5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
4RPJA 4TWRA 4DBZA 3GEDA 2ZCUA 1N9GB 2VWGA 1R15A 3AUUA 2CVQA 4CM9A 3A9WA 2IYPA 5IDQA 4RF5A 3IUSA 3OICA 3ZWOA 2FWMX 2IEDA 3D3WB 5JBIA 2I3AA 3LQFA 5K0ZA 1DIAA 3VZQA 7ADHA 4CLEA 4MIYA 2C5AA 2ET6A 3CXRA 4M87A 2BFOA 3ETDA 3FR8A 3UCFA 2O3JA 3ICPA 4TRNA 4QFDA 1SZJG 4H16A 3RUHA 1H6BA 1AHHA 1ZEJA 4YAKA 4N5LA 2J3IA 2HUNA 3JQAD 4IJVA 4BKRA 5A5EA 1HYGA 4C7JA 1DSSG 2PFGA 3Q1LA 2Z1MA 2J3HA 1A72A 2JCVA 1UAGA 3L9XA 4J7UA 1EBUA 3EYWA 5TGDA 2EV9A 4J1NA 3W8EA 4YVFA 2ZTLA 3RBVA 5BSFA 5DT9A 1CQIA 2TMGA 2NTJA 4E2YA 1Y8RA 3FTNA 3ST7A 1N8KA 4M1QA 1XQ6A 2QG4A 3U49A 1HDCA 2Y0DA 3F5SA 3G1TA 5T8KC 4P38A 4IDBA 2G5CA 4GX1A 2O50A 3CINA 3M2PA 3RFVA 3V1UA 1U2DA 2Q49A 4A27A 1ZFNA 3TPCA 3D1LA 1UP6A 4ILKA 3ROQA 5EQDA 2VHVA 3ANMA 3NTRA 2C54A 1Y6JA 4DPMA 1YL5A 4F3YA 4BV8A 1N7GA 3DB2A 3D4PA 3I6IA 5TT1A 2PKRA 1MLDA 4AJHA 2X86A 1QV6A 1JDJA 5EERA 3T4XA 1J4AA 2NADA 3OF2A 4F6LA 3B1KA 4Y8VA 2PD6A 1YL7A 3WMWA 1ZSVA 2FN7A 3DZIA 5B12A 1F12A 2X5KO 3FPCA 3GF4A 3DBHA 1LDGA 1ARZA 5TT0A 4BMNA 1LTHR 1OI7A 3GNSA 5ER6A 3TRIA 1XR3A 5EQFA 3GEMA 3RC2A 3TZ6A 3I9MA 3JQAA 3HDHA 4J7XA 3X2FA 3QIVA 1MV8A 1H9AA 3F6YA 1ZMTA 1O9BA 1U7HA 1QXSA 4XJTA 3KYCA 4FW8A 4WNIA 1PX0A 1GR0A 3A4VA 1ORRA 4IIVA 1LDYA 2HSDA 5DP2A 4EEZA 2FR1A 3WTBA 5DNAA 3NDRA 3CUKA 3LT0A 1C0IA 1HZZA 3JD4A 3DBLB 4GPD1 4Z3KA 2X22A 4UULA 4N5NA 3MOGA 3EHEA 3QWBA 1ZJZA 2BGKA 3OIGA 4CM5A 5GMOA 2IZ1A 3QWAA 3IP1A 2NACA 1SEVA 3LF1A 2ZQYA 4IDGA 1H5QA 3PWKA 4IJWA 4YACA 4J2OA 3WJAA 1RYDA 2AEFA 1PS8A 2GERA 3HZZA 1YB1A 2D8AA 2QRLA 4GQAA 5JO9A 3SC4A 2IRWA 4YT4A 5L7WA 4DTIA 1HLPA 2DVMA 4PG8A 1XHLA 1Q7CA 1KVQA 4NQZA 4CV0A 4OSOA 7MDHA 3OMLA 5ENVA 3AU9A 1F14A 3B6ZA 3DMYA 4CQMD 2C7GA 1KVSA 2VQ3A 4MINA 1ZXBA 1MGOA 4DL9A 4KQXA 2VWHA 2BI7A 3C1TA 3ZH2A 1W0CA 5K6AC 3BTUA 2QYSA 4MVJF 3HE3A 1K6JA 4PGFA 3DZGA 5BSGA 1LEHA 5IDYA 1NX6A 3DHYA 5L95A 5JMWA 1TT7A 4HFJA 4TRRA 1U3VA 3ZHZA 3I9NA 4PLCA 4H7PA 4FN4A 4D42A 1JQBA 1JVBA 1I3LA 1WXDA 1GTMA 3HADA 3FPLA 4J3FA 1H94A 4J7CA 2DTDA 4LRSB 1BVRA 4NJMB 3JQ7A 4RVFA 3U4HA 2PKQO 5G4KA 5JPIA 1MA0A 3GN2A 5B1YA 1TLTA 1ADGA 3PTZA 3NTQA 4FFLA 1WDMA 2PKQP 3SJUA 4XYBA 4B8WA 5L9AA 1F06A 5JAQA 4ZVVA 3PXXA 1MC5A 4GWKA 3C3XA 3WFJA 4LSMA 3WICA 1T2CA 1U5CA 4IDFA 3VC7A 4FFPA 3ZWXA 4LVCA 5MGBA 2IXAA 2WSBA 1SOWA 3IMFA 1E3WB 4CLOA 5L4LA 2VHWA 5U4QA 1H6CA 3GY0A 3RBXA 2HMUA 3LF2A 2AE1A 3Q9UA 1A27A 4R5MA 4BNGA 2RIRA 5IZCC 1P1IA 3ZWNA 2BGMA 3EVTA 3PHIA 4Z0HO 1NR7A 2E37A 4W7IA 4JCOA 2BLLA 3QA9A 4UVHA 3WSVA 2GLXA 1H0KA 4Z3DA 4IY1A 3BXXA 3KV3O 4WCFC 3DZJA 2HU2A 4GGOA 4PLGA 3KRTA 3QWFA 3UICA 4FQ8A 1WZEA 3U4IA 2WTBA 3PFFA 3WB9A 4CMIB 1E92A 3VVBA 1DLJA 1UXHA 3QVSA 4R69A 4CQLB 1IZ9A 3KXDA 1A4IA 1P9LA 5U1PA 4CQMA 1GU7A 4Q39A 5A5FA 3GGGA 2PZLA 2Y1EA 1KEUA 4E12A 4IPTA 3GOHA 3OQ6A 1I8TA 4AJEA 6LDHA 4NFSA 3O38A 2C59A 3WGGA 5AXCA 4GGPA 4FFOA 3CZRA 2VNSA 4X54A 4XX0A 4JIGA 5TNXA 4RPKA 2V6FA 5CPBA 2RCYA 3WOHA 1LNQA 3GAZA 4CR8A 2NNLD 2YYYA 4XYEA 5JAIA 1NFQA 3PYMA 1GD1O 3L77A 2QZZA 3PK0A 1H6AA 3FHLA 4L8VA 2EWMA 4N5MA 1VPDA 2GUGA 3RKUA 2DBZA 4DVJA 1QORA 1A4UA 3CSDA 1FK8A 1E1MA 1AN9A 4I5FA 3WQSB 4EGFA 3S55A 2GDZA 2VRBA 1DFHA 3QRWA 3PZRA 1XG5A 4NBTA 5EL0A 4HADA 3QVOA 1C1DA 5KVVA 2VHYA 3TSCA 3CPSA 4R68A 1KC1A 4KDFA 4HKTA 1HDOA 2X0RA 3PFWO 1F8FA 5C7OO 5KJFA 4XCVA 4J9VA 1E5QA 1P1RA 2HK7A 4PLPA 2CF5A 2IXBA 2WYVA 2Y93A 1AXEA 2TMDA 2AXQA 2PGJA 4N18A 3NAQA 2PLAA 3ZWMA 2P5UA 4M54A 3E9NA 1GV0A 1O6ZA 2YDYA 3F1KA 5TJ9A 3STHA 1I32A 4FC7A 3OH8A 3ZV3A 3AU8A 2PTGA 1FDVA 1QRRA 5ER9A 5F1PA 4HY3A 3QWHA 2Y67A 2IDZA 1WNTA 2GO1A 1DLIA 3Q2KA 1HLDA 4BKQA 1LJ8A 1Y5RA 1PIWA 1J0XO 2CUKA 3JQ9C 4FS3A 5EESA 1NQOA 3GZNA 5JYDA 1R4NB 3CMMA 2Q2WA 5DOVA 3BMNA 2P5YA 4XQ9A 4IJKA 4WCFB 2Q4BA 1AUPA 1M76A 2BD0A 5ILGA 4LRTB 3DTTA 5GZ6A 1DPGA 2ZJ1A 2HDHA 1BXGB 5L3ZA 5TX7A 3GT0A 1BHSA 4OKNA 3AK4A 1PZEA 1DIRA 1N5DA 1V0JA 4BO0A 4IGEA 5F1KA 3JQFC 2EGGA 4J6FA 4DYDA 2O48X 2O3QA 2YY7A 3RC7A 4KOAA 3ROKA 1RM4A 1XCBA 3E9MA 3OSUA 2GRAA 1V3TA 4OO3A 3HJAA 4BL5A 3P5SA 3I9KA 3OJOA 1GEEA 3WGZA 5KJ6A 4ND5A 1PJBA 4FDAA 2Q45A 4GLLA 3QY9A 1EBFA 4JNKA 4RDIA 4RF3A 3BTSA 1PQUA 5I8ZA 2WWRA 3JYNA 5CDYA 5I7VA 1EZ4A 2O3UA 1OFGA 1XLTA 2R00A 3QP9A 4E5NA 1E3LA 1HDGO 4GBJA 4WECA 5JFOA 2FP4A 5JNLA 4W9NA 2G82A 3VKUA 3MEQA 3RUCA 2BHLA 2AW5A 1I2BA 2HLPA 9LDBA 3KSZO 1M2WA 3JCZA 3TQHA 3D4NA 2B5VA 1VM6A 3IP3A 5DP1A 4U7WA 4LGVA 2BFMA 3VZRA 4JROA 1ZK0A 1I24A 4BMSA 1B15A 1BSVA 4BNZA 2XXBA 1X1TA 4JGBA 5BT9A 4YQZA 4CV1A 6ADHA 1WMBA 1K0UA 1VRWA 1PS0A 2OP1A 2PZJA 4A0SA 3TZKA 5ITVA 2X9VA 4BNKA 4YR9A 2X7HA 2EGHA 2GF2A 4BGIA 3QQPA 2WJPA 1M6WA 5F21A 2D4AA 1Y9EA 4BKUA 1VL8A 5CEJA 3KVOA 2H9IA 4K9DA 4OXNA 1MXFA 2IODA 4J1TA 1T4DA 3CE6A 3PYXA 5IG2A 2Q1TA 1OMOA 2YW9A 2J6IA 3GC6A 3MZ0A 1NR1A 2YV2A 2DTXA 4IZIA 3IDSA 3C8MA 3ULKA 4Z0TA 3K96A 2GD1O 3D4OA 5ICMA 2NVUA 4RGBA 5TF4A 2JAHA 4J16A 3S2IA 1WWKA 2ZYDA 1ISHA 3A28A 4ZD6A 2BMAA 3WYBA 1GCOA 2D3TA 4OXKA 1I3KA 2J3KA 3QVWA 4ND4A 1QYDA 5HWSA 4UEOA 4BKPA 4EW6A 5C3MA 2YZ7A 2W2KB 5TSDA 2HRBA 3SX2A 