5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
2GGSA 3CKYA 1T2AA 1GQ2A 3HB5X 1P45A 1NQ5A 1OAAA 4J4HA 5DDIP 3RBXA 3FTNA 4YJHB 4NNJA 1JQBA 3E9MA 3GFBA 3H9UA 4EZBA 4IQ0A 4DWVA 2BFPA 4Z3KA 5BSEA 5KCZA 1VJ0A 3GUYA 1M75A 4BMVA 4DTIA 4ROSA 4ZVVA 2E4AA 1JKFA 1GU7A 1LSSA 1KEVA 2DBVO 2D2IA 1EBUA 1P77A 3HN2A 3RC1A 3ZV5A 1F8FA 1NQAO 1GCUA 2BGLA 5HBRA 3TFOA 2VN8A 2OFPA 1DIHA 4JXKA 4P22A 3QW2A 4HADA 3WGIA 1J5PA 1P0CA 2C7GA 5EL0A 1T2CA 3AU9A 1A27A 4BQRA 4EITA 4YAEA 4Q39A 3ZWBA 4M49A 4XZ3A 4OXKA 5JLAA 4BNIA 5C7LO 2OORA 2B69A 2ZYGA 1P33A 1HKUA 1M6HA 3E48A 1AXEA 3E5MA 3JV7A 3ROKA 1UR5A 2BI7A 1ZO8A 3IJPA 3QQPA 2O3TA 5T8KC 4E4YA 1PWXA 3O4RA 1YBAA 1ZMTA 3QVSA 3N7UA 1PR9A 4WNCA 4IXWA 1IE3A 2W2LA 3KTDA 3GZ4A 4KUEA 3W4KA 4D0RA 1NASA 3B1FA 5JAIA 5A04A 1ZJZA 2QYSA 5KKCA 3C3XA 4JIGA 2VWGA 4WCFB 1V3UA 4FW8A 4J1SA 2FN7A 1JDJA 1UXHA 2EV9A 1YQXA 1UXGA 5ENVA 3IUSA 5DN9A 3VAZA 2OZPA 3WLFA 3PQFA 2I9PA 5KVSA 3NV9A 3GVXA 4B7UA 2Q2QA 4K26A 2AXQA 2YHIA 2C5AA 3PJDA 1DXYA 2P4QA 5A1TA 4PVDA 2Y1CA 4MINA 2RBEA 1KC1A 2X8LA 1PTJA 3EW7A 4MVJD 1C1XA 4L4SA 1T1RA 2AQIA 2HK9A 3F4LA 2O7SA 3WTCA 3K2EA 1GEEA 1T4DA 3F3SA 2JL1A 2UAGA 4XQEA 5BQFA 2Y05A 2Q1UA 3T4EA 5ILOA 5A02A 1X0VA 3R1IA 2A94A 4LCJA 3PWSA 4DC1A 4MVJI 4NBTA 3NJ8A 1JKJA 1BHSA 2HRZA 1DOHA 2QQ5A 1NBOA 1WP4A 4J16A 5EQFA 4ZU3A 3K6JA 1MX3A 1NWHA 4XDZA 1RM4A 4J2HA 5G2OA 5JSFA 2AHRA 4CL3A 1VC2A 3H8VA 1L7EA 3JQ9C 4E5MA 2XXBA 1CF2O 1LXCA 2FR1A 3AI1A 3UOGA 2B0JA 3WJAA 1TI7A 1N92A 3GAZA 3IOYA 1X13A 2EERA 3INTA 3DBLB 1YKFA 4PZDA 1PX0A 1H6BA 4ZHSA 3L9WA 3AK4A 4P4GA 3ITKA 3QWHA 5I7SA 5EERA 4A0SA 1K6IA 2QZ9A 1Z6ZA 1PJ2A 2HDHA 4IY1A 3HDHA 2EKPA 1GCOA 4FOSA 2C07A 5HRUA 2NVUB 4CPDA 1U5CA 5L3ZA 3P5SA 3PP8A 2ZTMA 3HDJA 1BWSA 4IZIA 1R15A 5JFOA 2P5YA 3NT4A 4TWRA 4XGIA 2VOJA 2DBRA 1LRKA 1T4BA 2R00A 4BNNA 3CE6A 2C0CA 2Q46A 4YJHA 3K31A 1M67A 4XGNA 3WB9A 5IXSA 3BTVA 5KJFA 3Q9NA 2GERA 3WQQA 4EBFA 3IJRA 4F6LA 2ZB4A 4UEKA 3VHRA 4JBHA 3H3FA 3PDJA 1G0OA 3D3WB 1BDMA 5A3JA 3BZUA 1LDMA 1QP8A 4OL9A 3TSCA 4RDHA 4H15A 4CQMA 2WD7A 1F17A 2VHYA 4I5EA 3IAHA 4FJ2A 1DJQA 5F21A 3VVCA 4B4UA 2CNBA 4WLEA 3T7EA 3PGJA 4E31A 2FOIA 2V65A 2CVQA 3HSKA 4J91A 3FN4A 2DTDA 2DFVA 1YVEI 3GGPA 3H7AA 1DIGA 1ISIA 3ITDA 2E82A 3RUHA 1JAXA 3DAPA 1KBZA 3LT2A 1A9ZA 5I9MA 4B8WA 1MGOA 5JY1A 3ENKA 2VZ8A 4NFHA 1NNUA 3NTQA 4WOJA 1R0LA 4MVJE 1UDBA 2FHSA 1ZK2A 1JU9A 1LC0A 2JFHA 3DZJA 1MXHA 5L4LA 1U7HA 2C7VA 1BGVA 1LA2A 4ESOA 1WDLA 3ZWMA 1O89A 2NV6A 4BGVA 1OC2A 1GDHA 1NHWA 5L7YA 1I3NA 1ZEJA 2AQ8A 1I01A 5HTOA 1BXGB 3SBOA 1GZ3A 3ZDFA 4EGFA 2G17A 1LEHA 2AEFA 4JJFA 2NLOA 3S55A 4PLPA 3ZW9A 2X5JO 3GDOA 4R3WA 1PEDA 3S2EA 4CM8B 1BXKA 1JKIA 3DXFA 4CMKA 1BVUA 4NMHA 3CXRA 4R3NA 3H4VA 4M1QA 1L1FA 4DUPA 3WX0A 3GR6A 3MOIA 1JLLA 3IDSA 3LF1A 5I7EA 4AJJA 3E5RA 4DPLA 1PQPA 4N5NA 1U2DA 8ADHA 1JA9A 1CJCA 1V3TA 2DTEA 5A05A 2EXXA 2Y93A 1U28A 1J6UA 2Q99A 3GVIA 3EAGA 4LSMA 5L51A 4QFDA 1Y1PA 3TZCA 3UVEA 3UW3A 3QSGA 1XLTA 3SLGA 1DPGA 3DHYA 3ORFA 3GRKA 2CD9A 2IXBA 2EWMA 3ONEA 2ILTA 3UFXA 3RSHA 1EVJA 4J1QA 5TJHA 1IZ9A 2AEMA 5A4DA 1IZ0A 1Z45A 1H94A 4EYEA 5K9ZA 5B37A 1SEPA 1LLCA 4J4BA 4B79A 3QVWA 3PHHA 3RFTA 5TGDA 1DFHA 3B1JA 3P7MA 4S3MA 4BKUA 2J5RA 2JHGA 4OMUA 4MKXA 1WZIA 2IEDA 5G0UA 1I2ZA 4O1MA 4U6QA 4YBZA 1PQUA 4J3FA 3WJ7A 4TRMA 4MDHA 3PWZA 4F3YA 1NX6A 1NFQA 4RZHA 4XYBA 2CF6A 3LLSA 1IYZA 1T25A 3DBLA 1G0NA 1HXHA 5I9LA 1Q0LA 1RKXA 4CMJA 4Z3DA 2B83A 2F00A 2AQKA 4XB1A 1DFGA 2FR8A 2VZ9A 5GZ3A 1T1SA 4QECA 3MJEA 1B14A 4DLLA 1HE4A 3EMKA 2V6FA 2Y1OA 1XA0A 3BHMA 4E5YA 2JCXA 2NVUA 3D5TA 1B7GO 3CMCO 4YJGB 3W1VA 4YQZA 4E2XA 2HMTA 3AUAA 2D4AA 4OO3A 4HKTA 1OOEA 2EP7A 2VOEA 3UKOA 4CV3A 2FSSA 4I08A 3JQCA 1PL7A 1MFPA 4L4RA 4N18A 4UUNA 1PJLA 4GAEA 4GWGA 1SAYA 4PLZA 3WGTA 2Y1GA 3ZHZA 1NPDA 1J0XO 1GPJA 1YO6A 4FC6A 4HUJA 4NJMB 3BMNA 2CVOA 3GPDG 1NPTO 3D3WA 4R41A 1O94A 1ZW1A 1ADFA 3PGXA 3ADPA 3AW9A 4DIFA 4NBRA 4ID9A 2LDXA 4OYRA 4A2CA 4KWIA 2BFAA 4DC0A 1K6XA 2XXJA 3RC2A 2GDZA 3TFQA 5IZ4A 1Y5MA 2Y99A 5U9CA 4A7PA 1ZNQO 2P5UA 1LU9A 3AOGA 4AJHA 3AM5A 3ABIA 4JBGA 4YRAA 1AE1A 2RH4A 1H2BA 3IQDB 3OICA 3V8BA 2QIOA 2QRKA 2VWPA 3PI7A 4B3JA 5CPBA 4A5OA 1SEVA 1U9JA 3H2ZA 1PR3A 3PYLA 3F4BA 3PHGA 2YYYA 2CDAA 3JYOA 3PLRA 3JQAB 2PD6A 3WG9A 4BGEA 1SOVA 1PJBA 4IS2A 2UV8A 1KY5A 2AW5A 4BGUA 4LGVA 4NFYA 2FY8A 3CEAA 3LYLA 4CM8A 1NFRA 1W4ZA 4FOOA 4UVDA 3LC7O 3IS3A 1FF9A 2IYOA 1PS8A 5DF1A 4DYVA 6LDHA 3MOGA 3VC7A 1P0FA 2DAPA 4GMGA 4YEDA 3UAGA 1OC4A 2C82A 3CH6A 2EGHA 3AUTA 2C2XA 1R6DA 2E6UX 1U5AA 3MEQA 1KVRA 1GYPA 3IUPA 2VQ3A 1M2WA 1KERA 5F1KA 5CPFA 4I8XA 2Z1MA 5TF4A 2PGLA 4BO4A 2HKIA 2J3IA 3P19A 2NU7A 4R1SA 2VRBA 3MWDB 1XQ1A 3FHLA 1VL0A 3ETGA 9LDBA 3UCXA 4GGPA 3ENNA 2EW8A 4B4WA 1B3BA 1PZHA 3HE3A 1XKQA 3OA0A 2IRWA 5KVVA 2Q1TA 4ALLA 4BB5A 2GN6A 3OHSX 4FFLA 