 1U3WA 1P33A 3EVNA 1OAAA 1EVYA 3MWEB 3GPDG 3TZHA 1PL6A 5L40A 1Y81A 1R4NB 3LT1A 4Z0PA 1ZH8A 2P91A 1MLDA 2DC1A 4EDFA 4N54A 4AJLA 4MPDA 2Y0EA 1HZZA 3HDQA 2R00C 2WD7A 3H2SA 4RF3A 4FFOA 4BL5A 4J3FA 2C59A 1CIVA 4W7HA 4B4OA 4WPGA 5DT9A 4FSHA 3GUCA 1CF2O 4UUPA 1WWKA 3QWAA 3IQDB 4IDDA 4YYZA 4FR5A 4BB6A 1QP8A 5COQA 5BT9A 4BO9A 2PLAA 3WYBA 3JD1A 1JWBB 3G17A 3QJ5A 2HJRA 2GN8A 4XGKA 3U4CA 1I30A 5AYVA 1ISGA 2QIOA 4AJEA 1H9BA 2DU8A 1NBOA 3OBBA 1ADCA 4GKVA 1F06A 3D4NA 2WYUA 1ADGA 1HDXA 4PVCA 4R69A 1T24A 1Y1PA 1QYCA 2OFPA 2YHIB 1HWYA 1KVRA 2X8LA 4CQLA 3AK4A 1Q2XA 2GZ2A 1H6DA 3PJEA 3KB6A 4MVJP 1Z7EA 3LC1O 3W1VA 1ADBA 1MGOA 5L7TA 3ZHBA 2EV9A 3PVZA 3ORFA 4JP3A 2GN9A 4ONEA 2HLPA 2J3JA 2C54A 1E1KA 2PFGA 2EKLA 4WOKA 1TT7A 4RF4A 4PLYA 3TWOA 3GEDA 1R4MA 1MG0A 4BKQA 4CMJA 4D3DA 1V3TA 4BUCA 1GD1O 4QT0A 1OMOA 4FD3A 2ZJ0A 4U0KA 3DBRB 2CDBA 1GL3A 4CV3A 4E4YA 2FPGA 3A4VA 3U62A 4E2XA 3PWKA 4NHEA 4PGFA 1LSOA 3FNHA 4D45A 4BVAA 4CM7A 4R1UA 1HDZA 1GQ2A 4XJTA 1KVUA 1ZK4A 3HFSA 1EZ4A 4GPD1 3JQAA 3UXYA 3AWDA 1BVRA 2A94A 1VL6A 4GVXA 4YRAA 1IZ9A 1CQJA 2E48A 3DR3A 4BMSA 2BFAA 2DKNA 3RC1A 1CWUA 4J2OA 1NNUA 1D4FA 2X9VA 2VWGA 4R9RA 1Y8RB 1GADO 3ROKA 1K6IA 3H8VA 4KDEA 5I7EA 4ID9A 2P4QA 2D59A 4XDYA 3WGQA 2D8AA 3EY4A 1EUDA 3L9XA 5TGDA 2DBQA 3KYDB 3JSAA 3KZVA 3NGLA 3EHEA 4GGOA 3HB5X 1JLLA 3JQFA 5KJ1A 1ZO8A 1DSSG 1O95A 4BGIA 2E37A 4F46A 2Y67A 3UW3A 5KTKA 2Q4EA 4AJPA 1UJMA 4NQZA 2UV8A 1PR9A 2NWQA 1ULUA 3U49A 3VZRA 3JQGA 3DHEA 1YBAA 3OQ1A 3PIDA 3C1AA 2G82A 1FDSA 1TB4A 2X5JO 3E6AA 4Q3AA 4MKXA 3DQPA 3OSUA 4HNGA 3Q2IA 1BXZA 1KVSA 3RBXA 3NTRA 3M1AA 3JQBA 2HMUA 2VRCA 1TEHA 4KUEA 1WDKA 3P7MA 1U5CA 3RBZA 2B69A 2WD7B 1PS0A 3DAPA 4BMVA 1UAYA 3WYEA 1N7HA 3DAFA 3NDIA 1LTHR 5JAMA 3ASVA 5EINA 4Z3DA 5DF1A 4I9NA 4FFLA 5H82A 3VTFA 4E5PA 4B7XA 4D7AA 1K2WA 4YJHB 4CQMB 2VRCD 3RI3A 1GZ4A 1GAEO 1RYDA 1ZW1A 4NPCA 1RJWA 4OQYA 4U6QA 3ZW9A 4IDFA 3H5RA 3RIHA
chains in the Genus database with same CATH superfamily
5I4BA 2ZZKA 3S2EA 2ZB8A 2ZSJA 2YWFA 1Q1AA 3UJ6A 3H8SA 2G08A 1ITZA 4XPIA 2IQ5A 4MGZR 3IDSA 4QYTA 3VH1A 1DMRA 4R16A 4I50F 1R0CA 3FUWA 4AZ0B 3KTDA 1YDHA 2IYTA 2O4UX 1WV0A 1JFFA 5LNK6 4A2PA 3DHVA 2DECA 3BF8A 3LG2A 4D8XA 1BGXT 4I2NA 4F11A 5IN4A 1KYWA 4L72A 4HADA 1YR7A 3A70A 3UPUA 3DGFC 1U04A 3DM9B 2VBCA 4WZBA 4ESVA 5CD1A 2W4QA 2W2LA 2ZYWX 1Q3HA 1Y5MA 3A4TA 3CXUA 3E4DA 3MEQA 2P30A 3IR6A 4O2BF 5BV0A 2RONA 1ORWA 3TDKA 1QGDA 3QFRA 4PONA 2ODEA 4AX4A 3KQSA 3GBVA 1SUEA 3GEPA 2Q8NA 1EX9A 3X43A 3D3KA 2DJIA 1V41E 4I19A 4MWZA 3TLGA 4DYHA 5CD9A 2NZ8A 3WQHA 4REQB 3LBNA 1WO8A 3GVIA 2WI8A 1G5IA 4IDCA 2EJWA 4QXQA 1GUFA 5AQEA 4FYKA 5K3OA 1JPVA 1WHSA 3EAQA 