4ALIA 4DLLA 3PWZA 3C1OA 4RV9A 1WDKA 3MWEB 1B3RA 5I9NA 2RH8A 3DZFA 3FBTA 1N2SA 2WDZA 1YVEI 1IOLA 3WIEA 3EDMA 2OO5A 2VT2A 4AJLA 4NMHA 4DC0A 4W4TA 3ZWYA 4CV2A 2FR8A 4BQPA 1CETA 3COSA 2UV8A 4XGIA 2AMFA 4M8SA 4ZQGA 5THQA 3U9LA 3DBVO 1E7YA 1MFPA 4R51A 4RPLA 2WE8A 5IDWA 1EK6A 2DFVA 3TOZA 5I8WA 3B1JA 1YE3A 4BNTA 3WJ7A 1I10A 3AI3A 4N7RA 4D7AA 1PZFA 4ZU3A 1E3JA 1P44A 4LMPA 4YCAA 1AGNA 2A9FA 1JWBB 2XPCA 5LDGA 3VH4A 3ITKA 4YXFA 2J5KA 2O3TA 1WPQA 2QHXA 4RJTA 1E7MA 5A1TA 3OQBA 4AFNA 1V9LA 3PJDA 4EJMA 3PHLA 1G1AA 1T4BA 2JAPA 2NVWA 4JN6B 1NTOA 3WDSA 2NWQA 4IM7A 1K2WA 4YJGB 3NV9A 5T8KA 3U4CA 2GN4A 3K2BA 2Z1NA 3M1LA 4G81A 2DPGA 4PZEA 4Q9NA 1I2ZA 1UAYA 5HRUA 1Q1NA 1BW9B 5A9TA 3UVEA 4NBWA 4BNUA 4YT8A 5JDIC 4YAEA 5CFZA 1CWUA 3HDJA 1NFFA 5G0UA 3ITDA 2HK8A 4YJFA 2GSDA 1LRKA 3GQVA 3WGHA 2B36A 3JQEA 1BDMA 1D8AA 3ON5A 5B37A 1HZJA 1S6YA 2Q2QA 4BMVA 2GR9A 1P3DA 3BIOA 1E7RA 2Y1OA 5L45A 3A06A 3N58A 4KP7A 5CP8A 4MVJD 1HYHA 4NBUA 3GGPA 4A7PA 4D0RA 2O3RA 4L73A 3UCEA 3TNLA 3K31A 3T7CA 4GWGA 1YQXA 3AY3A 4G65A 3O8QB 4I8XA 3FNHA 4TKMA 2GN8A 4QFCA 2H5LA 4R1TA 4ND2A 2BFAA 3DAGA 4NZ9A 1MG0A 2QZ9A 4C7KA 4E2XA 1NAIA 1O94A 4ZA2A 4JJGA 4Z0PA 1U28A 4WPGA 4AICA 4FGSA 2HAEA 1O5IA 2QRKA 5DCUA 3HN2A 4CMGA 3T7EA 3DFZA 4BUCA 2VZ0A 1R6DA 3O4RA 4BNNA 4XQGA 4N54A 1BXZA 3DAPA 4PIVA 2Q99A 2QYTA 3KYDA 5I7SA 4II3A 1UDAA 3RUAA 5HM8A 1E5LA 3SJ7A 5ILOA 3FCOA 2YUTA 4PG4A 1P1FA 2C0CA 5GY7A 4PG6A 3ONFA 1A7AA 1BG6A 5JAMA 8ADHA 4L4XA 3E6AA 3FSRA 1IY8A 2CD9A 2X4GA 3WLFA 1PJ4A 3FBGA 1LC3A 5ES3A 1XDWA 4KUGA 4ZQFA 4Z9FA 2PV7A 2NU9A 4PG5A 1G6KA 4OMUA 3ZNPA 4LK3A 5T67A 4A10A 3OA0A 1R0SA 3F46A 1V3UA 4MVJA 4BNFA 1RM5A 4QECA 4Y98A 4EEXA 2DC1A 3OFSA 2JFHA 2JKVA 4HFRA 5EINA 2OORA 3ORFA 1OOEA 4PG7A 1R4MA 4D79A 4XB2A 2VT3A 1RJWA 4CM4B 4YAGA 2EKQA 1W8DA 3GLQA 3MCVA 1YOVB 3ZCXA 4PLFA 1BWSA 2R2GA 3LU1A 4INAA 5A9SB 1R12A 1GUYA 1PU2A 3C7DB 4UUNA 2Y0EA 3ADOA 1CIVA 2UUOA 4PVCA 4JQCA 3P2YA 2B0JA 3BYZA 1MUUA 1C1XB 1OZAA 2B4RO 3MJSA 3MJCA 3DZKA 5HS6A 3FD8A 4BNHA 3FTPA 5AVOA 3GR6A 2X9NA 5AYVA 2VTDA 1GYQA 2LDXA 1YRLA 3MJ4A 1K6IA 5A04A 3CZMA 3I1JA 4MIEA 1DIGA 3I83A 3NX4A 4D46A 4GI2A 3TDKA 3WG9A 2AG5A 2X9GA 3BMOA 3NUGA 1BXGA 2E82A 3GNQA 1KY4A 1PJQA 3BZUA 5H81A 3L6OO 3HB5X 4IZHA 3M2TA 4CMEC 3RAJA 3D7LA 3BMQA 4NNJA 1Q0LA 3OEWA 2Q3EA 1EE2A 4W6ZA 2CVZA 2ZB4A 4NG5A 3TL3A 3ZGYA 4DPKA 1P0CA 2O7SA 3AOGA 4RQTA 3Q9NA 2BGLA 1V35A 2AEMA 1IHXA 1NPDA 3DQPA 3HHPA 3DO5A 3OJEA 5CDSA 2HJSA 4FR5A 3KTDA 4GKBA 4DBVO 4CM3A 2A92A 4YBZA 1RPNA 1FDTA 5A3JA 3FR7A 4IXWA 5A03A 2I6TA 4MOWA 2O4UX 2C5EA 1IHYA 1X1EA 3BMCA 3QE3A 4R4JA 4BGVA 1J49A 2VUSA 1PEDA 4I9NA 3DAFA 2X1HA 3I23A 5BQFA 3EW7A 1GQYA 1S7CA 2CFCA 2WD7A 4JJFA 1E3IA 3GVXA 3KZVA 1H2BA 2UVDA 4FOOA 1DIBA 1HYEA 3PWSA 2B69A 4CUZA 3ZHXA 4KMSA 2EERA 3SXPA 1T2EA 4MO2A 3DBRB 3LLSA 2GNAA 1VSUA 1I36A 4IDEA 4ZQBA 3PJFA 3QWIA 1DRVA 1HSOA 4O63O 1Z82A 4J2HA 4DMMA 4BO1A 1MFZA 2EKLA 2VWPA 4DLBA 4RVSA 1YO6A 4W82A 2VUUA 2W4QA 2WMDA 3JQGA 4MJLA 3VTFA 4FBGA 4PVDA 3JQBC 4IQ0A 3ZNOA 1ENZA 3OIDA 1ZCJA 2ZB7A 2NU7A 1DAPA 2NTNA 3RWBA 4E2WA 2W90A 3ZN2A 4B7UA 1XQ1A 1NHGA 2A35A 4P8RA 5L51A 5GZ3A 4DQUA 4ESOA 2PH3A 1K3TA 2A94A 3OJFA 1WDLA 3K8ZA 3KSUA 3PJGA 2W8ZA 3Q11A 4K26A 1BMDA 1H2HA 1GQ2A 2PY6A 3NT2A 3WR5A 4CMAA 1I3NA 3DDNA 2WE7A 1EVYA 3KLMX 1NP3A 1KY5A 3GUCA 4P4LA 4J49A 1KEPA 1O0SA 2V6MA 3I9OA 4W99A 2YHIA 1PSDA 2O4CA 1EMDA 5KJEA 3GA0A 3LC7O 2HRZA 1MX3A 1U8FO 3JQ9A 3TJRA 4WGGA 5JDCC 3UCXA 1MC4A 4I9UA 4B3JA 4ND3A 3ZU5A 2C29D 2OGUA 2Q46A 4A5OA 4IQ8A 4B4VA 2JL1A 3I9LA 5BNIA 1XWFA 1XU7A 1JKJA 1KEWA 1PS9A 2VZ8A 4AJIA 4BNLA 4OGWA 3EGOA 2J3JA 1U2GA 2ZKLA 5L53A 4UEKA 4CMBA 4KTTE 2EJVA 3P7MA 3WGYA 5ITWA 2H63A 2NV6A 3JQ8A 1GZ3A 3F47A 1YJ8A 4YJHB 1QYWA 3WBBA 1SMKA 4HNHA 3NYWA 4LISA 2BH9A 2EG9A 2Y1FA 2V65A 4YAJA 2C07A 5COAA 2VYND 3DFUA 1GPDG 1N7HA 3FF4A 1V8BA 2A4KA 2IZZA 1T2AA 2YFHA 5JCJD 2BFPA 4KWIA 2VHXA 4B4WA 5BNTA 3GPIA 3PIDA 5HA5A 2HK9A 2Y68A 3RU9A 1LI4A 4R3NA 1Z6ZA 3OETA 3CIFA 4EDFA 3LK7A 4GX5A 2W98A 4RCVA 1EFLA 3L4BA 1FF9A 1TVEA 1LRJA 2JCXA 3VPXA 1QV7A 1BRMA 3DL2A 5JE8A 1HF3A 1NQTA 3SEFA 1YBAA 3PJEA 1E3EA 3NKLA 4RZIA 4YAIA 3C24A 1E6UA 2P9GA 1XELA 3OJ0A 4R16A 4KUHA 4WLFA 3ZWBA 5G0VA 4M89A 5K9ZA 1YL6A 2DUUA 1L7DA 4FSHA 4Z9YA 3QW2A 4BNJA 1X0VA 1V6AA 4DIOA 4A73A 3L6DA 3NJ4A 1DRWA 2PGDA 1HETA 1ULUA 5DBGA 3OHSX 1ML3A 3JV7A 2O3SA 4CLDA 5JY1A 5J23A 4ROSA 2NQ8A 5A4DA 2XAAA 4U5QA 5L4SA 1WMAA 1TT5A 1SB9A 1LLCA 3AY7A 4ONEA 1PJ2A 3E5MA 4CLRB 1E1KA 1IZ0A 1BW9A 2DM6A 3ABIA 3R1IA 1CRWG 1K5HA 2DPHA 2RHCA 2ZIZA 3VKVA 3TFQA 1LDBA 3GDOA 4GX2A 1H9BA 1GL3A 3RFXA 4PZDA 2NUAA 1KS9A 2PD3A 4B8ZA 4YEDA 5JMPA 4ALNA 4FIZA 1A71A 1IPEA 1GUZA 1NVMB 1ZVMA 3DXFA 2JFGA 4L76A 5DOZA 1KVUA 1K89A 1Q7GA 4O59O 4RPGA 2VYNA 4E0BA 1YQDA 3JD3A 1NWHA 1HKUA 2LDBA 5JCJA 3RASA 5EPOA 4YPOA 1U3TA 3I9JA 1IYZA 1C0PA 3UUWA 2E49A 3QVTA 5CDTA 4TROA 1DFGA 1QMGA 3AI1A 1U3UA 2ZQZA 4WLEA 2FOIA 4J9UE 1DRUA 5B4TA 1LDEA 1IULA 4MKRA 5B4UA 5F1OA 3JQCA 1ZIDA 2Y1GA 1HE2A 3NDIA 4Q3CA 3PEFA 3UKOA 3ONDA 1FDUA 3I6QA 1X14A 3H2SA 