1GZ4A 4CMIA 3BMOA 5ER6A 4QQRA 3QIVA 4Q3DA 1R4NB 4B7CA 4OKIA 4E5KA 1DBVO 4RLSA 2X4GA 5CEEA 3PIIA 2YQ5A 4WK6A 5KKAA 3ZWAA 5IZCC 5KWEA 1EFLA 5GMOA 2AQHA 5U1PA 2AMFA 3PJEA 5IFLA 2DTXA 1N9GB 5G4LA 2DUUA 2PV7A 3SJ7A 1JVBA 3VH4A 2ZTVA 2QHXA 1Z75A 5C7OO 5K6AA 2JAPA 3NJ4A 1PGJA 1H93A 4XIJA 5HA5A 5ADHA 2VWHA 1E3SA 4RVSA 5BNTA 1LSJA 3DDNA 4FFMA 1PWZA 4JJGA 3STHA 4IQGA 4RCVA 1K5HA 3RFXA 2D3TA 4GKVA 3KYDB 2VHWA 1X14A 3HB4X 4INAA 1O95A 3GEMA 1KVTA 3EHEA 3TNLA 2A9FA 2ET6A 2B37A 3DL2A 1NR7A 4YJGA 5IDXA 3OEWA 3NAQA 2EKQA 4HFMA 1SOWA 3EVNA 5JDCC 1NVMB 3I23A 1F0YA 5ENDA 1HL3A 4Q3BA 2GPTA 5I7VA 1Q7GA 3WNQA 2XOXA 3JQGB 4TSKA 4R1UA 4MKRA 3W6ZA 3KEQA 3KOUA 1BSVA 1DO8A 2FZEA 1ENOA 1MXFA 2WE7A 3DQPA 2PTGA 3D0OA 2ZB8A 3RQSA 5EPOA 5HS4A 4Y9DA 2PZLA 2I67A 1LLDA 1W6UA 3L77A 2ZTLA 5KTKA 3GPIA 1LSOA 4N7RA 1FK8A 2YY7A 1LDGA 4WE3A 4HP8A 2HMWA 3CPSA 4Y8VA 1ML3A 2NTVA 4FIZA 3GDFA 4WPGA 2X7HA 3DOCA 4IM7A 2HK7A 5CHEA 3TRIA 1EEHA 3EVTA 3FF4A 3OJEA 4YAJA 3UCFA 4BMSA 4NU5A 2D8AA 5IDQA 4K28A 1LI4A 2OO5A 2GZ2A 1E0DA 4FFOA 2UVDA 5FFFA 2NTJA 4R5MA 1WW8A 1UDCA 1MC4A 1E1KA 3PYMA 5MDHA 1HYHA 3BMCA 4BKQA 3GHHA 3DZFA 4I9HA 4NHEA 1WPQA 4D3FA 3K96A 3VZSA 5KVQA 3JQAA 3NT5A 1I3MA 4DIOA 4Z0TA 2C2YA 2X86A 1TLTA 4GWKA 3ZU3A 5EJ2A 3R3JA 3ON5A 1YB5A 2AG8A 1A71A 3KYBA 3T4XA 2V7PA 3LC1O 3TZ6A 4XR9A 1E3JA 4JBIA 1HDGO 4CM4B 3VPFA 3FNHA 1QXSA 5LDGA 4BV9A 4TVOA 2O48X 3S2GA 2CMDA 1XYGA 1YQGA 1QRRA 2B5WA 3E18A 5I7FA 4CLDA 2E48A 1C1DB 4CR7A 5JDIA 2HMVA 3HG7A 3NTOA 1SB9A 3L9XA 4DBZA 5JC8A 3QVXA 2VTEA 1XGKA 1PL6A 1HDXA 3G3EA 4Y6SA 2O3RA 3OETA 1AXGA 1EK6A 3QA9A 1OI7A 1VJ1A 2DBZA 3PVZA 3D4NA 4MIOA 2YW9A 4BKRA 1TVEA 4MIEA 1BXZA 5A9SB 5ITVA 5JYDA 3DBRB 4LVUA 3WYBA 5ICSA 3BHJA 4A73A 4ND1A 1QG6A 5EESA 4PLVA 4IDEA 4GI2A 1ADCA 2NADA 1N9GA 4OOEA 2G5CA 1E3WB 3JCZA 5JS6A 4AJEA 1EUZA 3GEDA 3GZNA 4I5FA 3AM4A 4E30A 2PWZA 3CIFA 4GLLA 4NDNE 4JJIA 5COAA 3KYCB 3DEYX 4PLYA 4OQZA 1F8GA 4QSMA 4E21A 4YA6A 2HO5A 3GNSA 3HNPA 5CDUA 2V6BA 2JHFA 3K8ZA 3K30A 4Z9YA 2P68A 5ICMA 3H5NA 4A03A 4F46A 1TEHA 5TSDA 7ADHA 4K9DA 3VKUA 4IMRA 3MJSA 4JP3A 3PEFA 2O4CA 4ZQFA 4IDDA 5COQA 2NU6A 4Q3NA 2E37A 1DIBA 1ZXBA 4EI2A 5JAQA 5EQDA 4JQCA 4U7WA 4BNMA 1QORA 1YONA 2O7QA 1T24A 1PGNA 5EN4A 4AJ2A 4BNTA 3G79A 3JQGA 4R9SA 4RZIA 3UF0A 2ZCVA 3FWNA 3DMTA 3JSAA 5F3RA 3EZYA 2BI8A 4CLRB 4TMFA 3KM0A 5DBIA 1E77A 2OP0A 3C85A 5T6BA 3RC9A 4RL6A 2NVWA 1NPYA 3WBBA 1E7RA 3CMMA 4AL4A 3W4IA 4B4VA 2W2LD 2XPCA 1EE9A 3TZQA 1HETA 1QKIA 4PLWA 1P31A 3C1AA 3CINA 4L76A 4DLAA 4HNHA 4CQLB 5AQ1A 1HTBA 4XCVA 3RASA 1Y8QB 2PKQO 3PPIA 2J5QA 1WXDA 4XB2A 1GEGA 1Q1NA 3PWKA 1E3EA 1EZ4A 4DVJA 5TS3A 1AHHA 1XWFA 4J7XA 1JVSA 1GV0A 3LDHA 4W6ZA 2EF1A 4XEHA 4EEXA 4E2WA 1IY8A 1B16A 3ADOA 1ZSVA 3TZKA 1DAPA 3WGZA 2A35A 1Z74A 1YH3A 2VT2A 3AFMA 4UUOA 5H82A 4YWJA 2NSDA 4PFJA 1OZAA 2O23A 3GRPA 3WOHA 5KJCA 1OMOA 3ETDA 4YVFA 4RVUA 1K89A 5TX7A 4E3ZA 3JYPA 4KUHA 1PGPA 2C5EA 2IDZA 3KEOA 3DWFA 1HYGA 3ONDA 1HZJA 3GHYA 2A4KA 3AY3A 5JO9A 4BMNA 4OAQA 4EUFA 4ZQHA 1K6JA 1YDEA 1ISMA 4CM1A 1P1HA 4QT0A 4ZRNA 4CMAA 1I33A 3KB6A 2VNAA 3G49A 1E7WA 3ZWCA 1U4OA 4LRTB 1F06A 3BAZA 2Y0CA 4J2OA 3I6QA 4MVJG 2VRCA 4CM4A 4QO7A 3G0OA 1UXJA 3KSDO 5C3MA 3SXPA 1EK5A 2VCYA 5CFZA 4DREA 1QYXA 3MCVA 1Q0QA 3JQFA 1E1LA 2NM0A 3P2YA 4WUVA 1E7QA 1C1DA 1TT5B 1JW9B 3JYQA 4RF3A 4KTTE 1X7HA 3NDIA 2O50A 3QWBA 5DCUA 1V8BA 4DQXA 3ZU4A 1RJWA 3LSYA 1YWGO 3FBTA 3W6UA 4G2NA 3DZHA 1P1IA 4A27A 4BO0A 4ZQEA 1MA0A 3V2UA 1VE9A 1DRWA 1KEWA 4D42A 3BTSA 3JQEA 3U09A 5K6AC 1V9LA 3WFIA 5A9SA 1T26A 3DBRA 1KEUA 2Q45A 3SVTA 3ANMA 4D41A 4YCAA 1YGYA 3H3JA 4LCEA 2ZCUA 5I8WA 1DB3A 2I6TA 5COBA 4MVJH 5FI5A 5DOZA 2WWRA 5DP1A 3OJ0A 2OUIA 1PJ3A 3E9NA 5KIAA 3KYCA 3ICPA 4DYDA 4QFCA 2CVZA 2DKNA 5G0SA 2P4HX 1M6WA 3RC7A 4E13A 1D7OA 2EP5A 3NDJA 4WNIA 3W8FA 5B1YA 1ZK4A 3QY9A 2OGUA 3WNVA 2I3GA 5DNAA 1NVTA 4GSLA 4BHTA 1DIRA 3M2TA 3GH3A 5ITWA 1QYWA 2I5PO 4CQMD 3Q2KA 5AXCA 2GSDA 2JD2A 3ROQA 1YJ8A 2OL4A 4RGBA 1QMGA 3G1TA 4I1IA 3LK7A 1QLJA 4IDFA 3WYEA 4ND2A 1Q7BA 4YB8A 4CM3A 5CDTA 5DZSA 1U1IA 1YL6A 3MTJA 3CSDA 3WGQA 1TA4A 1BVRA 3PJFA 3L6OO 3RKRA 4K6CA 5GY7A 5IG2A 4BNVA 3KSUA 2EIHA 2VUUA 1B3RA 4KTVE 1ZJYA 1SB8A 4IDBA 5C7IO 3H5AA 4IZHA 3E6AA 3BA1A 2B4QA 1SBYA 3ASUA 4MP6A 5CDSA 1ULUA 3NGXA 2FMUA 2CY0A 3AI3A 1HDZA 1T2DA 5B4UA 4PCVA 4FSHA 4CQLA 4FB5A 1ONNA 3C1OA 5KJ6A 1XHLA 2BD0A 3DHEA 4TRNA 4ND3A 2DPHA 5C37A 2JD0A 3FNEA 3K92A 3QP9A 1GPDG 1TB4A 1B0AA 3V1YA 3DTYA 2ZQZA 4OHUA 5ES3A 1MG5A 4E6PA 1UP4A 4J90A 1GD1O 1S6YA 4CLEA 3BMQB 3KUXA 4LRSB 3B20A 3BYZA 4WLFA 5IF3A 2JJYA 2QZZA 3I3OA 1KS9A 1NQOA 4N54A 3WQRA 4IINA 2I3AA 2HMUA 1O0SA 2ZYDA 3UHAA 3VPXA 4ZGWA 2YUTA 3JD1A 2J3KA 5BSHA 3EK2A 4Z9XA 4TZKA 2GLXA 3EY4A 4J4TA 2CZCA 3OQBA 1HT0A 2WYWA 3AUSA 4JNKA 3H6KA 5BSFA 1CYDA 3M1LA 1N1EA 4NK5A 4K1LA 