1HFKA 3ILHA 3MWEA 2FTKE 3HCFA 2Z6QA 4J94A 4X71A 3T52A 1RZ3A 2P65A 4ZAVA 3TEMA 2EYQA 4AUNA 4KXQA 3A32A 5TV2A 5KNCA 1W46A 3LO8A 2XE7A 1GN8A 1SHTX 2GF0A 5EIAA 4CYMA 4M21A 4JYZA 4WHMA 1L2TA 2R1VB 1W4AA 3IDOA 3IDAA 4DQVA 1EUYA 2Q07A 4KXWA 4YQZA 3VZSA 2JIBA 2FFBA 3LFHA 4OHYA 4B46A 4AY6A 1LW7A 1H65A 2IUTA 3DZCA 4HFNA 1LPPA 2F8SA 5KYXB 3TSWA 1O77A 1KDOA 5F12A 1HE2A 2Q1SA 4IIJF 1WV1A 4ZTBA 3AY3A 3CEMA 3OX1A 4G0NA 1O87A 2H07A 2NTVA 4QL3A 2QGFA 3H5OA 4FJ1A 1N6NA 5T8KA 3IAS1 5AHOA 4LXHA 5FTWA 5KNCH 1SPBS 2Y0DA 3KWFA 1A8SA 2DJ5A 2I67A 1M2EA 3LAWA 3LP5A 1J24A 4PX9A 4TM8A 1PZEA 4NV3A 4R1SA 4YT4A 1RXVA 4P98A 2HMVA 4PPGA 4S04A 2FOIA 5TR9A 1T1RA 3WL6A 3K6SB 3K0KA 4RH0A 3R0QA 2GFQA 4R9UC 5F76A 2GLTA 2ZJYA 1NQUA 1DJLA 1YVDA 2NW6A 4Q4JB 3MYRA 4B6SA 3RF7A 3VOSA 1DLJA 1XCLA 4DDMA 2QE6A 3GAZA 1QHSA 2XEXA 3GMSA 5BSGA 3SMQA 3CPJB 4LF8B 1N2ZA 1E69A 2HO4A 1TKBA 5I7OA 3A4YA 3TUJC 4DIFA 4KSBA 4JP8A 3RVMA 1YHZA 4EHBA 3C2QA 2FJ0A 4RY2A 2XDQB 3MT7A 1KO1A 1MNQA 4R1OA 2VP4A 3R5KA 4YRDA 2R7NA 3JTEA 1IN5A 1ZUD1 2HA0A 2Q45A 3PD7A 4MCIA 4MEAA 4DILA 2FFQA 1GPMA 1GPNA 4I08A 3I5YA 5DM70 4DDWA 1US8B 1WU8A 2XECA 3P5SA 2YJTD 1JAZA 3LW8A 4Y9RA 3RV4A 1YRQA 4DCNA 3NPMA 4OK5A 1A8UA 4Z0HO 4PHGA 3DR5A 1AX9A 1BWRA 1E1NA 5ALFA 1TK9A 1NPTO 1LK7A 2XKAA 4RACA 4WGGA 1B7GO 1X77A 3FOBA 3HLKA 4L0CA 3KJFA 3RS5A 4EA9A 5HKKA 2CL6X 1I8TA 2VH1A 5DLPA 1WUJS 5F2KA 4GM4A 4IIFA 4ZJPA 3FDFA 2P41A 4Q9JA 3DUFA 3W2GA 1BWSA 1JQDA 2LBPA 2DETA 1YTLA 2Q9UA 2WU4A 4C4TA 5HMLA 3V7WA 4FFWA 2N1MA 1VGQA 2FMHA 3LOQA 1Q1QA 1PBTA 4CE6A 1YE8A 3FGOA 3ZBPA 4YXFA 5JJCA 4IUDS 4RDHA 1DHTA 1DTWB 4PFSA 1EM8A 5PGMA 1VCIA 1Q83A 1XKXA 2R60A 4HQ0A 2Z57A 4D3XA 2ZBEA 3PHBE 3O21A 3ZWMA 2NO6A 1R12A 5IUKC 5TQ0A 4CEHA 2Q7DA 5ILQA 4FXPA 2AXNA 2CHUA 3PUXA 3KVYA 1Y5NA 4M89A 4PHHA 5DBIA 2R97A 4MV0A 3EXHB 3WHIA 1P4AA 2JLBA 5IUJC 3ESBA 3O1JC 3S99A 3WBKA 4OUDB 4EUHA 1AGNA 3L7NA 4MRMA 4FGSA 3DOEA 4G2NA 3HPQA 1VIMA 2OCBA 1N25A 4HGNA 4QREA 1XU9A 3IURA 4EK9A 2A5JA 1Z3CA 2O5EA 1AG9A 1BX0A 1TEXA 3OE7D 3QBDA 1C9EA 3HB1A 3RTEA 5DYIA 1PWZA 1MAVA 2ZAYA 2YVKA 1UKZA 2JJ1A 4U8GA 4MUKA 4CTNA 4XFKA 4IIHA 4QHTA 3Q2OA 4W6ZA 4CM3A 2JZNA 4ZEVA 4O4IA 4LVNA 2DT8A 2VHZA 2XB4A 3B8EA 4X45A 2G5PA 4CCYA 1GNLA 1VXRA 3N6RA 5DWVA 3INRA 4EI7A 2VOEA 4YV1A 4I66A 4AROA 3K5PA 7YASA 3SQWA 2V7BA 3BOSA 3LYLA 4IJ6A 1G8PA 2V3VA 4Z6KA 3ZDAA 4B7UA 2YWEA 4C7KA 1R5OA 1F2TB 2P7HA 3I09A 3KSRA 3LUJA 4GECA 2G4VA 1XCPA 3M5DA 3TSCA 4B4WA 3OM9A 5IBPA 3KUXA 3K70C 5DK6A 2I1LA 4MWBA 1AQUA 4XZ3A 1RKBA 4UVIA 4QO8A 1IHUA 5JE8A 1IVNA 1KAGA 1UWLA 1YE3A 2HAEA 2OB2A 1RABA 2BE9A 2XZLA 4LE1A 3VJKA 2YXBA 3IKLA 4D9GA 5F2NA 5IANA 1J0BA 