1F8GA 5T5QA 4IDCA 5JAZA 3WGIA 4WE3A 4E5YA 3WLEA 1UDBA 1P0FA 2D0IA 1M66A 2E4AA 4NU5A 4R01A 1KYQA 3KSDO 4TMFA 4PLWA 1TI7A 1Y81A 3AJRA 4IS2A 5TQVA 4RVDA 2J5QA 3PIIA 3WXBA 3JTMA 1LBEA 1B14A 3E1KA 3GHYA 1SOVA 3U3XA 5KIAA 2P68A 4BO3A 4NFHA 5EN4A 4QT0A 2YQ5A 4UUMA 3H9EO 4JX8A 3P19A 4PRKA 4D45A 2VTEA 4XDYA 4QO8A 3NGXA 4HFMA 3DMTA 2G17A 3B20A 2Q1UA 2B5WA 4GLOA 2B37A 4KQWA 4YRAA 1HSZA 5IXYA 4WK6A 1EQUA 1F0YA 2I76A 2X58A 3E8XA 1X15A 3C7AA 4FFMA 3U62A 1NPTO 2Q50A 3V8BA 4OSPA 1P1JA 3CTMA 4TQGA 1QKIA 3ANNA 4CM8A 1SO8A 3W6UA 1BVUA 2J8ZA 1UP7A 3WSWA 4XR9A 4ZQEA 4JP2A 2EJWA 4CMHA 1N9GA 3HDQA 3FWZA 4K6CA 1JU9A 2I67A 3I5MA 1DO8A 2WEKA 3FN4A 3LT1A 3HFGA 3MWDB 4J4BA 3RI3A 1VSVA 3DOCA 4CL3A 1W6UA 3D3WA 2GASA 1BXKA 4I5EA 4BO8A 2VOJA 4MVJI 3RU7A 2ILTA 1EDOA 1LRLA 5AOVA 3ZWWA 2ZTVA 2WYWA 4CMJA 1UZNA 4HX5A 2P91A 1P1HA 5GZ1A 1Y8RB 5HBRA 1MG5A 3AM5A 3LSYA 3DHNA 5CG2A 1FMCA 5DCWA 5A9SA 4UVDA 4CM1A 1EK5A 5TC4A 2CY0A 4ID9A 2GN9A 3M6IA 1ZBQA 2YV3A 1YBMA 1U4OA 4E2ZA 3G3EA 4OIMA 3S1LA 3P2OA 4FB5A 5C7IO 4DIBA 3LC1O 1MB4A 1EVIA 4GH5A 1JKFA 4HWKA 2D1YA 4MKZA 2DBVO 3ETEA 1WLYA 3F4BA 5AXDA 3U09A 1LSSA 3A14A 3IKTA 1A7KA 4OQZA 4FJ0A 4GL4A 1IE3A 1DHRA 1ZK3A 3GNTA 5L7TA 4A2CA 1PR9A 4P22A 5DDIP 2B4TO 1LLUA 4JP3A 4YQYA 3D5QA 5DULA 5TRTA 4U0JA 4CR6A 4XZ3A 2FRDA 5L7YA 3E03A 1T2DA 4MVJM 3DBHB 4LN1A 1JTVA 4BHTA 1I5RA 4DLAA 1X7HA 4E6PA 5IJZA 4UUPA 1V3VA 4DGSA 1J6UA 4Q3AA 4K1LA 3NGLA 1E1LA 4IQGA 3JQAB 4AJ1A 1UP4A 4BO7A 1E1NA 4KZPA 4UVGA 4H3VA 2Y1DA 3B70A 4TVBA 3AWDA 1Q7BA 1ZJYA 3GVHA 3R6DA 4GSKA 5G0WA 4WEQA 3KYCB 1EUDA 1LDMA 2QQ5A 2V7PA 1CERA 2NLOA 4J91A 2Y66A 3I3OA 5ENDA 1E7QA 2O2YA 3O03A 4WLVA 3RVDA 1BGVA 3G49A 1GV1A 3GPDG 4D43A 1GADO 1ZMOA 3AOEC 3ETGA 4FOSA 3EK2A 4G2NA 4QSMA 4EBFA 5ADHA 1FDWA 4LCJA 3CKYA 4EJ0A 2DBRA 3QV1A 3WWZA 4XA8A 3GAFA 2EP7A 1PWXA 3WS7A 4YT2A 3L6EA 2HKIA 4URFA 1I0ZA 2AQ8A 2G1UA 4WKGA 4BNMA 1PJSA 1WZIA 3GFBA 3ZWAA 3H3FA 2OXIA 4RL6A 4GMFA 4EYEA 2PWZA 3ZDFA 3EC7A 1ENOA 4OQYA 1T25A 3H3JA 4BGEA 4BO4A 4D0SA 1Z75A 3H9UA 3AI2A 1Y5MA 1EUZA 1NM5A 4CLXA 2JFFA 4PRLA 4DRYA 4MDHA 3GK3A 4IIUA 3L0DA 1X7DA 4O5OA 4NH4A 4BNVA 4QO7A 3PGJA 3DBLA 3H65A 3K6JA 1B7GO 5KCZA 1OAAA 1YWGO 4JBGA 4LVUA 4QQRA 1UJMA 1XSEA 3E82A 2VNAA 3IC5A 1GUFA 2H1SA 2R6JA 1ZK2A 4FJ1A 4NBRA 5A05A 3IS3A 3V1TC 5TLSA 1ENYA 3QJ5A 1KEVA 4NBVA 4RVGA 3UW3A 2Y99A 3E5RA 3JQ7B 3K5PA 4GMGA 4MKXA 3HNPA 1ZK1A 5CDGA 3H5AA 1ZXLA 1C0LA 3PP8A 1Y1PA 1IL0A 1N1GA 1ZO8A 2W2LD 1TA4A 3UH1A 1PWZA 5I9LA 1M75A 1UZMA 4CLOB 3W6ZA 2GGSA 3PZBA 3C85A 3MJVA 4J1QA 3H9QA 4KWHA 4CMCA 1HWYA 5CG1A 4J90A 3NT5A 4MVJG 4WUVA 3GEGA 1KERA 1RM3A 1TXGA 1QP8A 1PJLA 3DC2A 1D4FA 4DIFA 3M1AA 3WWYA 1PGOA 2C82A 4NJMA 1SBYA 4DA9A 1X0XA 4I5GA 1HRDA 4XGNA 2D2IA 3EZLA 3HWRA 3RSHA 3DZHA 2SCUA 1UXJA 3H6KA 5G4LA 1QYVA 3HUDA 3LC2O 3MJEA 2FY8A 1Z45A 1SEPA 1CQJA 4CQMB 4IDAA 3IL2A 4L0QA 5IDXA 4HFNA 2OUIA 4Y6RA 1E3WA 2FSSA 3K30A 3SVTA 3K92A 3RQSA 4XDZA 5I7EA 3DOJA 3G17A 4TKLA 3RJ9A 5BSHA 1LQTA 3DR3A 1NQ5A 1FXSA 3IUPA 1UUFA 1NWCA 5A06A 3INRA 1U3WA 4XJSA 4EJ6A 1GAEO 3OBBA 4L4SA 1UXIA 1W73A 1Z73A 4IMPA 4Q3BA 3BHMA 4OM8A 2O7QA 4RF2A 1NPYA 2BF7A 5KVQA 4CV3A 2R00C 3ROPA 3I52A 3RROA 3WBFA 4CMIA 4DWVA 1HDYA 3BAZA 5FWNA 4I08A 1JA9A 4CQLA 1QR6A 3O26A 4Z6KA 2BI8A 2VCYA 1E0DA 1PGJA 3OIFA 4W9NC 5LC1A 2W2LA 2YJZA 4B4UA 4LMRA 2OFPA 1A9YA 4U0KA 3KBOA 4RPHA 3H7AA 4RO0A 1ENPA 2E6UX 3WMXA 2GPTA 3QSGA 1BTOA 4AJ4A 1SC6A 3CMCO 3Q6IA 1I30A 3KOUA 2XOXA 2C20A 3ZHYA 1LC0A 3HQ4O 3VDQA 5A3VA 4CM6A 3S2EA 4KTVE 2AA3A 1C1DB 4EITA 1B26A 2FPIA 1O95A 3DONA 3QHAA 3V5NA 4PFJA 2QW8A 2HMVA 4PLTA 5FYDA 3RUEA 1H93A 1GZ4A 2FZEA 2AQKA 1DAOA 4J1SA 3RUDA 5THKA 1Y8QB 2PNFA 2J5RA 1E77A 3ZW9A 1KVTA 4YWJA 1KETA 4CR7A 1UXGA 1GDHA 2UAGA 4ZRMA 2VUTA 2B35A 1JAXA 2CDBA 1T26A 1DJNA 1PGQA 1IUKA 3ASUA 1JAYA 3DWFA 2IYOA 3R0IA 5F3RA 1YDEA 4XQCA 1QLJA 2FSVA 3LZ6A 1HXHA 4S1VA 2EF1A 1VJTA 2H6EA 3GVCA 1LDNA 4MIOA 4NHEA 5AXBA 3WNQA 4PLVA 5K6AA 1JVSA 4LCEA 3F4LA 1C0KA 4UVEA 5KNLA 4OOFA 4ZRNA 4F6CA 5JDCA 1LUAA 2DKNA 5FI3A 3C1AA 3WGOA 2ZB8A 2I99A 2AQIA 1DC3A 1YDWA 1LXCA 3GZNB 3Q0EA 3GUYA 3H9JA 1HDRA 2D5AA 2JHGA 3BMNB 4GVXA 1X13A 2OZPA 3PDJA 4R3WA 3OEYA 4O1MA 1DXYA 2UUPA 3L9WA 1Q0QA 4CODB 2Q2VA 1XEAA 1CEQA 3ZWCA 1SNYA 5G0TA 2OBNA 3F3SA 4CM7A 1PTJA 1R0KA 4IGFA 2AHRA 4JLWA 3LT2A 2HMSA 1Z74A 1E7WA 2FZWA 4ALKA 3AUSA 1L7EA 5IZCA 3SBOA 3UGKA 2F1KA 4E5PA 1VLLA 3KM0A 1HEUA 2X0NA 4WLUA 1R4NA 1B3BA 3VVCA 1ID1A 3U0BA 1HE5A 2EKPA 2VOEA 4H15A 3ZWPA 4WCFA 2JD0A 3S2GA 2DT5A 2EHDA 2JCYA 4U6QA 3ZWVA 3DEYX 3F1LA 4GSLA 3TL2A 3W4JA 5CDUA 5KVCA 1SPXA 1YH3A 3WGTA 4YRDA 2JD1A 3F9IA 1VI2A 3S8MA 4J0FA 2OMEA 2AG8A 1DJQA 4UREA 1U5AA 2Q4EA 3A1NA 1MXHA 3NJ8A 1BDBA 3AUAA 1AE1A 4YA6A 4YTEA 4R1NA 3L07A 1N92A 5KWEA 1ADFA 2G0TA 2P4QA 1Z7BA 2X23A 4XEHA 2GZ2A 2FR0A 4WLOA 3UHAA 3S2FA 3JYQA 4ALMA 4EUHA 4ALJA 4P4GA 2YV1A 5EIOA 2GZ1A 3TOXA 3BHJA 3V2UA 2BRUA 4DQXA 4OL9A 1E3SA 3PDUA 4FFRA 1M6HA 3TZCA 1ZZEA 1ZSNA 3G1UA 3NDJA 3R3SA 4B79A 1GCUA 3GG9A 4FD3A 4EUEA 2CDCA 3GVPA 4OAQA 4E3ZA 1CDOA 1RKXA 1XIVA 8LDHA 