4OH1A 4DL9A 5AOVA 1MB4A 5TNXA 3ZHYA 3PYXA 4D43A 3JYNA 1ZXLA 4P8RA 4Z6KA 4HXYA 1LDYA 5JDIC 1AN9A 4IDAA 2PGJA 4RORA 3TZHA 4WCFA 3FPCA 5A3VA 4FGSA 2ZJ0A 3F1LA 4PZCA 1VSUA 1GQQA 2DC1A 3F5QA 4RDIA 4N5MA 3HUDA 4OSPA 1MG0A 2RIRA 1SO8A 3C8MA 3I9JA 5AXAA 3NEPX 4CM5A 5HM8A 2YJZA 5GZ1A 2EW2A 4CMCA 3FBGA 4OGWA 4H16A 4BNLA 4XR4A 1ISGA 1XR3A 2ZB7A 4XRRA 1XCBA 2H63A 2VNSA 3OA2A 2Z1NA 4Y6PA 4OM8A 1H5QA 4XYMA 2SCUA 3TDKA 1Y6JA 3FD8A 1B8UA 4HX5A 1YBMA 1BG6A 4BNGA 2IE0A 2WTBA 1O8CA 4NK4A 3S8MA 4IDCA 2WE8A 2IXAA 3JD0A 2HU2A 3E9QA 2O2YA 4CLXA 1CWUA 4YAGA 4M54A 4U5QA 4YT4A 3DOOA 5DBFA 2PD4A 4J6FA 1UAGA 3BHIA 3SLKA 4W9NA 1YS4A 1YXMA 3OF2A 4YTEA 2Y67A 5THQA 4DRYA 2VHXA 2TMDA 4D7AA 2B35A 1QV7A 4HFNA 3OIGA 1EUCA 4BNYA 3G17A 3IL2A 4GQAA 2TMGA 1D1TA 4CMEC 3DMTC 2RH8A 3HFGA 5IN4A 1VL8A 3L4BC 1PJQA 5JCJA 4PRKA 2CF5A 4A26A 4PLFA 3ZGYA 3FPLA 2G82A 3ZV6A 1KETA 3HWRA 3PRJA 3CZMA 3GFGA 4RPJA 2BHLA 3O03A 4ALMA 3JQ6A 3S2IA 4RLHA 1GV1A 3I9MA 4YAKA 3MJCA 2PH3A 3DZBA 3OJLA 5HS6A 1LDEA 2GASA 1PZFA 3S1LA 4BO6A 2B5VA 2HRBA 2IEBA 2JCVA 3U4CA 1ZEMA 5A5EA 5JW6A 3VDQA 1CEQA 3AM3A 1NWCA 2BLLA 3U62A 1UDAA 3ZCXA 3F1KA 4NBVA 3PFWO 4GBJA 4OXNA 4Z9FA 3OM9A 5EINA 3D7LA 4RQTA 4J43A 2CUKA 4B3HA 1AHIA 1VM6A 4PZEA 3WSVA 2QRLA 4AG3A 2YV2A 2Z95A 3ETEA 1DHTA 3VZRA 3TL2A 4JP2A 5FEUA 3AJRA 3TL3A 3DB2A 4R01A 4FBGA 3BMQA 3LF2A 4HNGA 3A9WA 5FI3A 1YJQA 2IYPA 1C0PA 4YT2A 2HK8A 1ZH8A 4C4OA 4CLOB 1I3LA 1PGOA 2ZTUA 2OBYA 1YB1A 3ICCA 2O3QA 4BNHA 1F14A 1IHXA 3D5QA 1F12A 4OIMA 5BSGA 1I3KA 2P9GA 9LDTA 4OOFA 4FQ8A 2Y0EA 3QV1A 3Q9UA 5TRTA 2Z5LA 2JFGA 3GAFA 3QWAA 3ZNOA 1MFZA 2YFQA 3ST7A 1VKNA 1JN0A 4NZ9A 4O59O 1LQUA 3ROMA 1WDKA 4GH5A 4J1TA 3A06A 4ZICA 2G76A 1BXGA 1XEAA 1A7AA 4FPXA 1N7GA 5TT1A 3JQ8B 5BT9A 3G1UA 1D3AA 1P1FA 2IZZA 4R54A 4ITUA 4J9VA 1B2LA 3WS7A 1O6ZA 4UREA 1ONOA 4LSWA 2O3JA 2FR0A 1E92A 3RUCA 4DBVO 5GZ6A 1M76A 4R1NA 4LK3A 1UH5A 4PLCA 5A9TA 1QLHA 3GG2A 3PHJA 1KVQA 3KSZO 5JCXA 4JCOA 3V2GA 1H6CA 4JN6B 4XA8A 4BQPA 4DGSA 1C0LA 3I1JA 3KHUA 4WECA 1EQ2A 5DULA 4E5NA 2DLDA 3KZVA 4B7XA 3NGLA 2PA3A 1WLYA 3TWOA 2EGGA 3X2FA 3OIDA 2DU8A 4GX1A 1ADGA 2X0RA 3IP1A 1VJTA 2VTDA 4RQUA 1V6AA 3IC5A 3Q2IA 1UJMA 4UVEA 2EKLA 4XYEA 4BO1A 4CMHA 3ZZNA 1QYDA 3FRJA 1MC5A 2JD1A 3GEGA 3I9LA 5T8KA 3R6DA 5T64A 1HLDA 4CL8A 5L40A 2Q3EA 1D1SA 4QUKA 3V2HA 3VTZA 3L07A 4AJLA 3JQ7B 2D1YA 1UZLA 1H2HA 3VPHA 5K0ZA 4RF2A 4KQWA 3FWZA 4XQCA 3PLNA 1MP0A 4R68A 1E3IA 4OJNA 3L0DA 1TXGA 1PIWA 2IODA 5C5IA 3BTOA 2Y0DA 3PK0A 4IQ8A 4DQVA 3DONA 4TKLA 1U3WA 4ZRMA 3MJ4A 1A4UA 4EDFA 1R12A 4HFRA 2W2KB 2BRUA 1QV6A 5TC4A 5LDHA 1C14A 2NNLD 2DVMA 3I4CA 4WEOA 1PS0A 2UUPA 2R00C 4Y98A 1OBFO 5JNLA 1WMAA 1Y8RB 3RVDA 3LZ6A 2DUWA 3QWIA 3SC4A 1R4MB 2V6MA 3UCEA 3ZNPA 2I65A 1O9BA 3OH8A 1N5DA 1CQJA 4YRDA 4UVIA 1QR6A 4RPHA 1XSEA 3WIEA 3VH1A 2JCYA 4TRRA 2P9EA 3JQAD 4IIUA 5U4QA 1WMBA 4WCDA 4DPKA 4MVJM 4D44A 4NH4A 2XAAA 3BXXA 3D4OA 4NJMA 3LQFA 4MJLA 2DPGA 4E0BA 1P44A 5L7WA 4CV0A 2O2SA 2H9IA 5L4NA 3JQDA 3U3XA 2AEJA 2W90A 3JQ9A 2NWQA 4CM9A 3KLMX 4TZTA 2UYYA 2X1HA 2VT3A 3C1TA 3GVHA 3WQSB 2BKAA 2NUAA 4BO8A 4P4NA 1VKOA 2HSDA 3QVTA 3DHNA 1E3LA 2OHXA 4MVJF 5G0WA 1N2SA 1GUYA 4CLHA 1HDOA 4YJFB 1UUFA 2QRJA 3SX2A 4WCFC 4CUJA 2NU8A 3AFNA 5AVOA 3A14A 3W8EA 1KVSA 3DBVO 4R5HA 5ILGA 1GQYA 1HSZA 3NT2A 4Q3EA 2BFOA 2I76A 4WGGA 2PGDA 3LVFO 4CR8A 3CUKA 5JO0A 1LQTA 1RM5A 1E5QA 1NAIA 4RV9A 5G0VA 4U0KA 3U4DA 4PGFA 3JQ8A 3TF5A 1FMCA 5CG2A 2X22A 3R0IA 1H9BA 2P91A 3B6ZA 4FR5A 1X7GA 3AOEA 4BVAA 1ORRA 1JWBB 3ZNNA 4L73A 3NUGA 4NIMA 3WR5A 4DXHA 2HCTA 5CAEA 4JROA 3UN1A 1I5RA 4MVJP 3JQBA 1LNQA 5L53A 3P2OA 1GZ6A 1T2FA 3WBFA 4YYZA 3M2PA 2YFHA 3OEYA 1FXSA 5DCWA 1I2BA 1Z82A 4EJ6A 3PFFA 3L4SO 3I9NA 3H9QA 3HADA 2WYUA 1UZMA 3FNGA 3UH1A 1LRJA 1DFIA 1EVYA 1VL6A 3LT4A 1U3TA 2J5KA 3U0BA 5LCXA 2O4UX 5KJEA 1K2WA 2EJVA 2G0TA 1C0KA 2GYYA 5ER9A 1X0XA 2H5LA 1XQ6A 2H1SA 3FR8A 4AJKA 5FF9A 4YR9A 1R4NA 3DC2A 3JQ7A 1GTMA 1ZIDA 1HE3A 2VZ0A 4R1TA 4NR0A 2X5OA 3V1TC 1ZFNA 4AJPA 3PHIA 4BNFA 2BFMA 2YHIB 4TKMA 2VHZA 3K73O 3NX4A 4YXFA 4ND5A 1E7MA 1XIVA 2BMAA 1WWKA 1C1XB 1FDVA 2ZYAA 3GDGA 1H6AA 2W2KA 4N5LA 4BUCA 1JAYA 3KYDA 1GUZA 1YOVB 3GNTA 2VWQA 3NYWA 4HWKA 1ZZEA 5EMHA 2HAEA 3AWDA 1EFKA 3F9IA 4GVXA 3VPGA 4RF5A 4I9NA 3VH2A 1V3VA 3E82A 3WGOA 1Y8RA 3I9OA 2DM6A 4YRBA 1YE3A 3QHAA 3PQEA 5TLSA 2RHCA 3D3EA 1ZUD1 1R4MA 4U6SA 2D0IA 1XELA 4J7CA 2GUGA 3GN1A 1SNYA 4ONEA 4W4TA 4OSOA 3RUEA 4JX8A 4O0LA 2X6TA 3AI2A 4EEZA 2QYTA 1RM0A 1UP7A 4IJKA 4H3VA 1EVIA 5JXWA 1TT7A 4II2A 1IUKA 2YV1A 2WDZA 3EGOA 4IXTA 4H7PA 3Q11A 3GVPA 4MPDA 1X1EA 4W99A 4L75A 1EBFA 3LT1A 3AU8A 3O38A 4FCCA 2IZ1A 3ANLA 4GSKA 2VRCD 3DBHB 4E5PA 1NAHA 2JFFA 4NFSA 4E32A 2FP4A 4RPKA 3DO5A 3EDMA 1HWYA 4YQYA 1EUDA 1GADO 3ANNA 4PG5A 4AJOA 3INRA 4CV2A 2XF8A 4DLBA 2NACA 1ULSA 1BDBA 3B1KA 3SJUA 