1WSAA 4LWPA 3DEZA 521PA 2FR1A 4OHZA 3C8MA 2ZJ2A 3D4IA 3E1SA 4CDRA 2H2IA 5DHQA 2R8YA 1C7JA 2F2TA 4CV1A 4ISBA 2WE8A 4Z49A 3U61B 5DGXA 1KJ9A 1XJ5A 2C5SA 4DJFC 1ZD5A 3AYZB 3O3MB 4Q4HB 1XZAA 2IZZA 1TF2A 1GUAA 3CZMA 2JZOA 4O4JF 3C6MA 4Y1EA 2A5LA 3HB0A 1GRRA 2OBMA 2CD9A 4X20A 3T5PA 5KTNA 4ZA2A 4ASUD 4BB9A 3H2ZA 3HA7A 5EOVA 2BI4A 2VHUA 2YZGA 5A4FS 4R9VA 1T8WA 2H57A 1IXRC 3AQ4A 4KVAA 2Q1WA 1R66A 2J41A 4U9HS 3NYQA 1LQTA 3O03A 4RPCA 4ZYLA 2Q29A 2IPNA 5CX1B 2DFKB 2ZREA 3L04A 4EFKA 3PA8A 4F2HA 4KH1A 2L17A 1WNFA 2Q3EA 1D3AA 1FYWA 1FTQA 3P5BA 3WGOA 2AVNA 1FU4A 1KH1A 3AFHA 4TTQA 3PDCA 4AKSA 1MRSA 2JW5A 2O07A 3AEKB 4ZOCA 5IVKA 5KYVA 1QQ6A 2RJ3A 3K0CA 5GP1A 1RRPA 2NX2A 4GPIB 5GV8A 4ZKDA 2JKZA 5JECA 2D7DA 1XL1A 1H5QA 3FTNA 4FFBA 4NEGA 2PX3A 4PSDA 5G1OA 5GV7A 3WRYC 4CMAA 1OCEA 3T12A 2IS6A 3D4PA 5L3QA 1FRFS 2PGNA 2QX6A 4LBYA 2QXUA 5EE0A 5CFMA 1Q1NA 3EG5A 3BRCA 3O90A 5EVJA 2G72A 1S2IA 1ARZA 4HFMA 3OOYA 1D4OA 5LP1A 4U7DA 2HQ1A 1J22A 4LDJA 2OHIA 2FQ1A 4H6PA 1DP4A 3CW9A 4L8VA 2P90A 3ILXA 1BA3A 3PUYA 4JYAB 1SHJA 2IPMA 2E89A 3Q9NA 3T06B 3RRZA 5IZCC 3FR8A 2CB0A 1Z0AA 4X94A 3R9WA 3OECA 2KM1A 1V9LA 3K1JA 1VSTA 1CQJB 2OO5C 1L1FA 1NW3A 3WDMA 4B75A 3O74A 4GX2A 4IM7A 1FUKA 4MVJE 4C20A 4B7CA 2WWGA 1CY0A 2EAUA 1U0TA 2HI0A 2VEOA 4JV5B 3ZEAA 1RDFA 1RI2A 3D0OA 3NJRA 1MFZA 2GPWA 4EAQA 3N6XA 5HF6A 5CT6A 1N2BA 1M8GA 4YAWA 3GNSA 2VHYA 1FZTA 1T15A 3U0VA 5BOSA 1V8BA 3II6X 2Q2QA 2QM7A 3Q40A 4N48A 1A1SA 2WB2A 3LLMA 4CIBA 2WYVA 4OHFA 1G0OA 4QOJA 3MUNA 3REQB 3QWHA 1MQSA 3L40A 3QU9A 1MRZA 1VTKA 3HDHA 3E4CA 3E1GA 1U94A 4NBWA 4QFCA 1N0HA 3LE8A 2I54A 2GRAA 2VT3A 2P3SA 2E85A 4LHZA 721PA 3S8EA 3C3KA 4BWYA 4KX3A 1N5DA 3B60A 3PFIA 4M83A 2GKSA 4PICA 4F3KA 1SFRA 4N3BA 2W2MA 3RHZA 4B32A 2VPIA 1N4AA 4YEDA 3K1ZA 3IYLW 2FPPB 5ALHA 3EPJA 5DB4A 5F3RA 1JYSA 5KVCA 4IXWA 1HQYE 4I7EA 4Z99A 4HQKA 5EWJB 3R6WA 3TNLA 1SVLA 4ZDIA 1EFUA 1RQPA 1KOGA 1GQOA 2SKDA 3VC7A 2EFJA 3ZXSA 5BN3B 5KWEA 5EJ8A 5ECWA 3TDNA 1TM3E 1XCOA 4JP2A 1DCKA 1XQVA 5KU1A 2AKYA 2IRWA 1GCUA 4A91A 2XUDA 2GN6A 1K0FA 1NLFA 1G17A 2HH9A 3MCZA 1UQRA 3PBKA 2EJBA 2HPAA 5MHTA 3G2MA 5KKNB 3WL3A 3VOAA 2NSHA 5E0OA 2ESRA 4FT4A 1UR5A 1J1UA 3GRCA 4NV0A 4XQCA 2ZB3A 5HQ3B 5F52A 1OWMA 4X1YA 3LHFA 1U3CA 1ZCZA 2JL1A 2BLLA 1XZJA 2PU5A 5AI6A 1QDUA 4AD8A 3G5TA 3LHSA 2AEMA 2UZIR 5G53C 4S24A 3AW9A 5FL7A 4ENRA 5K09A 3OU2A 5AI5A 5FWXB 2HLDA 2WJ4A 1GFSA 2JIOA 3HG7A 4MJLA 5IHPA 1SXIA 1G64A 3F8TA 3LCRA 5EIWA 3DVRX 3NQ41 3QFTA 1X19A 3BL5A 3G9UA 3COVA 4G67A 4F3TA 3WWCA 1GLNA 4EHIA 1C7EA 1P0QA 2FPGB 3BGDA 5KOIA 4FXOA 3GH3A 3LC0A 1VQ1A 1GNTA 1Z2NX 3C5VA 3G8YA 5TPZD 3DFKA 3SYTA 2BBTA 1ZRHA 3UH0A 2XTAA 