1GQQA 1NBOA 4BOYA 1Y7TA 2JJYA 2VZ9A 1GPJA 5AQ1A 4OOEA 4W7HA 4BB5A 4DMLA 4BIIA 4A03A 4E21A 3WQRA 4OKIA 5AXAA 5ICSA 4C4OA 5F5LA 1GY8A 1RYEA 4J4HA 4M49A 1ZW1A 1I01A 4AJJA 1C14A 1IPFA 4E31A 5KVSA 3ENNA 3K2EA 2I5PO 1UR5A 5IN5A 1ZKMA 2V6GA 1LLDA 3JD1A 3IKVA 3L4SO 2NVUB 5H82A 3ANLA 1PL7A 4BNYA 3UXYA 3IOYA 3KUXA 1E6EA 3D0OA 4QEDA 1YBVA 4NR0A 1ZEMA 4R9RA 2AQHA 3ICCA 4XRGA 1YKFA 4S3MA 3O9ZA 5KKCA 5LDHA 4DUPA 1HDZA 2VYVD 3OM9A 4NDNE 2EP5A 1NAHA 3H2ZA 4XYGA 1XU9A 3IIEA 3AFMA 4AJKA 4D3DA 1Q0HA 3LYLA 3RBZA 1PGNA 3D3EA 5DN9A 4D41A 3GRPA 1E7SA 4OHUA 3VOSA 1A5ZA 4PCVA 5B4VA 2NTVA 1QSGA 1NFRA 4MP8A 4HBGA 5COQA 3MJTA 3ZV5A 1ZK4A 2DUWA 3GMSA 5KJ1A 1B16A 3KLPX 4BV9A 4FPXA 3U5TA 4YRBA 3IJPA 4ZGWA 2DLDA 4FFNA 4DQVA 2ZCVA 3SLGA 4JBIA 2EW8A 3SC6A 4LSWA 3EAGA 5CPFA 1XGKA 2IE0A 3GDFA 2W2KA 2XXJA 4B7CA 1VJ1A 4E32A 3UOGA 1B0AA 4BNWA 3ASVA 4AJ2A 4XKJA 4MVJP 3WFIA 2DTEA 4TZTA 3JQFA 4ZJUA 4LW8A 5FF9A 1HT0A 2FHSA 4XYMA 4CUJA 4L9RA 2BELA 3RKRA 1FJHA 3PGXA 3VZPA 4MPDA 1M67A 1YQGA 2CDAA 3JQDA 5BSEA 2NU8A 4AG3A 4HV4A 2ZK7A 1NASA 5TIIA 2RBEA 4BVAA 4TZKA 2RAFA 3G79A 2FPGA 3INTA 1P33A 1DBVO 4R1UA 1EFKA 2XF8A 3NT4A 3VPFA 3WTCA 5KJCA 4Y9DA 3GZ4A 3RCBA 2UYYA 3PRJA 5KTKA 4DC1A 4L75A 4XRRA 5FEUA 4U6SA 4RZHA 4NFYA 4YJFB 5TJHA 5C7LO 2VRCD 5C37A 3EY4A 2FPPA 1PJ3A 2VYVA 3FNEA 5JW6A 1EUCA 2X8LA 1Y9AA 3IJRA 5DBFA 3HSKA 5CAEA 1LSJA 1ONOA 1TEHA 3PQFA 1PGPA 4RLSA 1JKIA 1UH5A 3WNVA 1NYTA 2D59A 4AJNA 1LSOA 2HCTA 2P9EA 4AJPA 1WP4A 1O89A 4YJGA 4YJDA 1VC2A 2HQ1A 5DZSA 4WEOA 1G0OA 2VWQA 3RFTA 3VDRA 4BGUA 2HMWA 4E4YA 5IXSA 2AEJA 3AFNA 2GYYA 1CF2O 4Z9XA 1DIHA 4U8GA 1OC2A 3RUIA 1HE3A 4RVHA 1T2FA 3B1FA 3GVIA 3VTZA 1B8PA 1GEGA 3RD5A 4XYLA 1LQUA 2GCGA 2Z5LA 5IF3A 5JO0A 1P77A 1CYDA 3E9QA 2HMTA 5I9MA 3V2GA 3AOEA 1ADBA 4RF4A 3KO8A 4KDEA 4WOJA 3KYDB 1L1FA 1ISFA 1P45A 1T24A 4E33A 2PR2A 3F5QA 5BR7A 3O8QA 1QYCA 1UZLA 5CEFA 5JC8A 1P1KA 2CF6A 3G0OA 1EVZA 1U7TA 1KVRA 1QYXA 4L74A 2EXXA 3RC9A 1DFIA 4I1IA 4E30A 2PK3A 2ZB3A 3UAGA 1R66A 4R9SA 3D5TA 4J0EA 1UDCA 1UXKA 2VRCA 2GN6A 3MTJA 2BKAA 4XR4A 1XYGA 4PN3A 4WCDA 2Y05A 3WQQA 1C3VA 4XQEA 4ALLA 4NI5A 1B2LA 5MDHA 3KB6A 4WOKA 1PL6A 1Q2XA 3MTGA 3VH1A 5H83A 5T57A 4RVUA 5IZ4A 3ROMA 1KOLA 3QVXA 5TS3A 1IB6A 4BS9A 4Q3DA 1NNUA 4Y67A 2PH5A 4R41A 4ZICA 3TFOA 1PJCA 3KETA 4FC6A 1XKQA 2GZ3A 3K9QO 4OJNA 1Y8QA 1A9ZA 1R4MB 4CL8A 3H5NA 3JD2A 5T64A 2ZATA 4WLNA 4NIMA 1NVTA 3EVNA 4XIYA 1VJ0A 2E48A 3HN7A 1E6WA 3NTOA 4PLYA 4GX0A 2V6BA 1OC4A 2WM3A 5JY6A 3DZBA 1K6XA 4K6FA 4TRJA 1RWBA 3BTVA 1EQ2A 1KC3A 4PLHA 2P4HX 3KEOA 5HS4A 4M86A 5EMHA 4QXMA 1YB5A 9LDTA 2YFQA 3WGQA 3RIHA 2DQ4A 3Q3CA 5U9CA 3MOIA 3ZU3A 1R16A 4NJOA 3X2EA 5COBA 3ONEA 1TB4A 3RJ5A 4NU6A 3VPSA 1DHTA 4CM4A 5FI5A 2CMDA 3AY6A 1YOVA 5IN4A 2I65A 5DCYA 1SCUA 3BMOB 4P4NA 5DF1A 5FFFA 1WAMA 4I9HA 3W8DA 1LLQA 3AUTA 2C2XA 4HUJA 3ZNNA 3ZU2A 5JDIA 3K73O 4CLHA 3BMQB 1W4ZA 5I7FA 1VKOA 1LU9A 1C1XA 1U8XX 4B3HA 2OBYA 3CEAA 3HB4X 3VPGA 4BO5A 3BA1A 2P9CA 4MP3A 4IUYA 4MVJH 3UN1A 5G0SA 3FWNA 2AE2A 3AM4A 1I2CA 4FJ2A 5LCXA 3GDGA 4YYZA 4D3FA 1B8VA 2X0JA 1ISMA 2CSUA 3H4VA 1VL6A 4O0LA 4DXHA 1ADCA 3L4BC 4EUFA 3KYBA 3BMCB 3N74A 4UUOA 5JS6A 2I66A 2I9PA 3DHEA 2I3GA 1ISJA 1ZNQO 4R54A 3JYOA 4B4OA 5KOIA 3GN1A 3H5RA 3GG2A 1JW9B 4BO6A 2WD7B 3JD0A 2VHZA 1D1SA 4HXYA 1YB4A 4AJOA 3GRKA 4MP6A 3TWOA 1ZH8A 1B8UA 4NPCA 5DBIA 5IFLA 1DC4A 3LVFO 2X5JO 3KHUA 4DPLA 5F5NA 4XIJA 1DB3A 1PZHA 4IXTA 3RUFA 5IAAA 4OXYA 2ZYAA 3GMDA 3PHJA 3JQGB 3QLJA 4WASA 1P31A 3V1YA 4IJUA 1PR3A 3ENKA 3EMKA 3ZZNA 2NSDA 3PLRA 3CH6A 5JSFA 4IBOA 3HDYA 4CJXA 1EEHA 1EVJA 1D3AA 5JXWA 4F46A 3W4KA 1GYPA 2HO5A 3FI9A 3VAZA 2Q1WA 5BNFA 1JN0A 4WJZA 1R0LA 4HNGA 3AW9A 3W4IA 1HE4A 4Y6SA 2HJRA 3R3JA 4CPDA 1ONNA 3DBRA 1Z7EA 4IMRA 4QX6A 3PPIA 4I5DA 3LT4A 4PZCA 2PGLA 3SLKA 4BQRA 2Q1SA 2JD2A 5T6BA 1GYRA 3TZQA 3BHIA 1VL0A 5L40A 4BNXA 5A9RA 1I33A 3UF0A 4UAGA 4ZHSA 2YHIB 4RLHA 1G0NA 3FNGA 4IDDA 1H6DA 2ZYGA 1PQPA 1KBZA 3OECA 3INGA 2DFDA 3EZYA 3RC1A 1N1EA 4TSKA 2NU6A 1VE9A 5A02A 5G2OA 1QG6A 3FRJA 1LA2A 2ZJ0A 1ONPA 2D5CA 1NVGA 1VKNA 2DAPA 3HFSA 1SAYA 1X7GA 2CNBA 3GFGA 5G4KB 4QTZA 1AXGA 1T1RA 2Y0CA 3TZHA 1I3MA 4QUKA 1T1SA 4MVJE 1OBFO 3DOOA 4ZQHA 3LLVA 3JYPA 2OHXA 4TVOA 3TF5A 1LSUA 2POQX 1PQWA 3DTYA 1PZGA 1HTBA 3JQ8B 4IINA 4DYVA 1ZSYA 2YDXA 4EI2A 1HL3A 3LDHA 3WX0A 4L4RA 4Y6PA 4XB1A 2IZ0A 4D3SA 1U1IA 4EZBA 1PL8A 3E18A 1AHIA 3DMTC 3T4EA 2IEBA 4BKOA 4IS3A 3I4CA 4RQUA 4CMKA 4E5KA 5JCXA 2ZTUA 3BTOA 4UEJA 2EEZA 3VH2A 2P2SA 4NK5A 4YDRA 2X0IA 3W8FA 3ADPA 3VPHA 4D44A 2CVOA 2PZKA 4RORA 2F00A 1NXQA 3FNFA 1DC5A 3GHHA 4PLZA 5JLAA 5JC1A 1J5PA 4Q3NA 2X6TA 5CHEA 5L4NA 1GFSA 2JHFA 1YGYA 3ZNQA 4GKVA 3PYLA 4R5HA 4YJHA 4K28A 2O23A 4CMEA 1DOHA 1D1TA 3D64A 3H8VA 1CJCA 2NQTA 3E48A 1RM0A 1MP0A 3PLNA 3JQ6A 3NEPX 3OP4A 2Y1CA 2NM0A 2X5OA 2C7VA 1EDZA 4Q3EA 3WIDA 5HTOA 3N7UA 3PHGA 4YB8A 3OQ1A 3ZU4A 3ZW8A 1U9JA 2FMUA 2ZTMA 1TT5B 1YJQA 3PHHA 4GAEA 1XA0A 4XD2A 3VH3A 3IAHA 2WD8A 1JWAB 2DBQA 5C5IA 2RH4A 3I4FA 3PQEA 4E13A 2NVBA 1YONA 2YHUA 2QX7A 1JLLA 1DC6A 2RHRA 2VN8A 3PQDA 4A26A 2CZCA 3WYEA 