1EDOA 4LW8A 1VPDA 1N1GA 3N74A 3MTGA 3C7CB 3WXBA 4HBGA 3ZV3A 4D3DA 4EW6A 1I2CA 4XGKA 4PG7A 3WICA 3HZZA 1DIAA 5F1OA 1KYQA 1V35A 3TJRA 1VLLA 3WFJA 3U4IA 4IJWA 3WYCA 4EUHA 1R0SA 4LMPA 4RPLA 5G0TA 3D1LA 5JE8A 1J4AA 2BGKA 1H6DA 4NBWA 1I0ZA 4XX0A 5L95A 5L4SA 5AYVA 1PJTA 4GL4A 3KVOA 3MJVA 4AJIA 3U5TA 1LSUA 2RCYA 3RBVA 1SCUA 4CQMB 2WD7B 4AJNA 1ADBA 1J49A 3DAGA 5L9AA 3Q0EA 4E33A 1CQIA 5A03A 5DBGA 2VYNA 3DFUA 3JD2A 1PL8A 5IJZA 2GZ3A 3UXYA 1X7DA 2GO1A 1P3DA 1U8XX 2NU9A 4BV8A 1IPEA 1MV8A 2WJPA 3GUCA 4XDYA 3NKLA 3WDSA 1UZNA 3M6IA 4MP3A 1ID1A 4XWYA 1PJ4A 5DCYA 1CDOA 2J3HA 2VYVA 4EJ0A 3TN7A 2Q1SA 3BTUA 1XDWA 4WJZA 4KMSA 1CETA 4BKOA 2C20A 3M1AA 4S1VA 1P1JA 4A10A 4CV1A 5A06A 3DMYA 1R37A 2FRDA 4FFRA 1DSSG 1K0UA 3D4PA 4OKNA 2Y1EA 3BIOA 4IS3A 4PLHA 1ZKMA 5IN5A 1Z7BA 2PY6A 4CM7A 1PU2A 3GLQA 5A9RA 1YB4A 3ZNQA 3DZIA 3VOSA 1E3WA 3Q1LA 3RU7A 4BO5A 4X54A 4NBUA 4R69A 3WGHA 4GMFA 2ZB3A 2C29D 5IDWA 3U9LA 1WVGA 2PKQP 1A72A 3PIDA 3ZI0A 4CUZA 3PZBA 3ZWXA 3UUWA 3RI3A 1YOVA 3F6YA 4QEDA 3PHLA 4RVFA 5JPIA 5JYEA 4D3SA 5BNIA 4IPTA 2UDPA 2WD8A 5H81A 2J8ZA 4QXMA 1A5ZA 5BNFA 4R51A 3PZRA 2FWMX 3OJOA 3RUFA 3ZU5A 2CFCA 3RCBA 3IIEA 3ZU2A 4ND4A 3ULKA 5BR7A 3GGOA 3OJFA 2WM3A 5IAAA 5B12A 4WKGA 4CLRA 4FC7A 1W8DA 3HFSA 4R4JA 4Y6RA 5I9NA 2VHVA 3FTPA 4I5GA 3HDQA 4IDGA 1AUPA 3EZLA 4UVHA 5KNLA 4FFNA 1Q2XA 3NDRA 2Y1DA 2NTNA 2B4TO 1E1MA 2Q4EA 5IZCA 1I8TA 1PZEA 1HE5A 4XRGA 3DBHA 4MVJA 1Y8QA 1M66A 2DFDA 2GZ1A 4MIYA 1EMDA 3PTZA 3ZV4A 5L45A 1G1AA 1B26A 1E5LA 1PJSA 3GMDA 1I30A 4J7UA 4U0JA 1VRWA 4E2YA 1YRLA 3F5SA 3Q6IA 4IJUA 4M8SA 1N8KA 3C24A 1A4IA 1ENYA 1D8AA 4UULA 3O26A 3I6IA 4GKBA 4P4LA 3ZHXA 1NP3A 3WSWA 4BIIA 3MJTA 2Q2VA 2VUTA 4XIYA 3RUIA 2PZKA 4LMRA 4NG5A 1SPXA 4EJMA 2B36A 2DBQA 5JDCA 4G81A 3AOEC 5CEFA 4GLOA 3KBOA 4J0FA 5F5NA 3BMNB 2B4RO 5TJ9A 1ZSNA 1DHRA 3JQBC 3I5MA 4RJTA 1DC3A 4FD3A 2GN4A 1DDOA 4BO7A 4XJTA 3R3SA 4C7KA 3F46A 2Q49A 2QG4A 1T2EA 2AE1A 4OXYA 1HEUA 3A1NA 4OQYA 2Q1WA 1P9LA 2EEZA 4PG6A 2I99A 3QWFA 2JKVA 3JD4A 1YL7A 3RUDA 2PLAA 1MLDA 4ZQGA 4KP7A 5F1PA 3TQHA 4UUMA 1NVGA 3QLJA 5H83A 3O9ZA 5B4TA 1LTHR 1TT5A 4FJ1A 4Q3AA 2GF2A 3TPCA 1PSDA 1GL3A 1BTOA 1ZK1A 3GVCA 4L8VA 3C7AA 4IBOA 5AXDA 1U3VA 2Y68A 4BO2A 2OXIA 4KDFA 4BOYA 5CDYA 4XQ9A 5JCJD 1LUAA 1GYQA 5JAMA 1UP6A 3WMXA 1UXIA 2NQTA 2JAHA 2OOSA 4GGOA 4ZA2A 2AG5A 1BW9B 1H9AA 1Y7TA 3ZWYA 2C59A 4WASA 4WOKA 3H2SA 1O5IA 4C7JA 2D5AA 1NHGA 3OECA 2CSUA 5J23A 5JY6A 3VDRA 1YDWA 3GA0A 4YT5A 4O63O 2YQ4A 2BF7A 2D5CA 2POQX 4ALJA 5TIIA 4O6VA 1E7SA 1YBVA 1RWBA 3U49A 4ZD6A 2X23A 1NFFA 3COSA 4P38A 2YDXA 3ZWWA 4ZN6A 1NM5A 1G6KA 1RPNA 4XQGA 4DMMA 4XYLA 1GYRA 4WLNA 5JBIA 3SEFA 1FJHA 1LX6A 1P1KA 1WDMA 4CM6A 1W73A 1EE2A 2O3UA 3OIFA 3PJGA 1PGQA 5T5QA 3WLEA 1KOLA 5CDGA 1RYDA 2PK3A 3HJAA 1ZK3A 2J6IA 2LDBA 4CMIB 1HDCA 3BMOB 4AJ4A 1XG5A 4TQGA 2R6JA 4PG8A 4I5DA 5T67A 4DQUA 1ZSYA 3D64A 4HV4A 2R2GA 4M55A 2HJRA 1U8FO 4KOAA 1FDTA 5G4KB 1ZK0A 1IB6A 1GFSA 1DRVA 2Q50A 4LISA 2WSBA 3FNFA 1GY8A 3GT0A 1K3TA 5JMWA 3IMFA 4L4XA 2BGMA 3ONFA 2AA3A 4PLGA 2HMSA 4W82A 1E6UA 4W7HA 1D4FA 2O3SA 3TOXA 3RKUA 4TRJA 3LLVA 1ENZA 3E8XA 3GG9A 3QJ5A 4KWHA 1LJ8A 3GNQA 1OFGA 2PH5A 3H9JA 3ZWNA 5KVCA 1V0JA 5F5LA 4CUKA 3Q3CA 5DT9A 1HE2A 1HSOA 3H9GA 3H65A 1HLPA 1GUFA 2VUSA 3ZN2A 2Y66A 5T57A 3W8DA 4EUEA 3WTBA 4YAIA 5JMPA 4IIVA 3UGKA 5L7TA 1IL0A 4YACA 2PZMA 1GR0A 3X2EA 1KY4A 3DZKA 1A7KA 3MWEB 1ONPA 1HYEA 1R16A 3TOZA 4UUPA 3N58A 3VZQA 3QRWA 1Y81A 1NYTA 2IZ0A 3DFZA 3WGGA 1DRUA 4IGEA 4URFA 2NVBA 1Z73A 3V5NA 1IOLA 3W4JA 3JQFC 4JGBA 4U8GA 4KZPA 4TVBA 1LLUA 2BH9A 1YL5A 5I8ZA 1RM3A 1PZGA 4GPD1 4BS9A 4BGIA 1DC5A 1UAYA 4HY3A 4RPGA 3A28A 1LRLA 3KRTA 4XKJA 4ALNA 1SMKA 1I32A 1E6EA 1FDWA 1KC3A 2FZWA 2PD3A 3F47A 4CODB 4NU6A 1Y9EA 4NPCA 1IPFA 3BMCB 5CP8A 1B8VA 4J9UE 1KEPA 4TROA 4F6CA 3GQVA 4WLOA 1FDUA 1NR1A 3UICA 1BW9A 3V1UA 3OSUA 4YJDA 4J1NA 3O8QB 1LBEA 5IDYA 4LVCA 4KQXA 2FPGA 2G1UA 4BNWA 3E03A 2GD1O 1CERA 1W0CA 4AICA 4AVYA 4B3IA 4CJXA 3H5RA 2PR2A 3EYWA 3L6EA 4AJ1A 1R66A 3E1KA 4IGFA 4RO0A 3ZWVA 4BNXA 5B4VA 1ZCJA 1I10A 4WLVA 4IUYA 2GN8A 2BELA 1AGNA 2YHUA 3FCOA 3GGGA 4ILKA 4L9RA 1DLIA 3JD3A 2Y1FA 3IP3A 2YZ7A 4XJSA 3VVBA 1Z7EA 3DZGA 1LC3A 1R0KA 4Y67A 1SZJG 2EG9A 1DC4A 1RYEA 1WAMA 2OMEA 3K9QO 3KO8A 1E7YA 2YDYA 1UXKA 1ISFA 2P9CA 4MOWA 4CM9D 3LC2O 2DQ4A 1U3UA 3CTMA 2HJSA 2HUNA 3GK3A 3VPSA 4CR6A 2RHRA 4M89A 3RU9A 1QSGA 6ADHA 3GY0A 4L0QA 4Q9NA 4RVHA 1P74A 5G4KA 4NI5A 3RIHA 4RVDA 2X5KO 3MZ0A 3FSRA 4ZJUA 4XYGA 2X9GA 3GOHA 3RBZA 1HRDA 5A5FA 3GZNB 4FFPA 4D0SA 1IULA 4J49A 3EC7A 1C3VA 2WYVA 4I9UA 3S2FA 4R16A 3WIDA 4NJOA 1A9YA 2H6EA 1HDYA 5CEJA 2AE2A 3KLPX 4PG4A 3GF4A 3A4VA 5EIOA 1HDRA 2Q4BA 3AY7A 4WEQA 2D59A 2GN9A 4BNKA 4BNJA 5HWSA 2FPPA 3VKVA 1YQDA 4II3A 4IMPA 1LDNA 3RFVA 1X1TA 3U4HA 2DT5A 1BMDA 5CG1A 3KV3O 3OBBA 1ZBQA 