4AJKA 2C2XA 4JWKA 5G2OA 2ZP1A 2RG7A 2UKDA 4Q21A 2CD7A 1PLLA 2GLUA 4PS0A 2BWJA 2P2YA 3E0XA 1XXHE 1Z47A 5CG1A 1GCGA 1NVVQ 5ALWA 2Z8ZA 3LQKA 4BQRA 1E8DA 5GMOA 1J06A 2JLAA 3I2FA 5AKIA 1EVEA 2RI6A 1G20E 1YVRA 4TKVB 1L9XA 4TTRA 5D7BA 1CUGA 3T0IA 3PXGA 3VR0A 4DE5A 3I5XA 1IBLB 4C05A 2JKVA 2GZAA 1FRNA 3DLAA 5KKAA 4LBZA 4DR7B 4BV2A 3MINB 2QRMA 5IABA 5AJUA 4OXNA 4Z1OA 5DISB 2UYHA 3S1SA 1A9YA 4E5DA 3A1DA 4H7FA 3V80A 4YRQA 3B3FA 5BVGB 4ARSA 2PUGA 3C8HA 3N07A 2IOYA 3AP3A 4MUMA 4BQEA 1CUFA 1ZN9A 2C8JA 4BLPA 3GFPA 4U3JB 2CL0X 3GGGA 3K72B 4N41A 1ZYUA 2IEGA 3QWBA 4ALLA 1BWPA 2PHZA 1YC2A 3RSSA 4JI0B 1E1CA 4ZEXA 4CQMA 1P80A 1U0FA 1GKLA 3CEPB 3OIYA 5D1HA 5ALVA 5C3MA 3JD4A 4LDRA 1AQIA 4B6JA 3CB4A 5JAQA 3OICA 3TAHA 4TMVA 5F3DA 5CB6A 4RGBA 3OQOA 3EG9A 3ZIAD 1HYQA 3CF0A 2XNKA 1BMDA 3NHZA 1OHHA 5JDIA 3R3UA 3S29A 4LRUA 4DCSA 1FVHA 1YIOA 4FMBB 3THYB 4KI0A 3UUFA 4Z4EA 1T8RA 3C3AA 3QMMA 2FQYA 3GEBA 3L3BA 4NFHA 2ZWAA 2IYRA 4RU1A 4XE5A 5EP3A 5F5LA 4CXMA 5J59A 2ID4A 3VPGA 3RABA 1LX6A 4BJ3A 4PN7A 4N0EA 1T4CA 1QFSA 4MWOA 2DBYA 1Q0HA 2CFOA 1I3MA 2Y6UA 3QBEA 4OJYA 4AP9A 4QM7A 3B6EA 4GWGA 5KYNA 4P3PA 4G3XA 1J8FA 1XXHA 5JH7A 3R9KA 1SEPA 3RF6A 2PMBA 5F64A 2QVBA 3PXDA 3I58A 4B4DA 2PL9A 2P2ZA 1BXGA 1YB7A 2KWIA 2WVAA 3FDZB 2A3NA 1M2FA 2C04A 1U7HA 3IUSA 4ON9A 4CF5A 1NXOA 5B6JA 4ENWA 3IP9A 3IAS6 4JXJA 4TXHA 1MORA 3L1KA 5EE5B 1GTZA 1L8QA 2Q0HA 4HDSA 1DZIA 5HIAA 1C3XA 1GGNA 3C7TA 2FWRA 2Q8QA 3HCBA 2V45A 4OL0A 1DHRA 1G8JA 2QXTA 3DKKA 3LDGA 4L57A 4WNYA 1QS0B 4KHPB 3IXLA 1B74A 5HRUA 3VYTB 1QYWA 1XNGA 1ZK1A 2EARA 1GFZA 4XM2A 5EHQA 3DMPA 4EPTA 1RWMA 1X7XA 3FKQA 3DCJA 5TF4A 2MSCB 1V47A 2GETA 2J6BA 2QTMA 4CCYB 4E4TA 4BFXA 3MS7A 3RRXA 5H16A 4B9EA 1U2QA 1H0HA 3E58A 2R0QC 4HS9A 1J2YA 1CPYA 4I4TB 3F5FA 1GTVA 2P4HX 3E5NA 4LWZA 3VGPA 5BOSB 2FN3A 3KLBA 3V4LA 1OFVA 2UYYA 4DJJA 5ICEA 3R3WA 3PI7A 4GL2A 4MIOA 1XVAA 2E4AA 1SXJD 3DT6A 2YVAA 4EKDA 2QV7A 4QJBA 3K9BA 5DMHA 3O8OB 4X64B 3SZ3A 4A0RA 2PUCA 3R7WA 3K9LA 4F91B 4EHNA 1RSZA 3U1VA 1FDRA 4U9IS 3CRNA 1PCXA 3AGPA 1TFUA 1II8B 2WVHA 3CXRA 1PKEA 4MQMA 5C9ZA 5HQ3A 1U7UA 3T9DA 4MWTA 2W2NA 1J49A 3IB3A 3K09A 2J32A 3O8BA 3OZFA 1IJEA 2AQ8A 1DS6A 1O54A 3A4NA 3AP1A 4N8SA 5FL3A 1YAHA 4IEIA 4F3NA 1XWIA 1OR8A 1JDJA 3FYCA 3K8OE 2EGGA 2FQQA 1E3JA 2W0SA 4UHJA 5DJ5A 4PNHA 2WIDA 3H2GA 1W5AA 3PC8A 4Z8YA 4RVCA 3EIWA 5DV9A 2PMWB 4DNFA 1Y7PA 4PW0A 3UAVA 4YUZA 2JAUA 3ADKA 3W5SA 1R0ZA 4BKRA 5KOHB 3D8NA 3E3AA 3E9MA 4CM4A 3I3SR 4W1PA 3OH8A 3EUWA 4F0JA 3QX3A 4TN1A 4YHBA 1C4WA 3AZOA 1JG4A 1QHXA 1W59A 4TKUA 5C4GB 2XIQA 4D4LA 1ACLA 2P3OA 3EVGA 1CR1A 3HBJA 5IBRA 1NVVR 2RBGA 4F4JA 3OY7A 4DR5B 2WT8A 3RO7A 1Q7RA 