2OOSA 1DDOA 1R37A 1FDSA 4JJIA 2DU8A 4ND1A 4TRMA 4BNIA 2YQ4A 1U4SA 3GH3A 4J4TA 2QIOA 4CM9D 1WVGA 3ZV6A 2OP0A 3VHRA 1NQAO 2WYUA 3WYCA 1ISIA 4ZN6A 4II2A 4BB6A 4CUKA 1YXMA 4AL4A 1DEHA 1O8CA 1WW8A 1SB8A 1ZUD1 5JYEA 3C7CB 4CLRA 1NHWA 1D7OA 3V2HA 1GZ6A 1ULSA 3UFXA 2PA3A 3HG7A 3JQBA 2O2SA 3H9GA 4ITUA 3U4DA 3JSAA 4JXKA 1PJTA 4J43A 2C2YA 4YT5A 3ZI0A 2UDPA 3W1VA 3OA2A 3EUWA 2B83A 4RDHA 2PZMA 4O6VA 4OH1A 4OYRA 4NK4A 3PI7A 3GGOA 4WNCA 2OL4A 4UVIA 1LX6A 2Z95A 4GVLA 1F17A 5CEEA 4M55A 2G76A 3PVZA 3NRCA 4BO9A 3AM3A 3IQDB 4HP8A 1YS4A 4DREA 1HDXA 1ISGA 4JBHA 4R1SA 1P74A 4B7XA 1KIFA 4B3IA 3TN7A 3OJLA 4XWYA 4E5MA 4F45A 3KEQA 1EE9A 2QRJA 4JK3A 4BO2A 5EJ2A 3VZSA 2PD4A 4KUEA 3JYLA 1QLHA 2EIHA 4G5HA 2B4QA 2EW2A 4XGKA 3ZV4A 3Q2IA 3ZHBA 4AVYA 4FCCA 5KKAA 4CM8B 4FGWA
chains in the Genus database with same CATH superfamily
4DBZA 4D9JA 3QGMA 3GEDA 1E0JA 1X39A 3E7DA 2W83A 3QU5A 4B34A 1Z5GA 1GZVA 4Q9JA 4Y1RB 4ZT4A 3B53X 4HVLA 1UBUS 4QUJA 1U9YA 3IUSA 5F7JA 2IEDA 1E1YA 2JFUA 1YB6A 4ZWNA 4TLCA 5K0ZA 3OCWA 1EDBA 1DIAA 7ADHA 3Q7EA 2AUNA 3NVAA 2GJ4A 4GF5A 5C46F 4ZO4A 1MN6A 2VHJA 2VEOA 3GBVA 3UCFA 3ICPA 5CLHA 1XN4A 4QFDA 2GJSA 2YXDA 3CX7A 4FM9A 3RUHA 5KYNA 2GM3A 1M2HA 5EJEA 2IYSA 2QRHA 1Q11A 1TMGE 4X7MA 3JQAD 4N0QA 5KNCA 1MTOA 4YREA 4I4TB 3LAWA 4OK3A 2VDNB 4AKSA 4GU5A 2O5CA 3N0WA 3FUXA 3I2JA 3PKJA 4UTRA 1PVOA 5LDHA 4ZOBA 2GAOA 1OJLA 1DCMA 2IYZA 3DLHA 4P84A 4N5HX 1LH0A 2XUOA 2YTZA 5KSZA 4G4SO 1C9NA 1UAGA 4US1R 1EBUA 3EYWA 5DHUA 4BTLA 4FZRA 4J1NA 1Y9DA 3OKFA 2Y1LA 4HHEA 4YVFA 2BVNA 2VLBA 5BSFA 5IT5A 1XPJA 4UTPA 4HAUA 3EUAA 1BJKA 4B6FA 5LB2A 4R2WA 2C2BA 2BGGA 2HZBA 4HAZA 1AUOA 1TLLA 3FTNA 4E2YA 1PG5A 4DA6A 1RZRA 4M1QA 1FTYA 3IBSA 5I01A 2J9RA 3D8SA 2Y0DA 4FU0A 3G1TA 4NX2A 4WZ6A 2P11A 4MKGA 4ZVMA 1W4AA 4GX1A 4MZXA 3ZE2B 1QVWA 1ZICA 3CINA 3M2PA 3V1UA 1U2DA 5EMJA 4RZ2A 2Z6VA 3QITA 2OG1A 5FWDA 1EFDN 1PFKA 1YNOA 2IE8A 4A27A 3IPYA 3LKZA 4X9XA 3TQOA 1AG9A 3TS1A 1YUNA 3E3OA 1Q83A 2PX6A 1WCIA 1EM6A 1XVVA 4C7VA 2I1LA 1Y6JA 1SUDA 2HADA 3CKLA 4DPMA 4OXRA 1Z39A 4LE1A 4QRIA 3ASZA 3TH5A 2TSYB 3PQ8A 3DB2A 1GP2A 3E1SA 4RHEA 3D4PA 4C0BA 3HCRA 1MLDA 1KAQA 1DJPA 1NP7A 2GYWA 4K9KA 4NU8X 4ENSA 2P6RA 4RD2A 3RPEA 1J4AA 4XFJA 2ZJ5A 2XF2A 4ZOAA 3F73A 3B1KA 4FFBB 4R8LA 2PD6A 3IR6A 3WMWA 2R3SA 1L3BA 1BU8A 1F12A 2QKYA 2FVYA 3HJUA 3FPCA 3MERA 1SQGA 3GF4A 1AGXA 3HNOA 3GLIE 1UWCA 1LDGA 2JS7A 3WDKA 5BMVB 1OI7A 1X7XA 1T3HA 1XR3A 4J07A 1KJNA 3QPWA 621PA 1GNVA 1IJKA 1R8XA 4LUCA 3DEKA 4FEAA 1UCFA 4J7XA 3EZGA 4WN3A 2H2IA 1FBTA 3X2FA 3SZ3A 5TF0A 5BR4A 4OYHA 4I1UA 2X6QA 4MB0A 1H9AA 3S99A 1ZMTA 2VZLA 3B1ZA 4XJVA 4OM7A 3H5WA 4XB6B 1JI0A 3IR5A 1MQSA 3KYCA 2FP3A 1QDLB 2WSSD 3UB2A 1FW8A 4N01A 2I4NA 4IIVA 1LDYA 3IULA 3FWKA 1A98A 2FR1A 3EMDA 3HMKA 3TECE 4U7DA 2WPNA 4ZYXA 5IUNC 4MTLA 1EYZA 3RIMA 2BWJA 2X22A 4U7TB 3U7IA 4MGEA 4AZ3A 4G9EA 5CT9A 2IEIA 4DV4B 3JAWA 1O4VA 3IP1A 3C48A 2R62A 2CL5A 1TAHA 2ZQYA 1XTQA 3K09C 4DDVA 3WJ2A 3TVTA 2D2XA 4RJKA 3IB3A 3FFXA 5TMBA 4J2OA 3WJAA 3HZZA 1PS8A 2OCIA 3LX8A 2D8AA 5JO9A 3MMZA 2ZYIA 2NYUA 2IRWA 2Z8YM 1GNPA 4YPVA 2QAJA 4PFSA 3ZWDA 2BKVA 5B6JA 4NY1A 3ZPXA 1XHLA 3OCCA 3QUTA 3VR3A 1PV1A 5HF6A 4QQKA 1YA6A 4CV0A 5DCLA 2JJ8A 1BS2A 1DL5A 1XMJA 1CU1A 2FMHA 2GA8A 1QRAA 1WJGA 2V4UA 3AU9A 3DMYA 2C7GA 1CB7A 2H2AA 1KVSA 3FRHA 4Z4FA 2VQ3A 1PYDA 3H1AA 1BAPA 1ZXBA 1WQ3A 4ENUA 3T3NA 3E1GA 4DR1B 3N3AC 3AIOA 4DL9A 1Y6FA 3NNDA 4GP9A 4X7BA 4KQXA 3MCAA 2BI7A 2H8GA 5DTIA 3F6SA 3ZH2A 1W0CA 1S2OA 2QVLA 3FDZB 1RW4A 2Q4TA 1UKEA 1XRNA 2YXNA 5G1NA 5K3DA 4PGFA 2ZIXA 1DC7A 1UOQA 3TCKA 1IY0A 3GFVA 3KE8A 3VMMA 1TT7A 4GPZA 5JMWA 4HFJA 5K8TA 1N2BA 4ER7A 4PLCA 5GOTA 3RVKA 5ES4B 4H7PA 4XTCS 4D42A 4YMTA 3TQQA 3UXMA 1I3LA 1IZYA 1GTMA 3FCCA 3FPLA 2VQDA 1H94A 4IVRA 4J7CA 1DP4A 4LRSB 4Y2JA 5ANRB 4OHXA 1I1NA 2PKQO 5JPIA 1MA0A 1BE8A 4CTOA 1SFRA 3DZDA 3NP7A 3SJUA 4XYBA 4P83A 4MJ7A 1ZVVA 3RIEA 4R2XA 2MSEB 1X2EA 1K3FA 1F06A 1LPSA 1XZNA 2KLBA 3U4QA 2QN9A 4GWKA 4N6NA 1ATIA 1A7JA 1CT9A 3JVIA 4EVSA 1SUBA 2FOXA 1CQJB 3EVAA 4LVCA 4KEAA 4C4AA 3DVRX 3SQXA 3M6MD 3IMFA 4CLOA 5L4LA 1OR8A 1RWNA 2D1TA 2FMKA 1H6CA 2WU4A 3LF2A 2RG1A 3ZC3A 2A9OA 3E9CA 1UBJS 2ST1A 4CHGA 3A4IA 2HCFA 4IZOA 4D0LB 5AD1A 4EARA 2M1ZA 1L7VC 3D2BA 1YZYA 4TWJA 1PNTA 2ID9A 2H2GA 2R8EA 4LOHA 3BORA 4NDZA 3CZQA 3BXXA 3L7JA 1PV4A 3KTAA 5CMLA 3C3EA 2FPKA 4WCFC 3ZYCA 4F9FA 4GGOA 5CA1B 2XE4A 2OZVA 4YCDA 4KYTA 1TVKA 3K5HA 1ZY2A 4JL5A 1WZEA 2XRFA 3VDXA 4DRXB 2WTBA 3G9ZA 1BZYA 3BSSA 5ALNA 2VNIA 1E92A 1IN8A 1DLJA 4R69A 1WZ2A 3E15A 4KXXA 4ZTZB 3KXDA 1P9LA 2QRGA 4J03A 4N47A 1GXSA 2OZLB 1D6NA 1RVDA 4XAQA 5C7LO 5KC8A 3CISA 2NZUG 3PQ7A 2NUPA 5I48A 1YVPA 2PL3A 3FOEC 2UZAA 4FE3A 3ZZTA 4KAJA 3D3KA 1H2RS 1M2VA 2QGNA 4IPTA 4RELA 3GOHA 1I8TA 4QTTB 1C7RA 4FMPA 2ZITA 4OEHA 4YFYA 1RU3A 6LDHA 3ZLUA 2OXRA 4D6XA 3SEAA 1EUYA 3IVCA 3IUEA 3GJQA 5CK5A 4X6XA 5J9FA 1SBTA 3V8EA 4ARAA 4BE4A 1NYRA 3D7SA 1UODA 2VNSA 1Z33A 3DXZA 3NHUA 2FPIB 1GRRA 3HPQA 2VL7A 3OO0A 5B3AA 2REQA 3C45A 1GTJ1 2LKDA 3JVVA 1HY3A 4H6WA 5CPBA 4Q48A 1BKSB 1W5TA 4TGLA 4UUBA 