2GRAA 4K6FA 1HF3A 3IKTA 4FS3A 3HN7A 1QYVA 4CMBA 4J0EA 4L74A 4UAGA 1CIVA 3K5PA 4IJVA 3VTFA 4BNZA 1Q7CA 4BNUA 2YV3A 4R9RA 1EDZA 1QYCA 4G65A 1S7CA 3L6DA 4BO9A 4CLOA 1XU7A 4BO3A 1Y9AA 4D79A 2GNAA 5MGBA 4FDAA 3RAJA 4ALIA 1ARZA 2W8ZA 4PN3A 1E6WA 4ALKA 4RVGA 4UEJA 4GX5A 3OMLA 5DOVA 5KJ1A 2X9VA 4QX6A 1VI2A 3T7CA 3FI9A 2OP1A 2PFGA 1DC6A 3GC6A 3AUUA 3HQ4O 4Z0PA 2ZK7A 2FPIA 1LLQA 3PQDA 2CDCA 3CZRA 3OQ1A 8LDHA 4DMLA 3HDYA 5TQVA 2I66A 2QW8A 1PQWA 4F45A 2WEKA 1NXQA 1KVUA 3VH3A 3DR3A 1N7HA 2X0JA 1C0IA 1CRWG 4PLTA 3WWYA 2CDBA 2W4QA 3RD5A 7MDHA 4B8ZA 1L7DA 3C7DB 3GN2A 3LT0A 2X0IA 4E12A 3WGYA 4YT8A 4B4OA 1NTOA 3AY6A 4PRLA 1I36A 3O8QA 3VZPA 5JAZA 5IXYA 2GR9A 2F1KA 1IHYA 5JC1A 2Q2WA 5THKA 4HFJA 1P1RA 2ZKLA 1LDBA 3QE3A 4MKZA 3WWZA 2HLPA 3NRCA 4W9NC 3RJ9A 4PVCA 3ZW8A 3I83A 1BRMA 1EQUA 1MUUA 3ZH2A 3IKVA 3RUAA 4NQZA 4JK3A 4Q3CA 1B15A 2ZIZA 2HQ1A 3ASVA 4E2ZA 1JWAB 1Y5RA 1PS9A 1VSVA 5DP2A 4CMGA 1XU9A 1Q0HA 2EJWA 3EUWA 2GCGA 5FYDA 4DIBA 2WMDA 3I52A 3DAFA 1ISHA 3ROPA 2P2SA 4GVLA 2V6GA 4FGWA 2PZJA 4WLUA 1DAOA 4YDRA 4UEOA 3PXXA 4M87A 1WNTA 1I24A 1U7TA 1JTVA 4AFNA 4MO2A 3LU1A 4XD2A 5AXBA 3SC6A 4DA9A 4GX0A 1PJCA 1ZMOA 4QTZA 1X15A 4LN1A 3NTRA 3OFSA 3ZWPA 3OP4A 4BB6A 4BL5A 4QO8A 3DTTA 4M86A 1E1NA 3KETA 3PDUA 2PKRA 3RROA 4O5OA 4GX2A 4JLWA 3JTMA 5LC1A 1SC6A 2RAFA 4RF4A 4ZQBA 1KIFA 2A92A 3QVOA 1B8PA 2ZJ1A 4FJ0A 1U2GA 4D45A 2NQ8A 1DEHA 3HHPA 2EHDA 2ZATA 1EVZA 1H0KA 4DPMA 2X9NA 1ENPA 3GMSA 4Z0HO 4W7IA 5FWNA 4KUGA 3K2BA 3I4FA 3RJ5A 4G5HA 1HZZA 5TT0A 1ZVMA 2E49A 2OBNA 5KOIA 2UUOA 4YPOA 4BKPA 2J3JA 4MP8A 3ZWOA 2VYND 4D46A 1DLJA 4KDEA 2FSVA 2C54A 2QX7A 2X58A 3KXDA 3OQ6A 1WZEA 4PIVA 1GAEO 2X0NA 3B70A 4UVGA 3WMWA 2PNFA 3INGA 1NQTA 4FN4A 4CMEA 1ISJA 3H9EO 2ZQYA 3I9KA 3L4BA 1FDSA 2W98A 3DOJA 3JYLA 3RWBA 3FR7A 4YJFA 1DJNA 3ZHBA 1U4SA 2VYVD
chains in the Genus database with same CATH superfamily
2FKAA 1T8YA 5AM3A 2QLFA 1NDUA 2PMDA 1OAAA 3OX3A 3PKIA 4WZBB 1ABEA 4UNPA 2OGWA 1L5QA 3OLYA 4YJHB 4NEQA 3N87A 1C2TA 1JQBA 1L4HA 3MJDA 3ZZ1A 2CLLB 4PZ9A 5E6UB 5IYZF 4GS5A 2H5EA 4EZBA 4G63A 1R8JA 4Z3KA 1Z5NA 4DWJA 2VF5X 1L9KA 1PK7A 4BMVA 2PBLA 1FA9A 4CWAA 5ITZB 2E4AA 3QE4A 2M6LA 1PEAA 1FSPA 2P9FA 2WUVA 4POOA 4Q02A 4UKDA 2HGZA 3HFJA 3V8PA 3WIBA 2RCNA 3OVMA 1P77A 3EFOA 4EG3A 4FHGA 1MJGA 1P2GA 3DDZX 4QNNA 4UPEA 4NWIA 3NMUF 1F8FA 2BGLA 1GCUA 2QRVB 2GF0A 4JOBA 4I9GA 1J0EA 3W8RA 5LUBA 1D6SA 1JDBC 1L7OA 3F9CA 3OLCX 3QW2A 5CH5A 3WL4A 5HDQA 5JCOC 1G7SA 1P0CA 4ECEA 1ZOLA 4CTKA 2Q5OA 3A1TA 5DX1A 5EA2A 1S2GA 3LIIA 3GV0A 5L40A 1QKJA 2HT6A 3HV2A 5KYVA 4F5WA 4Q39A 4R2XA 4D9GA 5JLAA 4GPZA 4I1VA 1EK0A 3NAMA 2ZYGA 2P6RA 1HKUA 5E3JA 1M6HA 1R1DA 3CVJA 1W88A 2WJYA 4ENQA 4TUYF 3E5MA 1PZMA 1CY1A 3U6KA 3D4BA 1ADJA 3QQPA 3KQLA 1C2YA 3K5HA 3PA8A 1L8LA 4WNCA 1PR9A 2EJCA 2C9CA 3NO4A 4KWTA 1UJ4A 2PRZA 3KTDA 4UU8A 2V3WA 4KUEA 4PHHA 3ABZA 3B1FA 2FZ4A 3E7XA 3VR6A 1RAEA 2P11A 4UBKA 2H08A 3AT1A 4Q5IA 2QVLA 2HC9A 2JIOA 1Y7PA 3HBNA 4L07A 3VR3A 4IV8A 2IHVA 3WNBA 4WCFB 4G37A 4J1SA 2IU0A 2ATXA 5CFLA 5HQTA 5JAOA 3NKFA 2H2FA 1VL1A 1RZVA 1YQXA 1SIBE 2QMZA 3U48A 2GCOA 2IY7A 3WLFA 4HAXA 1MNAA 2I9PA 1GR1A 1Q20A 1M74A 3NR2A 3LHSA 4M21A 3HL4A 4YAUA 5IBCA 5KVSA 4YRZA 1Y34E 1RLOA 2ZM6B 1FLDA 3PL5A 2XZPA 3KWMA 5IVPA 1NP6A 1RLTA 4U3JA 2XQFA 1NXVA 1R00A 3ECCA 1RZRA 3QEJA 1KS2A 2ZJYA 3TTVA 2C4WA 2BFWA 3F4LA 1EFPB 3K2EA 4IDNA 4KPUB 5KAMA 1QIDA 2JIBA 2JL1A 3F3SA 2JAXA 4KYVA 4XQEA 2Y05A 2Q1UA 1H9CA 2NQ2C 1X0VA 4C7MA 2WAAA 3HJGA 4LCJA 2HLDA 4JKIA 1SK9A 3VU1A 4HQ0A 4OLFA 1J09A 1BHSA 1BVYF 4MB2A 2HRZA 2QQ5A 2Z6VA 2ORED 4J16A 4K3VA 4MV1A 3Q5DA 4RL4A 4ZMBA 5ALOA 2RG7A 1M2OB 1T0JB 4UDNA 5DM4A 4XDZA 1RM4A 4ZYVA 3AG5A 4J2HA 1SCIA 2FPWA 2N9UA 1Q7EA 4YUXA 3Q8LA 4GZMA 3UK0A 1G20E 1K3FA 2OR3A 2VF2A 4JVSB 5G2OA 1WPXA 3FA2A 3NGMA 4DG9A 4EA6A 4XWKA 3AHFA 1AKQA 3DO8A 1L7EA 3JQ9C 4E5MA 4Z7OB 1RMYA 3AI1A 2FR1A 4WK0B 1NF8A 3UOGA 2B0JA 2BGTA 1Q1BA 2JA1A 4OMDA 1FU7A 4RACA 3BWYA 3DL7A 3MTAA 5DLQC 2JFNA 3IOYA 4L4YA 1WG8A 2JZNA 3DBLB 1KEEB 4OU5A 1PX0A 3K9NA 1XCLA 3DE6X 3VPAA 1TYDE 1XAGA 4KXLA 3OMXA 3PEWA 3AK4A 4DMHA 2N1BA 3DV9A 4M0PA 2PVSA 3D4IA 3CUVA 1T5BA 2C4VA 2OE2A 2Q8NA 4PXSA 5BN5B 5TMPA 5DI9A 2HDHA 2RK3A 1MQAA 4IY1A 1DRJA 2FRXA 1R3DA 1ODTC 2WMYA 3HDHA 3I0NA 4FN5A 4YRNA 2QDKA 2W6PA 2OLKA 4MWGA 5SZIA 5HRUA 5D7NA 3VOTA 4AXBA 1L4BA 1ZM4A 4MW4A 3P5SA 3W79A 2ZTMA 1LVGA 1I3CA 3B6MA 3WKAA 1BWSA 1R15A 3THSA 2XVAA 1GPNA 2QTVA 2QJWA 3BJMA 1SHLA 1HOTA 4TWRA 2P9HA 3H4TA 2VOJA 3AIMA 1QGUA 4N9QA 4FGUA 1CCWA 2R00A 4UC0A 1J56A 2GKSA 1NVAA 1SJ9A 3A2MA 2KS6A 3WB9A 3BTVA 3ZVNA 1DCMA 5K0EA 4MJ3A 5KJFA 3TM4A 1E3MA 4EBFA 3IQEA 2QIPA 2XWSA 3IJRA 4ZAGA 3ZKWB 3UGQA 4JLUA 3VHRA 5FPYA 4JBHA 3H3FA 3PDJA 4YGXB 3GYBA 3I2GA 2RK4A 2IOYA 4CDNA 5A3JA 1G8YA 4NVRA 3I72A 4H15A 3UAXA 1JPJA 1F17A 2ZBRA 