1B0UA 5TS3A 3N0WA 4CTJA 3C3EA 4ILKA 2CNWD 4KP7A 4FFPA 1T4BA 4LOIA 2QOEA 4HTFA 4IQ0A 3RS0A 1Y6GA 2QDKA 4LC1A 4KQIA 3NWBA 1ZVVA 4KPYA 4ZEMA 5FBLB 3RS7A 1HE3A 2AXQA 1HSOA 3PC7A 2FPMA 4L4XA 4REMA 5F23A 5I4CA 2VP3A 1RWVA 2WTEA 3NO4A 3BXZA 4XUGB 3HGMA 2UVDA 4C0WA 1EA7A 1T9HA 3R8FA 3A58B 3AERB 4K88A 1JSCA 3W9YA 3MIZA 1AMOA 1U6JA 3IOYA 4Q4DA 3SS7X 3IV9A 3MC1A 3QJYA 3L82B 2GM3A 1IQUA 1JE0A 4MVCA 4AIRA 5FJIA 4A26A 1U0RA 1T1JA 2VJDA 3GD5A 4RA9A 1KP9A 3RAFC 4BNKA 2VSYA 3AQIA 3SHVA 4PO8A 1D0SA 1G21B 4FC6A 4AMVA 5JQGF 2YJ3A 1YCFA 2C5BA 4EB6A 1O95C 1VGVA 2HZ7A 4A8HA 2Q5OA 4TUYA 4EQ6B 3CLKA 4GXNA 3U13A 1DRJA 4TWZA 1W9HA 3KFXA 3LM8A 2UYCA 2SCUB 4FX2A 1DBIA 1P1CA 2V74B 3N2YA 3OQBA 3ZE1B 2PXAA 5JQWA 1SCDA 4KOAA 5JBIA 1KR2A 2FK7A 2JIZD 4QDOA 3ICQB 1X94A 4J4BA 1R8XA 4CLEA 5AJVB 3EB9A 4ZICA 1W29A 4EEXA 5CDTA 1JS1X 4RY8A 2N9UA 1XEFA 2AI2A 2B4RO 2HIAA 3HEMA 4C4XA 4YBZA 4LF9B 1W36C 4JHXA 3QEJA 4H1VA 3K3PA 3TR6A 4HT3B 4O0LA 3TIVA 1A9SA 3H1TA 5TQ2A 3ETNA 4WBXC 1WXWA 4FWTA 2NO5A 4XB6B 3MJSA 1EVKA 2PCJA 4JOBA 4WLFA 5JU6A 1AZSC 5EQTA 2HHHB 2ZCJA 5B7GA 4GPTA 2FF7A 3D64A 1RMQA 1NKSA 2NM0A 5HKLA 3UMJA 1PK8A 3Q12A 4AULA 1KAMA 3E8SA 2R85A 3HJCA 4CMEC 1J2TA 4Q93A 4EOGA 1NN1A 1WMFA 1LDNA 2OVBA 3OLXA 5A9TA 2Z58A 1J97A 4ZOLB 3AJ8A 3BXHA 2QYTA 4EJ2A 2JAWA 5IKPA 4L4YA 1FYVA 4I3HA 4BNLA 4DR1B 2G9VA 5FR1A 2ONYA 4HI0E 1AKEA 2ISQA 3HDJA 3QVGA 2IXGA 5BSHA 1YKSA 3HVJA 3WWPA 3HYRA 1DIOB 1RHKA 2OCYC 2SECE 4QLOA 3ZQ4A 3NZEA 3INTA 2X9GA 1ZD3A 3G89A 3AM4A 4F92B 2ODNA 1YK0A 1WMSA 4JUAA 2I87A 4WESB 1IHYA 2YQ5A 4W7SA 4IMPA 3PF8A 2V3CC 5JD6A 4GI5A 2E2WA 4EB6B 5D3QA 1PJCA 2YIJA 1ZLXA 1GG8A 3GA5A 4DCOA 4HRXA 1DXQA 4AMUA 5EJ2A 5ELMA 3O75A 1ZMTA 2HPZA 2ZWMA 4ACBA 2XVYA 2ZQZA 6REQB 3JAMA 2WMDA 4XGIA 3E7WA 4OHOA 4YWJA 1XD8A 4PZYA 2AG6A 3I6QA 3HH8A 3QWFA 5BOVA 2J5KA 3IKJA 4L6IA 2D1SA 2C3PA 2KSQA 2VOJA 1LW6E 1LPNA 4BPRA 3CRRA 4UHFA 2HQSA 4JKYA 4JI4B 3WGUA 3HFGA 5AT1A 2WKRA 4MDFA 1PYGA 2I3ZA 2XMQA 3H7IA 1E2GA 1JFFB 2W22A 1CNFA 1RXSA 1MOPA 2BFEA 1DQZA 1ONBA 1SNYA 2RHMA 4US2R 1CDEA 2OOSA 1M2VB 5CA1A 5BRJA 3R0VA 3WS7A 5AESA 1T4CB 2PGLA 2YJ6A 4LPKA 4NNOA 2OG2A 4RENA 4JT9A 2IZ7A 4G89A 4LY6A 5FBHA 2QAGC 1V45E 1WS6A 3HJTA 4OV6B 4JQZA 5H59A 2VZ9A 4ZGWA 3U6BA 2FZGA 3R24A 3JRNA 3TGLA 5IJWA 1DQNA 1JXAA 2XQGA 4PLVA 3IEMA 3J81A 4ZQCB 1UK8A 4IWNA 4F7WA 1T0JB 4QGHA 1JQBA 1SPXA 1XN1A 3WHKA 3WX0A 4EDHA 1BOFA 1H2EA 4RK4A 4X7MA 3A3YA 3EZ6A 3TO5A 5JYBA 3T54A 2QLJA 3C24A 4QFBA 5AI8A 1ZNXA 2QWXA 4I8XA 5D8DA 3MG9A 5C3UA 3VPDA 1VKNA 3KBBA 2PZ8A 4EHJA 3F90A 3NTUA 1T3SA 3CKMA 4MI1A 3G23A 2A84A 4P9NA 5TPWA 3WNZA 3ZY6A 5AW0A 1HE4A 4KUHA 4E6PA 4P0TA 3GXOA 