1QOZA 1U7OA 4EF5A 1E2UA 2NNLD 1ZH6A 2B8JA 1L5RA 2VZEA 1NFQA 3RRNA 3WL6A 3QE9Y 3NG1A 4BVBA 3L77A 4DA8A 2QZZA 4ZEMA 1H6AA 1GTL1 3FHLA 4L8VA 5D8DA 1BGXT 2EWMA 2RKBA 3PKIA 1J0DA 5TMPA 3GZJA 2GUGA 4PANA 5E2BA 2IS2A 2DBZA 2QYHA 1HR0B 4DVJA 4JZKA 1D2MA 3N8DA 3CSDA 1JR2A 3K9NA 2JEOA 2WD9A 1OYOA 1E1MA 4I5FA 1BHJA 1M8JA 5DISB 3BKXA 1YASA 3L2OB 4C21A 1HC7A 1QS0A 1W52X 2RGRA 2GDZA 2FGKA 3PEEA 5F77A 3KR1A 3QRWA 2CJPA 2NXWA 2R65A 2V03A 3E3NA 1S8AA 2V7UA 3QVOA 1C1DA 1LD3A 2FUKA 1WUIS 1F6BA 1RQNA 2ZZNA 4Y2XA 4R68A 1KC1A 2J6BA 3MSXA 4FMBB 2BMWA 2ZFUA 1XRLA 2G7MC 3IAXA 1PK7A 4FXOA 4MV6A 5F78A 3UHFA 3V3TA 4Z4CA 2IUSA 3NBYC 4RHTA 4PBSA 4J9VA 4L4ZA 4TXMA 5AH0A 4Q21A 1BQ4A 2CF5A 2IXBA 2WYVA 3O8LA 2GBCA 1PT9A 4J0KA 2Y93A 4QQNA 3ZGXA 1TF5A 1AXEA 4QDUA 3C6XA 4R81A 2O9JA 1GRNA 2Q0SA 2AXQA 3W5CA 2WNSA 4N18A 3KKMA 3NAQA 3L4KA 4S1OA 3E22B 4OHKA 1GV0A 2YDYA 3F1KA 1N6PA 3E61A 4R05A 5FIUA 3MCWA 5F9MA 1QQTA 3IBFA 5TJ9A 4P7JA 3BE8A 5AI5A 2JGDA 4UFOA 4CEIA 5DRYA 4AYTA 1C1HA 1V2HE 5ER9A 4ME6A 5AT1A 4WY2A 3EXFA 1I9CA 4QOFA 5FHQA 1VKJA 1G21B 3GELA 1M6VB 1P2UA 4C6HA 5IYZA 4ZOQI 3QX3A 3CLTC 1G60A 3A1TA 4RETA 1NUUA 1UMBA 2R4UA 1Z83A 2SECE 3W2EA 4H1TA 2B4KA 2R7NA 4M21A 4CETA 4FS3A 4GDFA 5LOVA 2WNHA 3NFRA 4C43A 3ADKA 3P96A 4TMWA 4MAMA 3AEQA 1KAHA 3UOAB 3JAKB 3NUZA 2JFXA 4ADSG 2Q2WA 5LMNB 3BMNA 1OLSB 4OGLA 2CMFA 4IJKA 2I6GA 1JHYA 3BPSA 4YI3A 1ADYA 2CFTA 1N6IA 1M76A 2IEAA 1G20E 4YASA 3UJBA 4IXDA 2QV7A 4WKPA 2BUCA 3A6PC 2ZJ1A 4PZPA 3L7KA 3NC1C 4K8RB 3LOPA 4PAMA 5TX7A 3GT0A 4AG3A 5EXSA 4IKEA 4K1XA 1GFWA 3GLGE 1K5DA 1Z4OA 3BWBA 5F1KA 3JQFC 2C04A 3OT1B 2FW9A 3HZOA 3M3DA 1KAMA 4PRZA 4KIUA 1SIWA 3RVOA 2YY7A 3BXHA 4H2DA 4KOAA 4OLHA 5HBGA 5H16A 3RC7A 4DEVA 1DX9A 3OSUA 1YS9A 2GRAA 2WKQA 4QASA 4G1VA 4IDPA 5FUMA 4F96A 3SF0A 1QZTA 1C1YA 1Z2EA 4BL5A 3TEFA 4G0VA 3WGZA 1I13A 4N39A 4Q15A 2DPYA 3FKJA 1DCKA 3L49A 4V3CA 4DQ0A 2J0SA 4FDAA 2W2QA 4QBKA 4GLLA 2L42A 3V7WA 5JNSA 5KX5B 2XUKA 4UNNA 3AM1A 5I8ZA 2WWRA 4RM3A 5C5DA 5CDYA 3GAMA 3LKDA 4HMPA 4AMZA 4O2LA 1EZ4A 4JASB 5JRZA 4O2AF 1FLAA 1UQTA 1WHSA 3QP9A 3ORHA 3RDPA 3L6CA 1TJ4A 2QSYA 1HDGO 1Q22A 4MV1A 2IT1A 4WY8A 3AKCA 5G1OA 5F3WB 5CFLA 4Q7JB 3GUZA 1AQIA 1MOSA 1UJNA 5H68A 4W9NA 3G82C 1XEWX 4LHZA 4B3GA 3SIWA 2Z2ZA 3NM4A 3AETB 5TQ0B 4DCJA 3R7WA 4QGSA 2AW5A 9LDBA 2LNDA 3HI6A 4OY3A 2BT4A 10MHA 2OD9A 1J1ZA 2CXSA 4XUEA 3WQBA 1T9GS 1OROA 4N8DA 2ODAA 2GKOA 3QLVA 1GZSA 1UPFA 4JROA 3V46A 4OJKA 1I24A 3W06A 1B15A 1QIFA 5JJBA 4F9TA 1PHPA 3HSYA 2FSPA 3N0VA 1U3GA 1XI2A 2K2WA 5AQEA 1RFGE 2RCNA 2WFAA 4HWRA 5AIAA 1VRWA 1QLWA 2OP1A 4A0SA 3FKSA 4URHA 3DCYA 5TQJA 2IPNA 3P4XA 5DTRA 3QFTA 5C18A 2VXBA 4KI7A 4BNKA 2NX2A 1YDHA 2VRNA 5AM1A 4YR9A 2J85A 1T0JB 1EAMA 2X7HA 1EA5A 1Z7YA 4FYKA 2AN5A 1ORHA 5BWCA 3QQPA 5IFKA 4W5OA 4U63A 3THWA 5FTMA 2DHDA 5IEBA 3WZLA 5JAUA 1OH5A 4ARZB 3LV8A 1VL8A 1KJ9A 2WU0A 4ISCA 4KH1A 3TW0A 4UHBA 4PIPA 4D80A 1JFSA 4OXNA 5KC9A 1K1EA 1OPXA 1N34B 4J1TA 4RJ2A 3PYXA 4XD7A 1I9GA 3FGPA 4EKGA 1W36D 2PLNA 4P33A 1RQLA 3A37A 3C3DA 1SY7A 2G28A 3H4IA 3HJTA 2DOKA 1TADA 4BU0A 3T3MB 4YRZA 1PYGA 3ZCTA 1IXKA 2ANCA 1MIHA 2J1LA 3P9IA 4G1FA 1T9AA 4JC5A 3ESDA 3UANA 2ZSUA 5B7PA 4DV2B 2R1ZA 4FYVA 4ZDJA 3JWEA 2WK1A 1RBZA 3LW7A 4RY8A 1XZHA 5ESXA 3NBQA 1Z26A 3TUJC 3QMPA 1ZMBA 3Q8KA 1ISHA 3A28A 3P71T 3M7IA 5ILQA 1USKA 5B3JC 4AM8A 3QVWA 4ND4A 4OB7A 2UKDA 4LBYA 4BKPA 2LKCA 3TE6A 2P2GA 2YZ7A 4K9OA 3HU5A 2IYAA 4TXHA 4PCUA 3RWOA 2HRBA 1EX9A 1GUDA 3HYNA 5HJ7A 1CXZA 5KNBA 3NH6A 4HEJA 2TMKA 3F5DA 3FROA 5C8YB 4DLZA 1WDKA 3PFCA 1EFPB 1J42A 1YE5A 4UE6A 3U61B 4QG7A 1J1UA 1SVSA 2J5BA 3HJFA 2BGIA 3T7RA 1IOLA 1SRRA 3VV3A 3PCRB 1X1QA 1XK7A 2YJ4A 2YJ6A 3K53A 3DP7A 2YWFA 5J2UB 1N2XA 1HNNA 4AJLA 4KXQA 4DC0A 3MWFA 4BRSA 4HCJA 3C8ZA 1EDEA 2GWHA 4UATA 3KPWA 3OX2A 5AOBA 3EGXA 4CV2A 3AESB 1IUNA 1OW3B 2AT1A 3COSA 2EFDB 4XGIA 3SR4A 4ZQGA 5THQA 3DBVO 1E7YA 1CKEA 2QUBA 4R51A 4RPLA 5IDWA 2DFVA 3CZCA 1W581 1J39A 4O2AB 5FOUA 1H1TA 1NVUQ 4D7AA 1PZFA 3UJNA 3TCXB 3PPXA 1E3JA 2VJMA 4P2BA 1NI5A 2FPPB 1Y5NA 5D86A 1U7XA 1UINA 5DM1A 1U6IA 1GA1A 4YCAA 1AGNA 2PT6A 3RK1A 4YI5A 3UKJA 1ZJ4A 1VI6A 2D7JA 2J5KA 4UASA 4W63A 3TGLA 1WPQA 2QHXA 2I2CA 1VYUA 3KFLA 4MLDA 4YONB 3DYBA 2FMFA 4RJTA 3KVVA 2BEUA 3HR8A 3I45A 5HGJA 3VNSA 1E79A 1JLRA 1E7MA 1ZITA 2FN4A 2NZJA 3HC7A 3R0VA 1WPXA 4G0MA 4HTFB 5AWFC 3VKWA 3AEYA 3PHLA 5H0IA 3M9LA 2JAPA 1QUEA 3QLTA 2IDKA 4NOMA 5NLLA 3W3AH 3TB4A 3OQHA 4AS1A 5T8KA 4H3KB 1A1VA 1AZTA 2DPGA 3KKPA 4G24A 4Q9NA 3ZY4A 3TG8A 2CZQA 2IVFA 1FYDA 2O8FA 3UVEA 1K9VF 1PT6A 4AMBA 2G36A 5HKOA 1XHEA 2OAP1 5IJ0A 3HDJA 4BAZA 4YJFA 3H8WA 1D1PA 1EP1B 3OZUA 1W49A 3CZ4A 2ZBVA 2B36A 1NLZA 2GI4A 4LJYA 4GBMA 1JX6A 1YR2A 2OA0A 5K0JA 2H4ZA 1F8UA 2WF6A 3F7MA 1SA0A 2WINI 1ULTA 4HDNA 2J08A 3FOFC 2AZ4A 1UK7A 3ETLA 3A06A 4EY6A 3A7DA 3ABZA 3I0ZA 3RM3A 4MVJD 2GJ8A 1HYHA 4NBUA 2POCA 3GGPA 2GOYA 1Z0KA 1VKHA 1WNFA 2O3RA 2BFCB 5A7HA 4UBJA 5C5EA 2MTBA 1YQXA 3AY3A 2FEWB 3GB9A 4Q1DA 4DFDA 2OXFA 4TKMA 4QVKA 4P80A 2GN8A 4G5RA 1C9KA 4IO0A 4J6EA 4JLDA 2O2XA 4XVRA 5TR9A 4C4TA 