4MMZB 4P93A 1XMQB 3RK1A 3LUKA 4I5EA 2GHQA 4B9AA 3JQQA 4FJ2A 5BN3A 2CNBA 3KQOA 1DJPA 3I6MA 4PX5A 4BMOB 2ZRIA 2FOIA 2R62A 2X6RA 4E31A 4EB8A 3ELYA 3HSKA 5DLEA 2I6SA 1NKSA 2B0CA 2VDRB 2VP5A 3RRFA 2DFVA 2H7YA 5B3LA 1YVEI 3GGPA 3H7AA 1CNFA 1BFUA 1N6LA 1YB7A 3ZDRA 5EP2A 2IC5A 1FW8A 3CEJA 4NSNA 1KBZA 2GMWA 1YCHA 1A9ZA 2AFHA 2Y9MB 4PANA 4KHZA 1O0BA 4L5YA 1CXZA 3H16A 1XP8A 2VZ8A 4YK7A 4MWBA 2IPNA 5TDHA 2WQ7A 2AB0A 3QXCA 2JFHA 3DZJA 1MXHA 1BNCA 1SA0B 2VT7A 4US1R 4Q1FA 1UM9B 1Z4NA 1O89A 1RHUA 1Z15A 2NV6A 1OC2A 5L7YA 4BGVA 2OM6A 4F2GA 1FYXA 1OYWA 1GGHA 3C15C 1ZEJA 2AQ8A 1I01A 2HPVA 2J5XA 5J63A 3DVAA 4QPDA 3NHPA 3SJZA 5EPUA 1DINA 5C31A 3G13A 3BM5A 3ZW9A 2X5JO 5C1BA 2ODAA 3EGEA 2VHJA 3W6OA 1PEDA 5AT1A 3SQMA 4CMKA 1VYTA 4FB4A 2D4HA 3EZXA 3CXRA 1J2TA 2AI3A 4NMHA 4M1QA 4R3NA 5CB4B 1SUWA 1QDLB 3GR6A 5D1NA 3T7TA 3CRQA 4N48A 2GTHA 3IDSA 2DFTA 4GICA 3LF1A 2G28A 5KREA 1AD2A 3DCJA 4L4ZA 1LNZA 4BXOA 4BY9E 2RBKA 2ZYUX 1KI6B 3ESAA 3WRXA 2QSYA 3R75A 1U2DA 1EVQA 3PC8C 3AEQB 2YXLA 2KI5A 5K0LA 3ZVRA 2EXXA 2Y93A 2QPOA 4DLPA 3H4IA 4D8UA 1J6UA 3H2HA 3MHPA 1FZTA 2ID8A 2NU7B 3GVIA 5EJIA 3MMXA 1Y1PA 4PINA 1OREA 3H5WA 1XLTA 3SLGA 1DPGA 1OWPA 3W5VA 5LQAA 2NNWB 4DA6A 1XVLA 2IXBA 2EWMA 2M6RA 3O4HA 2ILTA 3ONEA 3RSHA 4QU8A 1EVJA 1OAKA 4MYTA 4TSFA 3A6JA 4ZCMA 3QX3A 5TJHA 2ODWA 4ASUA 3BXZA 2V96A 3CJRA 4HS9A 5B37A 4K9NA 1I7PA 1SEPA 5CXXA 5BV7A 1GOTA 1G60A 3PA6A 3QVWA 2P9TA 2REXB 3KU1A 3PHHA 1DFHA 4TLMB 5F5XA 3B1JA 2WY2D 3RFTA 1XTKA 4MVXA 4RK6A 2JHGA 4OMUA 3PUVA 1WZIA 4YBZA 1DWPA 4UU0A 5BOVA 1RWKA 4MDHA 5JG7A 5IK2D 2BTQA 2QPLA 5PGMA 4Y2VA 2F67A 1J0DA 1EVEA 5FUVA 1NFQA 3RG8A 4BQFA 2OEPA 3RR2A 5BW8A 2JIPA 2A0YA 1K75A 5CITA 1HXHA 4XD7D 3RIXA 3IUBA 1PD1A 1M2FA 5CBPA 4CT0A 4OMCA 4YJ2B 4AURA 2FR8A 2YICA 3ZLJA 2N0SA 1B14A 1PFYA 4QICA 4EJFA 5HOEA 4EJSA 3K7EA 3DLCA 3UXHA 2QB5A 1HFJA 5JQGA 3BHMA 5LYJF 3NG1A 3UMFA 3QBVA 4CEIB 2DWPA 4PC1A 1L5SA 4E7OA 4IUBS 2O8CB 3CMCO 3B60A 1EE1A 1ZHHA 3OLVA 4YQZA 2B21A 2DWUA 1VFNA 2Q1XA 4E2XA 2C97A 4M0LA 5CK5A 5KINB 2QAGC 4MWDA 3G6WA 5HZHA 5ESWA 3VXKA 3T4UA 1K88A 2D4AA 2XWBF 2IH2A 3LPDA 4FYMA 4MNTA 5FR1A 2QI9C 4INPA 1XZCA 2WMNB 3RANA 3P4XA 2V58A 2C2KA 4OB8A 3T5GA 5D3KA 4UUNA 4LE0A 2OG2A 3GP3A 4P32A 4UM7A 2GHIA 2V0CA 3NOOA 3NIGB 1FSFA 3ZBUA 1LCIA 1NPDA 2I33A 2C3OA 3AF2A 4LHSA 1KJNA 1UMCB 1CG6A 4P4UA 2CVOA 1FS4A 2CUZA 2B8WA 4GPAA 3L1UA 4I1UA 2F3SA 3FYDA 3TSYA 4KQ1A 2ZG6A 2L82A 4WTOA 1BH2A 4A15A 2OORC 4B33A 4ID9A 2NUAB 3R7WA 2X9QA 5EKXA 5FNZA 2BEVB 1ORWA 3TFQA 1N7IA 4DWWA 1D7AA 1Y5MA 5IZ4A 3QVLA 1FVFA 1TNDA 4RA6A 1LU9A 4QWWA 4AJHA 3A9TA 1LVUA 4L8YA 3HKDB 1JEYB 1H2BA 3ICOA 4YDHB 3VI3B 3CLRD 4I55F 1E2FA 3TNFA 5H9WA 2KW5A 3ZLTA 1O4WA 1TTPB 2VWPA 4UDXX 2LE0A 4LBWA 2XKBA 1SD5A 1BWQA 1FYFA 1SEVA 1CE8B 3M8KA 1VRCA 3QEMB 3QLUA 3WNCA 3E8MA 3EFEA 3PYLA 4QPJC 5DHFA 2YYYA 5C80A 2WJJA 5AKLA 4NTZA 4BZQA 1AV6A 4Y2PA 2C77A 3JYOA 1QRUA 2L18A 3WRVA 4LNHA 1TJ4A 4N5DA 1MT0A 3SS8A 1HGXA 4MQEB 1GPKA 3B9RA 3ORRA 4ZAFA 1YMVA 2AW5A 3H99A 2ZUEA 4AUMA 2ZVDA 4CKEB 2BTEA 1QHHA 3OM0A 5JVDA 4CM8A 4WY2A 4YAWA 4CL0A 4EFMA 3IS3A 5ERGB 2IYOA 1SCKA 5DF1A 4DYVA 1VPEA 1N6PA 3SQOA 4KV9A 2B2CA 5E0KB 2DAPA 2RHHA 3KJQA 3UAGA 1OC4A 2OC9A 4FHDA 1R0RE 2BHTA 2EGHA 1DQPA 2YVKA 1R6DA 3KQVA 4AECA 1M7GA 3HVJA 1GYPA 1MPXA 3IUPA 1A9SA 1T9AA 3WGVA 3EXG1 1MIOA 4DMGA 4R81A 5ESDA 1PG5A 4FINA 4RADA 4IJ5A 3VHQA 2J3IA 3IKJA 3ORYA 3RLIA 4D02A 3WGIA 3P19A 4N6OA 5LSAA 3IPAA 5L3QB 3OLZA 1CFZA 1J9EA 2I4IA 4BQIA 9LDBA 2ZXUA 3CPJB 1AUVA 4BC0A 1Q74A 1JFRA 2EW8A 3THRA 3I04M 4BLPA 3EEOA 3BCSA 4A4DA 3OA0A 4C6TB 1J7KA 1JHQA 2X5NA 5KVVA 5FBVB 3A6DA 2GN6A 3H7IA 3OHSX 5CFOA 1U2TA 1JTFA 4B6OA 3BMOA 1NF9A 3RFFA 3I76A 3QIVA 1CDDA 2ACWA 4QVIA 3HM9A 1YUBA 3NUQA 1BN6A 3GW8A 2X4GA 1NIPA 4O29A 4WJKB 3PIIA 4XE5A 2AC4A 1XZNA 1II9A 5EJEA 5LZ2A 3HNRA 1KO1A 3EW9A 5EP3A 3M33A 5GMOA 3L1KA 5BRJA 2IYSA 1N3IA 4A2WA 4PFQA 2AMFA 4N3NA 3W3AH 5G4LA 5D84A 2PV7A 3G0GA 5I3CA 5LA6B 1JVBA 1GUBA 1LNSA 1WM1A 1NUHA 2WU8A 3KKMA 4KSBA 4Y6LA 5K6AA 3KLNA 4FYJA 3VYTB 1KYIA 1JAZA 1U1EA 3O8OB 3I12A 4YRPA 5H1YA 4FZRA 4U2FA 3QX9A 1E3SA 3W78A 1JHRA 5TQ0B 5BNTA 3JWJA 4FFMA 4GOOD 1DX9A 1WVIA 3GRAA 3H6GA 2ZRQA 2VHWA 3EF3A 3I05A 2IYXA 1Z4LA 3D4LA 3UMMA 3UTCA 5DI3A 2HADA 2B20A 3FDIA 3NHSA 4V39A 4WJLA 1ICIA 2A9FA 4LZJA 2OBXA 4PYKA 1OILA 1QH1B 3B82A 4XPIB 4YJGA 3OEWA 1QVVA 3R4CA 4HFMA 4HWGA 3Q0IA 3WMEA 4ND8B 2F9MA 1FX0B 1HURA 4MW1A 4DRZA 4EENA 3BD6A 3I23A 1F0YA 3P9SA 3TR0A 1E2HA 1CR2A 4PTLA 3DC7A 3IYLW 2C9OA 3TVDA 1E9DA 2XOXA 5KTRA 1RWOA 2PEYA 2AI2A 4MQBA 5JYCA 3KOUA 4JCCA 4ITVA 2OSBA 1BCSB 1ENOA 1OLSB 2P0AA 4N0PA 2PTGA 3RQSA 2ZB8A 3SJBA 4C3ZA 1SU4A 1ESNA 2H85A 3OX1A 2PZLA 2H1HA 1W6UA 1FTYA 3GPIA 1JR3D 4D81A 5TMBA 4N7RA 4QREA 1FK8A 3SF8B 2VDOB 1NMZA 2YY7A 3ENWA 4EPYA 