1V48A 2GERA 1FU7A 4MKHA 1Z15A 2JGJA 2ZKLA 1TM2A 3NIGB 1CXZA 2AQKA 4G4IA 4GRIA 2RG1A 4HYQA 4QWWA 4WK4B 4PYJA 5EIEA 3EXHA 1TMGE 3QW2A 1E3IA 3QTTA 3WWYA 2FPWA 3IVCA 1NVTA 1EHCA 3QVGB 4GD3Q 2QD2A 3I5AA 3KR1A 1N2EA 4GO1A 4TZKA 1PUJA 1ZHOA 4U7FA 4QBFA 1G16A 2BM0A 2OXCA 1EWQA 1R74A 2X0DA 1X13A 3MVEA 3WR5A 1KO4A 3RT1A 4KYVA 2AFHE 2R79A 2XWJI 2GCPA 4RZUA 1LPMA 1X0XA 1JKXA 2QRUA 4G5XA 3O82A 5CM2Z 1K5HA 2OBFA 4AKEA 2VXYA 5LR6A 3UJAA 1P2DA 4DZTA 1WF3A 1ZUNB 2YY6A 2ZUCA 1MB4A 2ZS9A 3PNPA 4K6OA 4KRYA 1CETA 4RJ2A 2IWHA 4ALIA 4ESHA 3MHTA 1EVIA 2X7JA 2BEWA 2ZRHA 3KHTA 4UBJA 4MRPA 4L4ZA 2WR8A 3M6MD 1YH3A 3OWXA 1RYBA 2G9ZA 1EB8A 3BBLA 1N8NA 4GFDA 1NPYA 2NTNA 4PAWA 4A0SA 1PK7A 4BBPA 1RJGA 1XVTA 2A5FA 3DEIA 4FKZA 4YMWA 1YUMA 5AM4A 4LVCA 4PTYA 1NQAO 2Q5QA 3EC1A 5B3JC 1D9ZA 2OV8A 3IPYA 3SJCA 2BFBB 1KJJA 2AW3A 1EUCB 2N75A 4TVOA 4XQ0A 4F2GA 4ZZ2A 3KVOA 4XYLA 2H52A 4TS4A 3CCBA 1KSHA 4RHUA 4FOLA 2V4UA 3FDXA 1EEHA 5EC8A 3IL2A 4GKJB 3O2SB 1A8QA 2PRSA 1F2TA 4HQFA 4OREX 2XMCA 1GZ3A 3S2GA 1G21A 1KR5A 2VFAA 2VUSA 4NMXB 3THXB 1WMDA 2XDQA 4H1UA 3USZA 3O8QA 3ZDXB 1I4LD 2X9NA 2VATA 5MN5A 1SQGA 2XW6A 4L7QA 3IKVA 4J07A 4N01A 5FEUA 4CLRB 5ELXA 3AXTA 1XRRA 3SJZA 1B6SA 1ZH6A 1P61B 3OPVA 4O5OA 1JEJA 4RHFA 4I1SA 4L5AA 3H05A 3IB6A 2PL3A 4HX5A 2JLXA 2WYIA 1AHNA 1P72A 4RE6A 3VNRA 4GMFA 3LA8A 1U2SA 1Q22A 3WAKA 5TARA 5BN3A 3KT3A 4HGOA 1D4AA 2J9ZB 3AF4A 3NHAA 1DAPA 3L02A 2C8KA 2Y2UA 4MIKA 4ZRDA 5H4HA 1PEYA 4J0JA 5TT1A 1HKHA 2C4MA 4RZQA 3GVCA 2QL9A 3HJHA 3TQOA 2H7YA 3B36A 1ZGHA 2R68A 1VSBA 3OFJA 2JVKA 4B84A 4YCMA 2FG5A 4NIMA 2DFNA 3K9QO 4XPIB 3OPXA 4ECEA 2R7LA 1FSPA 3R75A 3AWIA 3N2KA 4YJ2B 2PKWA 4J0IA 3TRKA 3U7EB 5IDQA 5KPDA 4JB3A 2QQ5A 3LCMA 2BGRA 3EXAA 4OBBA 4WNAB 3V42A 4C88A 5DE3A 3LP8A 1IMOA 1M33A 3VPXA 1IUKA 2HTEA 2A30A 3SYRA 3C3CA 1J21A 3FPFA 4E1VA 1PGPA 1YB2A 1WUTA 2PBFA 1CJCA 2O3JA 5FKJA 2QLMA 2EXXA 3KTAB 3QU5A 3PJGA 3IX7A 1RPJA 4DSTA 1U8XX 2YTZA 1WW3A 3EXG2 3ROXA 2EW1A 3ROEA 2P4EA 2HR1A 1CUJA 5CTJA 1JWAB 1L7XA 4KE9A 3WADA 4C7BA 1SIOA 3L4JA 1U7DA 2F1OA 3ZHCA 2O20A 3WFJA 2EBWA 2ZI6A 5M29A 3SI7A 1C3VA 2VA8A 4CQJA 4KV9A 3NVAA 3GU3A 4O2LA 1FFXB 2PH3A 4MJ3A 3B52X 3RYHB 5HYVA 2WUGA 1RQLA 4G9BA 1MC1A 4N6GA 3SKVA 3SN6A 5KEIA 2M9MA 2UXBB 2HN9A 4P83A 4E21A 2Y1DA 3AFNA 1AXEA 1KFKB 1K63A 2WICA 4V02A 4S1WA 3TEFA 3AVQA 2ZJ4A 4B8YA 4D42A 1EXWA 2ZBRA 3U1TA 3O4VA 2Z9CA 3E35A 1GOTA 2G28A 1EUCA 1PDWA 2O06A 2R7AA 3DDSA 2NU8A 3O2NA 4G6ZA 2DQ4A 4UZEA 5LYJB 3AM1A 3M2PA 1NQVA 1NZFA 2XVZA 2B8EA 4BB0A 1FFAA 3DE6X 4TZ6A 1YBVA 3NHPA 3RJZA 5EJ6A 2Z2ZA 4RKWA 4ZVNA 5FBRB 1V95A 2M1ZA 1NP3A 3K0HA 121PA 4X00A 4E22A 1J20A 2RGBA 1ICIA 1X92A 