5F4ZA 3DKRA 4C7KA 5JCOC 1CS0A 4Z4IA 1A97A 3CZ9A 4L8FA 4E14A 1GL6A 2J09A 4DJTA 3WRYA 2ZSIA 3TQCA 1E1RA 1U28A 1US8A 4C6RA 4PQEA 1OX4B 1RYYA 2HAEA 1O5IA 2QRKA 3HABA 5C2JB 1PT8A 2QLNA 5DCUA 1Y1SA 4IF4A 4OQMA 4P7FA 3T7EA 3JVUA 2YYZA 3ZQ6A 3W5UA 3OUZA 4B3DA 3Q9LA 2G1KA 3KL4A 4GQIA 1R6DA 1ZNYA 4IV8A 3DL0A 4BNNA 3DJFA 5KCMA 5JH7B 3E7WA 2A0YA 3K70C 4XQGA 1BXZA 3ETNA 3U16A 2FEMA 1Z37A 2FDXA 3O4FA 3ID6C 3OPVA 5SY4A 1MW8X 1J0EA 3ZIUA 3SJ7A 4CIWA 1S3IA 1J2JA 3FCOA 2P1DA 2YUTA 2VCHA 3VXKA 4Z1MD 3BDVA 4G25A 1PK8A 4F4FA 1PJ8A 1RAHA 5GY7A 2RB4A 4PG6A 3V8RA 1TTPB 1NNLA 3KOZA 2B8EA 1LTQA 4UCQA 4DNXA 3T5PA 4OMDA 4CL0A 3IURA 5K01A 4RTLA 2NYRA 1V7QA 1JIQA 3FBGA 3G9QA 4ZQFA 2C83A 1GSAA 1LW6E 2HLNA 1DEAA 4OMUA 4LK3A 4W6QA 3CV3A 4U4AA 3F46A 5P8WA 1RM5A 2ZRBA 4WVFA 2NPIA 1V4VA 5CXXA 1QRUA 1L5NA 4KO8A 1QTRA 1CY2A 2H4WA 2JFHA 3OZIA 3KUKA 1HNWB 4I1RA 1KSJA 3WGLA 4CCSA 5JBNA 3DO6A 5ALSA 4ARSA 1OOEA 4ZMBA 2VT3A 1FUKA 4EI9A 1RJWA 4W8OA 1ICEA 1NN3A 2PAFA 3VNAA 3MB5A 3ZIAD 1M1NA 3I9FA 5JI2E 1Z5PA 2AOTB 2DMRA 2X4LA 4PLFA 3RC3A 1R0BA 3UJCA 5FBKA 3WBJA 4W9MC 1R12A 4UUNA 4A6DA 2R4TA 2Y0EA 4DCSA 1C29B 4PVCA 3C4JA 1NUPA 4RXTA 5ICEA 1TC2A 2B7CA 3IPLA 1H4TA 3FM9A 3P2YA 2WWGA 4Q1FA 1A7UA 4JB8A 3KSAC 2OOKA 3EULA 2WIDA 4YIKA 3FB4A 4JI4B 4TKVA 1C1XB 1OZAA 3ZDQA 2YCBA 2PT9A 4N49A 3VSBA 4PW0A 1P4RA 1NI4A 4EF6A 5CB4B 1GZ7A 3G0GA 3SNKA 3EF0A 3DQZA 4O1HA 3CW9A 1YR3A 2XB4A 3FD8A 3AGQA 3I12A 4BNHA 1MB0A 2HWYA 2Y1KA 1IXZA 2XWBF 1BKYA 3LUJA 2VTDA 1S2IA 1GYQA 2LDXA 1YRLA 2HA7A 3D7RA 3HP7A 2QD5A 3MJ4A 3TXYA 4CKCB 2WT9A 3K1AA 3TKYA 2ARKA 1U0LA 2HCBA 4MIEA 4Y1GA 3GLFE 2J9FA 3I83A 1OXVA 1T9KA 3NS7A 3OLWA 4QPNA 1PR6A 3Q8XB 4D46A 2J32A 4UQOA 2EIXA 4YMHA 2E82A 3EB9A 1PJQA 5KSWB 5H81A 1RRFA 1LK7A 1FDIA 1R8JA 1O1YA 4HWOA 2BGWA 3G2IA 5CM8B 3BMQA 4KFCA 1IXYA 4DKJA 2VPIA 5KYWA 1TF2A 2YXPX 3MJDA 1QCZA 3L0YA 4DVGA 5J4HA 1XJ0A 1CUJA 2VQ6A 4FILA 4HK4A 4EGSA 2V58A 4DR3B 3CBQA 2F2TA 4I8DA 3Q9NA 4G4GA 4OHPA 1RLJA 2BGLA 1V35A 2AEMA 1NPDA 2NUBA 2VDRB 3F4KA 2JJ2A 3HHPA 3OJEA 4M0PA 2D1QA 5SZKB 1GSIA 1XPRA 1YR7A 5JNVA 4GKBA 3KC2A 3AHJA 1C8VB 3NFYA 2A92A 4A2WA 3I58A 1FQJA 3V7NA 2UXBB 4GYKA 4H0CA 1LBTA 1YOBA 3O8OB 4QARA 5C3UA 5B7QA 3FR7A 4JC8A 5ALKA 1P7CA 2QA5A 1IHYA 1DCFA 2OQRA 3G2OA 3GEBA 4R4JA 4RK7A 3SZGA 3M1YA 3GAAA 1PAUA 3DAFA 2QVYX 4PRYA 4CT5A 4F11A 4ZHQB 2X1HA 3I23A 1TKBA 3H6GA 5ALPA 2IYVA 4JHLA 4MW6A 2DFPA 4WZAA 1XRQA 5B3LA 4KE8A 2QRPA 2C99A 2GM9A 1YKGA 3GVXA 3OFVA 4GYYA 1G3MA 5JVDF 2AFVA 2MINA 1HYEA 2YC4C 3L8MA 4ZODA 3CZ5A 3RGWS 3THSA 3ZHXA 2DR3A 2GETA 4PHTA 1LJUA 3H2HA 3SXPA 5EUBA 3WE7A 4K3VA 2J7PA 4TS4A 2ABWA 5EWLB 4HMQA 2GNAA 5I9TA 4LDQA 4PWZA 4KE6A 4IDEA 2WA2A 4ZQBA 3QWIA 5KO2A 4NFLA 2IS6A 1JIVA 1CRLA 2FQXA 3L84A 3KHSA 3MN1A 5AHXA 4DMMA 2QTZA 3ICOA 2ZJOA 2C3OA 1L9KA 2ZVQX 4CTJA 4HUQB 4HVTA 4MJLA 2WVHA 2QTWB 3W6PA 1G4AE 2QK4A 2CVFA 4Z49A 1UPUA 3O47A 1HI9A 4EPWA 4YIHA 3ESYA 5LNK6 7MHTA 3JQBC 3VDNB 1XDDA 1XKXA 2BZSA 2RGDA 3WOVA 4LK2A 2JJMA 2PVPA 3L8EA 1MNAA 1XX6A 4GMHA 2NU6B 5IJ9A 2ZB7A 1LPAB 2NU7A 1DAPA 1H42A 2NTNA 3CBGA 4AKEA 3IUMA 5I9BA 1SUIA 3MINB 1XQ1A 2A35A 2FNAA 3C8DA 1IBRA 4P8RA 3FMPB 3S68A 3SHVA 5GZ3A 3CH7A 2PH3A 1QIDA 1WDLA 3K8ZA 3L7AA 3LW8A 3PJGA 2RK6A 3A6ZA 4FQ7A 4OQDA 3HRIA 2PY6A 3SSOA 3LX4A 2DF8A 4KACA 1IHPA 4AQ7A 1WIWA 2G4LA 4ZI5A 3C0KA 1EVYA 1U0OC 1NP3A 3GUCA 4MR9B 3ZK8A 2HIMA 2X0FA 2WF8A 1CZUA 4BQFA 2F3TA 3T9EA 4G5XA 2IW3A 5B64A 2YHIA 1T0BA 2P6UA 3BVPA 4QFMA 2H7XA 2O4CA 5CXUA 5FPKA 4OLAA 4B5KA 2F55A 1X19A 3HY6A 1AGPA 1MX3A 1U8FO 3KKZA 4Q7KA 4X60A 5EJMA 5JDCC 1P4HA 2OBLA 3TJRA 4MUMA 1NBAA 2H2WA 1XAHA 3U9SA 2GCPA 2NZXA 2R9VA 1DAHA 2PWYA 4DQLA 1S2MA 2JLYA 3DBOB 2JBAB 2W8BA 3RUPA 3VU1A 3K0CA 4BV2A 2WTUA 2BFEA 3QEAZ 2X15A 3FHJA 2VZ8A 4JGGA 5L53A 1NDUA 5HP4A 3OUTA 4O4LA 3KVNA 1QBKC 4X8HA 2EJVA 3H5OA 5ALWA 1CUHA 2FKAA 1ZJJA 2EX1A 4BMCA 5ITWA 1V4BA 3JQ8A 2YWEA 3WL3A 1FYWA 1YJ8A 2EC5A 4WJLA 3WBBA 1VIAA 2ETXA 1TQ2A 5DXFA 2OKCA 2O6HA 3NAGA 3LUCA 4JVMA 2Y1FA 2V65A 4YAJA 4MTCA 1J8YF 3A6GA 3C6ZA 1GPDG 1N7HA 3OWXA 4G0ZA 4S04A 4BTVA 3OPMA 2ZG6A 3MTQA 5TGTA 2QM8A 2W6MA 3OM1A 5CIQA 3RU9A 5IVDA 3TJMA 1ZIPA 5EJ5A 3KZOA 3OETA 1DOAA 1TEXA 3T3HA 2JFBA 4NYJR 4EDFA 5AW8A 1VECA 3T7AA 3EC1A 1QF7A 2ZANA 1EFLA 2GSWA 2ZYTX 2MCFA 3ORQA 5K7SA 2RGWA 5I7OA 1FF9A 2ZRLA 4WXMA 1WOMA 2TS1A 3RS3A 4RCZA 1VLHA 2Z5GA 1UPCA 2ISCA 4G0YA 4RAOA 1YBAA 1E3EA 1QGYA 3IALA 1YR1A 2JAXA 5B55A 2EG5A 3C24A 2P9GA 4EWLA 4A1FA 4C6TB 3PPVA 1P4GA 1VL1A 3HKDA 3HJRA 1MD9A 2XNKA 4LXIA 3SYKA 1GKYA 3TRDA 3KOMA 1DX4A 4DA0A 2JIQA 3QW2A 4L22A 1ZM3A 4DDUA 5IM4F 1EP3B 1V6AA 1LJLA 3DM9B 2BLNA 3L01A 1K8XB 5A0FA 3IP5A 2F17A 2WT4A 1PJAA 2FSFA 3N2KB 3NJ4A 3NW9A 3NC4A 3C6KA 2HQRA 2RKWA 3O7WA 1JBEA 1N7JA 2CLCX 2WYHA 3D3QA 2WTMA 3HMQA 1RKQA 2O3SA 3EVCA 1EGAA 3OHSX 5DK6A 4CLDA 3NBXX 4DXAA 4YUYA 5A4DA 5L4SA 3A1EA 1SB9A 3I1FA 1LLCA 4FI3C 2I87A 1PJ2A 2DX7A 3ZDAA 4JITA 1SG0A 1IZ0A 1BW9A 1O7JA 3AUJB 1N2EA 1XRJA 3MF4A 4FGZA 4JLBA 1GL7A 3TFQA 3K2QA 2YASA 3TX2A 3RYTC 4US0R 2C84A 5CCDA 2PPLA 3B51X 4NL4H 