2FVXA 3W3AA 4K6OA 4EHJA 1TOAA 3U4MA 3UOWA 1NW8A 5JEEA 5EPEA 4HQ6A 3GDFA 2CL7X 2CBXA 2X7HA 4WPGA 1OTHA 1A77A 2HK7A 4KWEA 1EEHA 3KHKA 4XGQA 2AZDA 5CHEA 2ZJ4A 3HXQA 2CYAA 4DR4B 2OHJA 2WOJA 3IP5A 4I3FA 3UCFA 4IRXA 4NU5A 1POWA 4MVWA 4FMPA 1N2GA 5DGXA 4LE2A 4H18A 4M38A 5FFFA 4FFOA 2UVDA 4H1HA 4R5MA 3U0VA 4BLRA 1UDCA 1ULHA 3VO9A 1U0BB 2WSMA 2Q4DA 2ZJ5A 3N05A 2GDJA 4WZAA 1E1KA 2ZRAA 1HYHA 1Y8CA 1KYWA 2CZQA 5B3JA 5L3SB 4AF7A 3DZFA 3EQ6A 3LUDA 4HN2A 4D3FA 5ELXA 3K96A 1SHZA 1LPPA 4QBTA 3VZSA 4JLAA 4I4TB 1CUSA 1M9NA 2VK2A 3JQAA 2BCEA 3LA6A 2CSXA 3SU8A 5HHTA 3DMGA 3F9RA 4JOSA 2QX6A 4RVCA 5E2AA 4DJEC 3L41A 5EJ2A 3BCHA 3WQBA 4QOHA 2I71A 3R3JA 2YWEA 2AJBA 1FP4A 5T4BA 3BK2A 1E2MA 2AG8A 5J2TB 2XDQA 5E9JA 1X1QA 1A71A 3T4XA 3LC1O 1NV8A 4QXQA 4XR9A 4JBIA 1NM5C 3U7EB 3BDIA 3QKSA 1QXSA 2C2HA 3C3CA 1JALA 1K3UB 3TLYA 3WDKA 4BV9A 5C8DA 5HZGA 3GLGE 3HKBB 3JALA 4LMBA 3UAOA 2B5WA 3E18A 1ZD9A 4HEJA 1I7DA 1IEXA 3H8SA 3O75A 3OD5A 1Z8HA 3BREA 3UT6A 1C1DB 1JYEA 1Y8AA 4YV0A 1M6VA 4V3CA 2R8RA 3FFXA 3NTOA 4MUYA 4XDGA 5FL7D 1G3MA 3W77A 1F5NA 2IYYA 2WIAA 5BOSA 3O84A 2JVJA 5JC8A 3QVXA 4H08A 4Z4HA 1HDXA 1L5HB 2JAWA 4BCBA 4EO4A 1DWQA 2W42A 3PX2A 4R2KA 1K8QA 2Q9CA 2FW1A 1JIVA 1BROA 3QA9A 3FW1A 3TGWA 4BFCA 2UUBB 3DZDA 1RAFA 2XADA 2H57A 2GN2A 4NC9A 1TVEA 5AHRA 2IBSA 1NVFA 1U94A 1X7XA 3TTTA 2AG1A 4EABA 4GZ3A 3WYBA 5KSOA 1UBRS 3BHJA 1Z28A 4ND1A 4A73A 2H1VA 3NHKA 5CNJA 1W4AA 2BP7A 2C5HA 4DM7A 3D3JA 3FLMA 1E3WB 4G1BA 1CUGA 4BECA 2ZZNA 3C8DA 2PIDA 2FYTA 4GL2A 2DQYA 5B30A 4FYIA 4GD3Q 4E30A 4GLLA 2XJ4A 1XEXB 3K8QA 4JJIA 3VM6A 4FBLA 2QMUA 3QXJA 3D1JA 2NXNA 3FOWA 4U2DA 2CLIB 2OZLB 3THWB 4QSMA 1RE1A 1Y48E 1ETUA 4KXQA 5B1EA 3TTSA 5FI1B 4AY6A 3GNSA 2FWJA 2JI4A 2VI5A 2XYPA 5F33A 2V6BA 2JHFA 2Z9CA 2O19A 4BVEA 3GJ4A 4F46A 3PB3A 4FHEA 2V5VA 1J06A 1AKMA 5DT2A 1KI8A 2BIFA 2XGMA 4ZV7A 3R7BA 4NULA 5FFNA 1FOEB 3QU4A 5CLGA 1PT9A 1UK7A 5COQA 2NU6A 4ZQFA 2ZYHA 5IT5A 2E37A 3DG9A 5EQDA 5FFMA 1RYYA 3R5XA 1VE5A 5HKLA 2JHPA 1WXEA 1F8YA 1PQYA 1QIEA 1Y3AA 2O7QA 3GD5A 1FC0A 4AJ2A 4YO8A 1KJIA 4P0PB 3G79A 4KFRA 4AU1A 3JQGA 4RZIA 4MQFB 4M6WB 3R7DA 4C89A 1JRLA 3L1HA 3TIGA 3AVQA 3FDXA 4RD2A 4G0VA 3K0HA 2BFEB 4TWAA 4DQKA 4EHIA 3GRZA 4Q7LA 2BI8A 1QDEA 4TMFA 4P7BA 5CYOA 5FX2A 1E0SA 1C30B 1UKEA 2X9LA 3RC9A 2V1UA 5B2ZA 3C4QA 1RPTA 2ZJ7A 4BQEA 1NPYA 4IO0A 3B1ZA 4ZJYA 2JLXA 1VHTA 3CMMA 4WXRA 1CZOA 4V03A 1KSFX 3UGTA 4IRMA 1HETA 2F1HA 2MHCA 3N39C 4H60A 1T3LA 1JSRA 5CMLA 1P31A 3W9UA 4BV3A 2ZE5A 1G4AE 3K5IA 4JS0A 4L76A 1FLNA 4F11A 3K71B 3SHWA 5D5PA 1HTBA 5AQ1A 1AQNA 2NSLA 2OCDA 5IJAA 2PMBA 1EM6A 4NYJR 4G86A 3WV5A 4O4JA 4EVRA 3DF9A 1L8AA 2A57A 1XWFA 4J7XA 1JWLA 3PEEA 1PD0A 3MAGA 4W6ZA 3RFUA 3OJCA 3U3JA 4TN5A 3BB4A 3DKVA 1B16A 1ZSVA 2HTEA 1DAPA 5DYYA 1Z74A 2NPOA 2VT2A 2W2QA 5HR5A 4YWJA 1LFDB 4ZOLF 2MYNA 1I7SB 1G8GA 4FHZA 5FTJA 1RJ9B 1V4VA 4O4IA 4PFJA 2TS1A 2O23A 3GRPA 3KPWA 4CU5A 3TKYA 4CIVA 2WM2A 3ANXA 4B4KA 3QZUA 3ETDA 3B51X 4KCGA 4G89A 3H1AA 4OM7A 4KAFA 2ZRNA 2J9ZB 3O9MA 1RWXA 1GSIA 5LFAA 5K3FB 4OK6A 1F60A 5KYXB 3AY3A 3ZCRA 2W2VA 2BE7A 4OAQA 4OHWA 5C5CA 2ZIFA 1K6JA 1PL0A 1P1HA 4QT0A 3OY7A 1XMXA 1I33A 4ZRNA 5KQLA 2XV1A 3K0CA 2RHWA 3CX7A 1Y3HA 2XR1A 1OVMA 3CPEA 3H84A 1QFJA 4NX2A 1Z4PX 1ZLXA 4MVJG 5HJ7A 1U2QA 3E3AA 3G2LA 1J97A 1PEKE 1MEEA 4JQSA 5DBEX 2CCKA 2PWYA 2XGJA 2ZIXA 1LI7A 2ZBFA 4MPRA 4B09A 2VCYA 2AS0A 1WD7A 1QYXA 1OXMA 2HBYA 2VJNA 1GQSA 5D3QA 5TPWA 1E1LA 2NM0A 4C0QC 3RVKA 1WSWA 3FRIA 5AJXA 5IU6A 3P9CA 1FMLA 5EIAA 4BAZA 1X7HA 3NDIA 3QWBA 4RIEA 1QDUA 3BXGA 5KAPA 4DQXA 1RJWA 3F67A 5BSMA 4D97A 2XB2A 2V45A 3B6EA 5AVXA 2FUKA 3OE7A 4OI2A 3UXMA 3EAQA 2ZIEA 3HFRA 5LKRA 4TKUA 2GJ4A 2VAVA 1QIFA 2AJLI 3OURA 2RI1A 2C4TA 5L6MB 1Q0ZA 4ZQEA 3X1DA 3U7RA 4YP5A 2KLBA 1VE9A 1DRWA 5EG5A 1Q12A 3H86A 3OPMA 4BAGA 4D42A 3JQEA 3U09A 4UFPA 3DMFA 4IVQA 1V9LA 4MW2A 3IALA 4XWGA 4N8SA 4ACBA 4MDFA 2IHTA 5IHXA 5DB4A 2WHQA 4AKEA 4Q03A 1EX9A 5LOVA 1JMKC 2AFIE 2QN7A 5BUQA 4LCEA 3SWWA 2NP7A 5G3YA 1E59A 4BATA 4MJ7A 3TG2A 1DB3A 1QZUA 1SPBS 1TZCA 2I6TA 3KEGA 3LHFA 1Z26A 2ERXA 2UZ3A 5DP1A 5FT9A 3OJ0A 1CUWA 1D9ZA 2YTZA 3MMPA 2G7MC 3SYMA 1H2XA 2ZSAA 3UMSA 2ALJA 4QZVA 5J47A 1NVXQ 5KIAA 2ZRMA 1OJ7A 1U31A 2YKGA 2OYRA 2ILVA 4HQOA 4QFCA 4ZIRA 3LWNA 2P4HX 4QRHA 5EWLB 4A5SA 3RC7A 4DR6B 4Q6BA 1E98A 5IXJA 3W8FA 6YASA 2PX0A 2ZR8A 3CM0A 3CF6R 4DLSA 4GRIA 3M2TA 5L3SA 1QYWA 3CQ9A 1Y63A 2P0EA 2HX1A 1WMFA 4IUCS 1D2GA 3ROQA 1SWVA 1W96A 2BISA 2FMKA 1QMGA 3DJFA 5CFRA 1QLJA 1QS0B 3DFFA 4IDFA 4OHKA 1M6NA 4KQ9A 5CDTA 3RKSA 1ZN8A 3TEJA 1U1IA 4Z51A 1YL6A 3HRKA 5DX8A 3WGQA 1TA4A 3PJFA 2FXVA 4YLEA 1RW4A 1UDRA 3SEAA 2HM7A 4ZVSA 5IG2A 3L7DA 4R40A 5CLJA 2VUUA 3PFBA 4ADSG 4O02B 5FLXA 1SB8A 4U39A 3EB9A 3H5AA 4ZVNA 3PQ2A 1MVLA 4MP6A 3C5EA 3QE0A 3T7JA 3NGXA 1CY4A 2XOKD 2Y2VA 3U37A 6NULA 