5J2TF 2JHAA 1Q15A 2H0AA 3SY8A 5IRCD 3L6RA 4IJ5A 1O57A 3BSFA 1MO3A 3G2LA 1T4MA 2YH2A 3TLZA 3VC1A 3W8EA 2NYVA 4DIMA 1JEQA 3RYFB 4D9BA 2AJDA 1R0SA 2ZYSA 4EX6A 2I6TA 3KKOA 5ICMA 5BV8A 2QMOA 3GC6A 3LOUA 1D4ZA 4LHVA 3SNKA 4DIUA 4Q7JB 4PBTA 1TCBA 3LBIA 4J0GA 2FA9A 3B2QA 3B85A 4DBVO 3IJRA 3ZWPA 4ASUA 3RIMA 4ZO8A 3JZMA 4JLNA 1JKMA 4CMBA 3O8DA 3C0KA 4F9EA 1AURA 2QW8A 3UYLA 4CG0A 3DO6A 4DSUA 1EHYA 2EKQA 3WKDA 1VA5A 3K6SA 2WSBA 1XXHB 3CG4A 2D1RA 2Y1LA 5ALUA 1XDWA 2Z4TA 1MGPA 5FHQA 2DGDA 1TW3A 4RCYA 5DLDA 3PXXA 3AR9A 1HMPA 4IIYA 1DJQA 1GTSA 1E18A 4U39A 3QF4B 1FNSA 3O1HB 4KXYA 2CLKB 3MMSA 3QVTA 3HXQA 2HF8A 2PL5A 3L6DA 3SXJA 5MDHA 3N7UA 3MWKA 3HBMA 3JALB 5HNKA 5I9IA 1V5GA 4BQIA 2HFKA 4FZ3A 2YZ7A 4ZO6A 3A14A 1U2PA 2KX7A 3ZV4A 3VRHA 4BBZA 4AG3A 5IM4A 4G01B 2MHCA 1G18A 4MRRA 4YP7A 3VKHA 4JI7B 3IHTA 4ERNA 2H1WA 3PDHA 4NL4H 2VAVA 4AT1A 1V25A 4QWMA 1K7XB 3FPCA 1DTWA 2Q3FA 3GFFA 3OSZA 1R6UA 4L5YA 3CWCA 1SH7A 3ZDCA 5BPHA 1HLPA 1VBFA 3RW9A 1PU2A 3PQDA 4BPBA 1ZD8A 1OZFA 4ALJA 4NBSA 4EHHA 1TKCA 2C9BA 3QBVA 3E9NA 2RKOA 2EJUA 3H17A 5LYYA 3RSOA 2GLXA 1ONPA 2FW9A 5EESA 5ALEA 3TXXA 4FFRA 2G76A 4KR0A 4AJHA 1AA6A 4FFDA 3IC5A 2A5DA 2JJ1D 4RKRA 3P96A 3Q3CA 3CVYA 2HA6A 2X19A 4MLDA 4ZOBA 4YR9A 5KX5B 3GLGB 3H5VA 5DWDA 1ODIA 4UULA 4IIUA 1NSYA 1ZJ4A 1AXRA 4UZFA 3N1UA 1FVFA 5AW3A 4J1SA 5ESRA 2F8LA 4DCCA 4Y2SA 3RUFA 3WRXA 5LZ4A 2DTEA 1XEXB 5GJCA 3RC9A 1P5JA 1N2GA 5AM2A 3Q3IA 5HWSA 1MB9A 2HJ9A 2R96A 4YCNA 3L6BA 3VR3D 2NTJA 4B85A 4UNRA 1JIQA 4W5WA 1RKVA 2H5EA 4NECA 3ERCA 1R9GA 3OCXA 2PO5A 5JHGB 3UWMA 4NCXA 3AO0B 2Q46A 1M6VB 3GJQA 3V6LA 2QJTA 3HR8A 1PN3A 5DOVA 3H6GA 1O58A 2R84A 1R6XA 5T8KC 1LFDB 5EWMB 2AX4A 1PV2A 1AK9A 1CUIA 3ZZNA 1IC6A 2YOHA 4YYEA 4BN0A 1KVQA 1MC4A 2Q4OA 3AM3A 5EMNA 1B00A 3T9AA 1S9DA 3F3KA 5L6LB 4TL7A 5ALOA 3O47A 2OYSA 1VL2A 1HEUA 3STHA 2GEBA 2HGSA 5HA5A 4MK4A 1KYYA 2XCQA 5TQ0B 5C1OA 3MWDA 1T5SA 5BUCA 5CMLA 2Z3VA 1UZUA 4GMDA 5H4GA 3D5EA 3NNDA 1L4MA 2HL6A 2KLHA 2IYOA 4KDRA 3VSDA 4B71A 3IELA 5BQFA 2YXNA 1YRBA 2IHJA 3F5QA 1MUUA 1V5WA 4LGMA 4NEHB 5T4EA 1AK2A 1DOAA 1X80A 4TYMA 4DLNA 4P93A 1DWQA 1S1CA 2COEA 1T91A 4EYQA 1Z5PA 2VCHA 3EIUA 1GGJA 4YAEA 2HDHA 2WHXA 2OBYA 2ZYAA 3DMRA 4MRVA 4AZ3A 1CDDA 1NQ5A 2HK8A 1P7WA 1AN0A 5F7OA 1VGRA 2P9FA 4ALMA 3DW3X 4L5JA 2Q49A 3Q3VA 3M3DA 3R7DA 3CF4G 1WXGA 1YA8A 1ORHA 2BT4A 2CJWA 2JANA 4S0ZA 4F96A 4CDGA 3MNFA 1A9ZA 2XA1A 2WZDA 3M2TA 3G2KA 5BSUA 1GAXA 1NG1A 3IBYA 2XBUA 3OC0A 3B5EA 4Q9LA 3HFRA 5ICFA 3K2IA 4KC0A 4PU0A 2OHXA 3F74A 3RWMB 3FGPA 1XMXA 2XB6A 4IXDA 5FUMA 2O5VA 4R1QA 1Q91A 1JKJB 1QRRA 1HDYA 2IBMA 2VJCA 2O0HA 2C03A 3FROA 3NWOA 4PSKA 4R3WA 3GUVA 5L3VA 4BMXA 2WA1A 