3FBWA 5D7NA 3JZIA 4G5FA 1IWBB 4IWXA 2PD3A 5JADA 3GLHE 3URMA 1TPYA 4FKMA 4Y2YA 4ZO8A 1OFUX 3DV0A 3MYRA 2PANA 3CONA 1IPEA 1NVMB 1EVKA 1ZVMA 3DXFA 2HPZA 2XMQA 1WDWB 1Q7GA 1ZA2A 4RPGA 5TPWA 2C9ZA 1EWRA 2DPXA 5EXTA 3U3RA 4D57A 4NP6A 2P41A 4E0BA 3JD3A 5JCJA 4YPOA 2RI6A 4Z9BA 5LYYA 4YAWA 3WWPA 1TYEB 1HORA 3QNWA 4QOJA 4BFYA 3PLAE 1V71A 3UUWA 1VGVA 3HZHA 3PI6A 5CDTA 4N48A 3SY8A 2XI4A 3AI1A 3ZJVA 4BFCA 1U3UA 1J23A 4NCNA 3UG6A 2WBLC 1RZVA 3O8RA 4TLLB 2FUG6 4JMLA 1CEXA 2IOHA 4IMIB 2A3NA 1LDEA 1IULA 3EAFA 3PICA 4MKRA 5K8CA 5B4UA 5F1OA 4HTAA 1JHPA 1OGJA 3JQCA 1JGTA 3V7FA 4IDQA 4AD8A 1RXEA 1PEYA 1XDZA 3PEFA 4KR2A 1FDUA 2B3DA 5T5QA 1CP3A 4LJ4A 5LXTB 3D6MA 2I54A 1QIIA 4NU5A 4PG8A 1L7XA 2YBDA 3C5WP 1RFLA 4TMFA 4IS2A 5TQVA 1XK6A 2J5QA 1TL7C 3VR4A 1LBEA 1B14A 1FYVA 2DHRA 3E1KA 1L5QA 3EG9A 3GHYA 2C4VA 3CFYA 1SOVA 4ZC1A 2XYHA 3U3XA 3OZBA 3V2IA 1DQZA 2P68A 2YMQA 4LXTA 4BJ1A 4QT0A 2YQ5A 3PNOA 4L16A 1VE6A 4U2FA 4PZUA 3ZKWA 4C03A 1V4NA 2DY0A 4L02A 2ZM5A 2QQEA 4M9ZA 4C22A 1PT7A 2ZZMA 1GAQA 4JIMA 5AJZA 1E6LA 1XMVA 1ZCFA 2B5WA 1NG1A 3T54A 4LF4B 4CEHB 1JDBB 4YRAA 3K8QA 2D5BA 3BJEA 4PC7A 1QYIA 1YI1A 1ZGCA 3MA0A 4MITA 4WK6A 4WK0B 2XE8A 1EQUA 3M6UA 4HDKA 5EZYB 3E8XA 2XGSA 2X5XA 1NPTO 3MBIA 2BCJQ 2GPBA 2G9QA 3W3AA 1FTGA 1T0HB 2ZPTX 3IIJA 2X7XA 4E15A 5INTA 3GZTB 1TPZA 1SO8A 4C07A 4UU8A 3W6UA 2DWCA 2J8ZA 3GT3A 4LHYA 4XR9A 4ZQEA 3OQNA 3HDQA 4PX3A 3PEWA 1S1CA 2RJ3A 3HY4A 4C2AA 2YV4A 1NW4A 1KQGA 2R97A 3DCJA 4LV8B 2I67A 4O29A 3PB3A 3I5MA 4XSVA 1A9SA 4RLFA 4Y1RA 1DO8A 3LT1A 3FN4A 3RVJA 4AROA 4W5WA 2X19A 2XOKD 2GASA 2D6FA 5J1SB 5FH9A 4V02A 2VAWA 1NBME 3Q85A 3FHTA 1EDOA 1FE8A 1V7CA 5I45A 3RSLA 2WYWA 1KI2A 4CMJA 4E07A 1I5EA 1LVUA 2EQAA 1BDJA 2P91A 3DNMA 3ZD9A 1CR1A 1Y8RB 5HBRA 1MG5A 1FUEA 3DHNA 3OU2A 1G8GA 1FMCA 1JPVA 1A1SA 1P7PA 4MQFB 5F33A 3FTFA 2JGEA 4L6AA 4F4JA 5A9SA 3VOBA 4K6OA 5ELLA 2GN9A 1ZBQA 3D6FA 4I4TA 3HCAA 3P97A 2IUEA 4R9NA 4FB5A 5C7IO 4HAVA 4H4DA 721PA 1SUSA 2WAXA 1KI6B 4PC6A 1MB4A 1EVIA 5DTEA 1JKFA 1E2BA 4CYMA 4H1VA 4DAEA 3O1IC 4MKZA 4C14A 1KMQA 3HP4A 3N87A 1ACMA 1GT91 2EKDA 4MWGA 3U09A 1H2EA 1UBNA 2EJBA 2JKZA 5KYKA 3MRXA 4Y1EA 1YAJA 2WIBA 1RI4A 3PC3A 1B23P 4AKGA 1QHGA 3QFFA 2R96A 1RXWA 4X41A 3DDHA 1IE3A 3Q4GA 3AVXA 4KRFA 1I1HA 4QU8A 1ZK3A 1Z12A 3GNTA 4PXSA 1GGNA 2J3QA 3C98A 5DDIP 3JZAA 4EFNA 2PCJA 3AKZA 1CQXA 2IITA 3QMVA 3OMXA 3RLIA 1Z47A 3FNRA 3FSGA 1FQWA 2V3VA 1G7CA 2VSYA 1T2DA 2XUFA 3DBHB 3E03A 2D2EA 3Q88A 3W34A 4B33A 4B9AA 1GUAA 5DNDA 3QXGA 3FVTA 4DGSA 3Q12A 4G5GA 6Q21A 4Q7LA 4L78A 3R5XA 3JQAB 1BRTA 3EUFA 4LXHA 4NZNA 4UVGA 3CVWA 4D0GA 2OAQ1 3AWDA 1Q7BA 3GVHA 3KB2A 1NT4A 4PTLA 3N6VA 1Z7GA 2ORYA 3SNHA 4WEQA 3NTXA 4D43A 1GCGA 1NL3A 1Z63A 1V6SA 1Z6TA 3V42A 5ENDA 5LM3A 5JJCA 3LUDA 3UTDA 3PNKA 1BGVA 1K8YB 2PRJA 2YFYA 4HEHA 5F1YA 5FUVA 3B5IA 1ZMOA 1NBHA 3AOEC 4FOSA 2F8MA 3EK2A 2ECPA 2DFLA 3OZVA 4FFBA 1FDWA 2EEPA 4RKYA 3T3GA 5ABPA 5IK2D 4JYAB 3CKYA 1T8YA 2DBRA 4I55F 3X1YA 1SXJD 2EP7A 3EGDB 3WS7A 3P0RA 4YT2A 3L6EA 5JG7A 5K2OA 1KNXA 3CEPB 2NZ2A 4AIIA 1I0ZA 2G1UA 3IUNA 3GXOA 3N8GA 1R0YA 3R74A 1HNZB 4BNMA 2YWHA 5BMVA 3OP1A 3KQNA 1Y33E 1PJSA 3QVGB 4UCXA 3GFBA 5AKEA 3ZWAA 4OV6B 3H3FA 5B30A 1TQ6A 5BN5B 1AKEA 3VPDA 1E2FA 1IRIA 1J8VA 2A33A 3KK0A 4M0DA 2QTVB 4PHFA 4WUTA 4EHLA 5KZMB 2JLSA 2GMWA 1OPRA 4OQYA 4D0SA 2ZW9A 4IGAA 4LBVA 1XCJA 1NM5A 2ZJ8A 5B53A 3TCNA 1P17A 1B73A 4RY0A 4AN1A 3NOXA 4M38A 3ZCUA 4PRLA 2ADOA 4WDRA 1ZWLA 1GGKA 4O5OA 3H9BA 2CLMB 1WABA 3ECCA 1CQWA 4QO7A 3R76A 2PJDA 4BNVA 4KMRA 1UFKA 1WCXA 1FFHA 4CI0B 1YWGO 2Q21A 3ILVA 1RYFA 3CU5A 1AA9A 1ZUNB 3BJZA 1XSEA 4NBRA 4JI0B 2NTYC 1ZK2A 2R6JA 3WYNA 4QLOA 5DN6D 3IS3A 5TLSA 3TTYA 2O0MA 4Y6LA 2UUCB 5J43A 3QJ5A 1GPWB 3NUQA 4LJ5A 3PKZA 3A4YA 3K5PA 3CIOA 4MKXA 1EJBA 4RADA 1WBJB 2C58A 5CDGA 3H5AA 1ZXLA 2XVZA 2G70A 1LKZA 1X8XA 3CLSD 4F4UA 3EBLA 1IJFA 2X14A 2YJNA 5EIWA 3IPCA 4DDMA 4X95A 5JROA 4O4HB 1HX7A 1L2TA 1N77A 1UZMA 2B2CA 1U8ZA 3C85A 4KIJA 3H9QA 4YV1A 4YXWD 2ZI9A 2ZPAA 1OA1A 4CMCA 4ZT6A 1EWTA 3SZRA 1ZGGA 3R3YA 3GEGA 3WVNA 5G1PA 1KERA 1SKYB 1KEEB 2O7RA 3OHMA 4R8RA 3DC2A 4QD3A 5EJIA 4A8JB 2ACWA 2B94A 4RTNA 4A4DA 3H11B 2WZCA 3GT7A 1HNXB 4NECA 1XNRB 1SBYA 1X0XA 4C2TA 2YOHA 1HRDA 1P4AA 2QTGA 2WJGA 3EZLA 3LP5A 1FNSA 4MV3A 1VLVA 2I4TA 1NW7A 1UXJA 3AUXA 2OBFA 3L92A 1BU5A 1E1QD 1V43A 2V55B 3NWEA 3ZBQA 4B3JA 1A8SA 4JL8A 4BFVA 4LF6B 1NF8A 2CLLB 1Z45A 2B6HA 5JCZA 2QL9A 1CQJA 4OK5A 1NF2A 5H3CA 2XUGA 4ISBA 4L0QA 3VTAA 3DEAA 4XPZA 3Q7IA 5CBPB 3EVDA 3RV4A 1PK9A 1UKVY 4YGYA 5CYFA 2A0KA 3RQSA 4XDZA 4DAOA 4BRZA 2V4MA 4ER6A 3OJXA 3DR3A 2AK3A 2R44A 2XDQB 5TGZA 1YQTA 3INRA 1GA4A 1OI3A 1XD9A 2MIIA 4KQIA 2ATEA 3OBBA 3PV0A 1A5BB 2XEDA 3P9KA 1ST2A 5EYPB 1RHRA 3TAUA 2OTCA 1G4HA 1XJWA 1R88A 1MQ8B 1ZN9A 3E3AA 3KFVA 1R5NA 2OFOA 3EGIA 4RF2A 5JFGA 5CA1A 1HFEL 1ZAYA 4I55B 4XVCA 4CV3A 4DRXA 5LU8A 1XFDA 5KSYA 5B1SA 3NVKI 3RANA 3ZX4A 3WBFA 2H8KA 3BAZA 5LMCA 4BU1A 5ESRA 5HW0A 3EUEA 3N7TA 3O26A 2BI8A 3EYAA 1TM4E 4M1SA 4D6PA 1PGJA 2C4TA 3OIFA 4YYEA 4W9NC 2CL6X 2OZLA 2Z8ZA 3L82B 4KIFA 1A76A