1X70A 1XHFA 3GCXA 1PLKA 2V6JA 1KYVA 3WGYA 5AK3A 1YCDA 2EX1A 4JBYA 1RXEA 2MMCA 1YCHA 2GXSA 3PWSA 4CETA 2X5OA 1Q19A 4GQIA 4KX5A 4OAOA 3SE0A 3CF4A 3GQBA 1DIHA 3M6LA 3BAFA 4XIYA 1H9AA 5EKDA 1CUEA 1U2GC 3QOXA 1I1QB 1Z0FA 1JQJC 3B6JA 1LX7A 2JD1A 2V1XA 5LZ7A 4FCWA 3PE6A 2O1SA 3RREA 4QOEA 3FPKA 4BZXA 5EMMA 4KQCA 2DPMA 1QGZA 4N5NA 1I9GA 5KQGA 1NASA 1H6CA 1C0LA 4KFCA 3RUEA 3JQBC 4DIOA 5ALKA 3LX4A 3R44A 4RQAA 1LBTA 5KZMB 3D81A 1KRXA 5INTA 4JYMA 3EVDA 3UMFA 3H9JA 3LGXA 2PPLA 1QLHA 2XADA 2O8NA 2O2IA 1XEAA 1DXOA 2ERYA 2EW8A 1BAPA 1ZCAA 2OCDA 2GZ1A 2XUQA 3AEXA 3X2SA 1A5SB 4EKNB 4YMLA 2RC6A 1U1IA 3I01A 1ESZA 5HKAA 3GLFA 5KQPA 5C53B 5AJWA 4Z4CA 4F9TA 1GTRA 3B3AA 3GN1A 3HN6A 3PEUA 3OTHA 3T3DA 4X24A 4R84A 1JH8A 4JITA 3NEAA 4PLPA 5ABPA 2IH2A 1K7EB 2ZFUA 3TTWA 3EC2A 3W3ZB 3ZCSA 3SG0A 4BVBA 4CLDA 4CM9D 2DXIA 1QGOA 1E62A 1X39A 2YMMA 3D0QA 2NZJA 4D9JA 4KN9S 2WTBA 3NLLA 1SUIA 3DBLA 1VLMA 1WZEA 3FXAA 5HGJA 5COAA 2FRVA 3TSYA 4JNCA 1ESDA 4DMLA 1I6KA 4U7JA 1JJ7A 1PGNA 5A3QA 4Y6LA 1LCIA 3LX5A 1Q0PA 1WZCA 4MMZB 2WIJA 2C92A 3EJWA 4ZQFA 2PWAA 3EF0A 2QM0A 2FOLA 3LXRA 3VV2A 1TECE 2C9MA 2P9EA 1V6CA 4S12A 4IDHA 1Z29A 3WGTA 3E3NA 1ZY2A 2QN1A 3DVAB 4BCCA 3V8NA 4DGSA 4CF3A 1YL7A 3RSFA 4AZSA 3PTZA 3PC2A 1C0IA 3AILA 1MKYA 2QN9A 2HHLA 1CULC 1N5KA 3CSUA 3LQYA 5EHIA 4Q5IA 1MHPA 4BX2A 1I4OA 3FJYA 1UT5A 1H2BA 2IZ5A 3TQSA 3WZLA 1Q5PA 2P9HA 5CFQA 2JLZA 1CF9A 4W5HA 4Q0MA 2VJMB 1P45A 1HDRA 4HPJB 2NSDA 2J4DA 4ZQBA 1KWGA 4OHXA 2P7IA 4HLCA 1MXHA 2X0IA 1XQXA 2VKTA 3VAAA 3AMVA 4QJ3A 2GJ8A 2R751 3IVAA 3NKLA 5DHFA 1I3CA 2IYVA 3E5HA 1XWWA 3EY9A 1SKUA 3ZUGA 4RW0A 4H60A 2G3YA 2QUZA 3I72A 4LJAA 3FUVA 4Q66C 4W1RA 2RHJA 4C89A 4UUOA 4XTRA 4DUZB 5I4KA 3A7DA 2JDID 2OD2A 2FQXA 4D9EA 3UIEA 4JA0A 3U7QA 1QG2A 2MWMA 2RK6A 3ICPA 4BNYA 5CDUA 2O1EA 3QSYA 1ZCJA 1SQSA 3HRIA 1MA0A 1NJFA 5E1MA 5KTMA 1KORA 3DD5A 3K0AA 4N8DA 3L8YA 1AJEA 1WF6A 1IN7A 3N2LA 2Q2NA 5P21A 4DCMA 5A7FA 1W19A 4R40A 2P2NA 3E8XA 4UM5A 1ZUWA 3AOGA 3B9RA 4P36A 2JD2A 3IBGA 4Q3DA 3WGKA 4E70A 1BVHA 2G1AA 2GMWA 2PMKA 4LJKA 4M0KA 4IO1A 4D99A 2O59A 4BYGA 1N1DA 3C41J 4LRSB 3H18A 4YJ3B 5A5GA 1QU3A 1VB5A 1P0CA 2DHDA 3A1VA 3DXXA 3OT4A 2YUIA 4G37A 3DAYA 4A2QA 5IU6A 1KQOA 4AQ7A 1F38A 1M1YA 1D0VA 2VYQA 1NL3A 4D8WA 5EJEA 2ZROA 2ALJA 3D2AA 4MUEA 3GDWA 3K4PA 4KAXA 1AUPA 5E6UB 1NATA 2OHJA 1U4SA 3E23A 4YDSA 4IDQA 4AC9A 2RH9B 2ZEJA 2HF7A 3PUHA 5L53A 2PZMA 4J1TA 3L0SA 1TO2E 1C9NA 4I4TF 1JKJA 2QPTA 3BS4A 3AR7A 2F48A 2WIBA 4UHBA 3EIHA 1GQFA 1M7GA 5JXGA 4C0LA 1TU4A 1YS7A 1JTEA 1V3VA 2A78A 2QXYA 3JWPA 3QPAA 5KYYA 3GFQA 3STWA 3E9RA 2XH8A 3EVTA 3ELDA 3UGKA 4CEIB 2PRIA 3A26A 3GJRA 4YP9A 3KXKA 4OG2A