1FNCA 4UD6A 4B76A 5BMVF 4GM0A 2QLMA 1F1BA 5BORA 4IG4A 1S02A 1EWRA 4MLPA 4QC2A 5AW9A 4PCVA 1USVA 4HLNA 4YJ3B 5EEGA 1YJCA 2O1EA 2OO5C 3V1MA 4EVSA 5J3JA 3EG5A 2GPJA 1S3IA 3EA4A 3IERA 1ZH2A 1I13A 2YMMA 3OQVA 4PX3A 5E6UA 1Z5ZA 4ND3A 2DPHA 4EFKA 1RE0A 2ZDGA 3TS1A 4NCJA 5BSVA 2JD0A 3FNEA 3K92A 1DWOA 4JEIA 4D6XA 5JH7F 2X5XA 1GPDG 3D02A 4EB0A 3ETJA 3T1NA 4ZEMA 4OHUA 1MG5A 2EZ4A 4FLMA 4H3SA 1JS1X 4OD0A 1JU4A 3HU2A 1XXHA 3BMQB 1YNSA 4LRSB 3B20A 1PUJA 2QRVA 1N3YA 1Y3BE 3CVYA 3ACBA 3ZHOA 4B84A 3VZCA 4N54A 1NN5A 4Z0TA 3DNMA 3VR4H 2HMUA 4UDYX 3ZW7A 1JSCA 2W7TA 2ZYDA 4J0HA 3VPXA 2YUTA 2EBHX 4U7TB 3VVMA 4D1YA 3U3ZA 1NI5A 1U0FA 2J3KA 1FQOA 5BSHA 3EK2A 3OI7A 4TZKA 2GLXA 1C3LA 2OY0A 3EY4A 4JJ8A 5FYQA 3IEKA 3B9QA 4K6HA 1X8KA 4RSHA 5EJ6A 1L3CA 3VDXA 3OQBA 3PIRA 1B0ZA 1DAEA 2RHTA 3H6KA 2XH8A 4NK5A 4OH1A 4DL9A 1UJ5A 5AOVA 1JHAA 1MB4A 4L08A 1UEIA 4P6VF 3PYXA 3JYNA 3B12A 1DG3A 4HXYA 1LDYA 2C5GA 3JARB 4IVPA 1WHSB 5FA8A 3VX3A 4AZWA 4DILA 2WT8A 2Q5QA 2XVYA 4WCFA 3R6TA 5B1IA 2ORYA 3I32A 2JHAA 2FQWA 4ZREA 3TPZA 1QGYA 2ZJ0A 3OD1A 3UANA 4PZCA 1VSUA 1TKBA 4AZTA 2XA2A 1OASA 1DDGA 2DC1A 3QOYA 2C84A 4LX8A 2H9AA 3HDVA 4LXUA 4ZOAA 3U2QA 1ZJWA 4OSPA 2RI0A 2JGMA 4M46A 1V96A 3I5UA 1SO8A 3I9JA 2K2WA 3IGFA 3FRHA 3O8DA 4KQGA 2EW2A 3GYGA 5CXUA 4OGWA 3THXB 4H16A 3U7GA 3CZ5A 4WOBA 1WBDA 3Q85A 3KQMA 1XR3A 2H63A 1AHNA 1GRCA 2EATA 1GL7A 2JGDA 4C6HA 2Z1NA 4Y6PA 1IIRA 1CHNA 5DGDA 4S04A 2R6FA 2JANA 3QTTA 1EFPA 4XB1A 1B8UA 3VR4A 1V2HE 1YBMA 5CLFA 1FPQA 2QL7A 2WTBA 4MYUA 3FTCA 5D6NA 2YWDA 5BVHB 2HU2A 4M1OA 3T5TA 2ZBGA 1X7YA 4ZT6A 2QD2A 5FBZA 1IJEA 1JFFB 1QHSA 2XCIA 3OIWA 4U5QA 1Y5LA 3HCCA 4YT4A 9ATCA 2C7PA 2Y6UA 2QYOA 3DOOA 4FGKA 5DBFA 1MC8A 2PD4A 2R1ZA 3IH5A 2EGUA 2QZ4A 5C35A 4G4SP 1GRRA 1UAGA 4AX4A 1ZWLA 1AKUA 1YXMA 3OF2A 4IWYA 3MW8A 2MSEB 3BIXA 1EI9A 2D2EA 2GK7A 2VHXA 4IKEA 1QPZA 4UTNA 2H4YA 3QEAZ 4P3OA 2H2IA 2B35A 4D7AA 5CFNA 1QV7A 1IB0A 1IWOA 1EUCA 2ZAIA 3OIGA 1BWRA 3RRMA 1O94D 2FSVC 4LTMA 1L7QA 4JB3A 4C04A 4G09A 3ZR4B 4CMEC 4YECA 2R5WA 4JFRA 5E8JA 4X41A 3HFGA 5B2FA 2RC5A 4I1SA 2C83A 5IN4A 1VL8A 2PHZA 3K0AA 4EOGA 4R8MA 3HVIA 4PRKA 1AT1A 3RGWS 4CF4A 1XK7A 3WLHA 3DH0A 4BCCA 2CNOA 4A26A 3NAZA 3STVA 3MS7A 3D0KA 5GAJA 5GJBA 3I53A 3ZV6A 5EC8A 2GBFA 4U9HS 4RY9A 5T6BA 4D9KA 1Z83A 5LP6F 2CDNA 3O47A 3KFXA 1AN0A 4ISBA 4RPJA 5IF9A 1DU4A 2X77A 3IIIA 5J5VA 1GV1A 2DOKA 2IP2A 3KWJA 3PFNA 4X85A 3NTLA 5D5HA 4MLZA 5FHRA 2IHNA 5HS6A 1QKKA 2PT7A 1USIA 2TMKA 4ATNA 1VIDA 1ZEMA 7REQB 3JPYA 2GJAA 3VDQA 1G8FA 3OZEA 2GD0A 3U62A 3EH1A 1UDAA 1KU0A 3ZQ6A 2BKXA 3EHDA 2XD9A 5EINA 3PFWO 1NJGA 4GBJA 2F48A 1FS6A 3ISVA 2FW7A 3I2FA 4Z9FA 821PA 1IN6A 5BW4A 4J43A 2IU4A 2AGVA 2CUKA 4IEIA 1AHIA 3ZKWA 4LRYA 4AN0A 3HMQA 3UO8B 3WSVA 3E58A 1PFQA 8ATCA 1DHTA 1X80A 2E0IA 3VZRA 4JP2A 3LUPA 4Q3LA 3QUAA 4X1YA 4EF5A 5FEUA 3TL3A 5JLJA 4R01A 2O20A 2HPHA 1KSJA 1IZZA 1XTTA 3G82C 4X44A 2OCAA 4C07A 4X90A 4C4AA 3KSAC 2VHCA 2GA8A 4KI7A 4UOQA 3V4SA 3PJRA 2HY7A 1BMFD 2C7OA 1C0PA 2D5BA 5LJLA 1F1JA 3DP7A 1U9IA 1ZH8A 2HDOA 1X3SA 3P0FA 1P2SA 2FE1A 3QNWA 3PNLA 5BSRA 5KCMA 2F1RA 2ZIAA 3V00A 4W5HA 4OQMA 4YAOA 4P3KA 1YB1A 2MR6A 2ZUCA 3D5QA 1GA1A 2BGUA 1WU8A 3C14C 3LBFA 4REQB 1ORDA 1R6AA 1L4EA 2HJVA 2OECA 4KQFA 5F1YA 4DNPA 5BWMA 2Y0EA 2YVQA 2H51A 3CC8A 1KQFA 3KAPA 5M2QA 2Z5LA 2JFGA 3TLGB 4Z54A 4B71A 3FLEA 1MFZA 2WWHA 2ZRKA 3LVBA 1JN0A 4MA0A 1VGVA 1RXUA 3N75A 2FPIB 3A06A 1RJFA 3BE6A 2QY9A 3O1JC 1JTEA 3R8FA 5C7YA 4C4RA 1T5LA 3D3KA 5K0NA 5TT1A 1N7GA 1XNQB 1QYRA 2BFDB 3H0KA 3JQ8B 4RE5A 1APBA 4RMIA 3G1UA 4PYOA 4ZCRA 1P1FA 4R54A 2Y1LA 3QKWA 4J9VA 3TL6A 1KH1A 3RYCB 4A1OA 3QX7A 4HQLA 5H8WA 3ZY3A 2OV4A 3E7FA 5CB4A 1YJ5A 3DEZA 1M76A 3TNYA 4R1NA 3PGMA 4DUYB 4LK3A 1UH5A 4PLCA 3DGFC 2YCLA 1SY7A 4P34A 2G04A 1KVQA 2YS6A 2AEEA 3V2GA 3Q3GE 3VO1A 1IWPB 1IOVA 3AEQA 2LV8A 2BMWA 5AOBA 5AJTA 3QF4A 3SE0A 1XNRB 4J16C 4E5NA 2J4CA 3KHUA 1EQ2A 1K1EA 1UBSB 4E1VA 3AEXA 3NGLA 1WLYA 4AT1A 1NBIA 3X2FA 4IKOA 4F3CA 5JECA 5JFGA 2EHJA 2I6QA 3BSFA 3FIJA 3MGKA 3OESA 1YQQA 2QXTA 3IP1A 3IULA 2R85A 2VTDA 3JS5A 4G8BA 5J2UF 2R1VA 1UT5A 1V6AA 2IXGA 5IJ0B 1SBQA 1Q17A 4A0HA 2G71A 1OAOA 1C9JA 1S89A 2QWXA 3Q7PA 4JYCA 1H4SA 3FRJA 3GEGA 3O21A 4GI1A 1N32B 1IEVA 2ZR0A 3I9LA 1M1YB 5T8KA 5BV1A 3VTAA 1D1SA 3R0XA 2ZRPA 3H8WA 3L07A 2D1YA 3MN1A 4U63A 2NP6A 1XZJA 1AKWA 1UZLA 1H2HA 2WFLB 2GK4A 1P6UA 5AI4A 2ZS9A 5J4KA 4W5QA 4LDRA 1GTRA 4EAAA 4MV3A 1E3IA 2OBMA 2X8BA 4OJNA 4KQIA 2NX2A 4G1CA 2IODA 1SZPA 2BPOA 2OYSA 3K94A 3A70A 2I34A 1KO7A 3G0BA 5BQ3A 2OXEA 3L1VA 4FCWA 4TKLA 5HOQA 1PLLA 2P6MA 2DWQA 3DWIA 3IPYA 2PTHA 4P80A 1JQ3A 1IZ7A 1BFKA 1SUDA 2R11A 1E9EA 4JMPA 5LDHA 1ZC4A 1ZM2A 5H4HA 1WLSA 2PKWA 2FMIA 3ER6A 3JR3A 4AQ7A 5IJ9B 1ZL0A 1PE0A 2DVMA 4RHUA 4RPCA 3DLHA 4IV0A 3F8SA 2DUMA 2UUPA 2QQGA 1P9NA 2R00C 3LUFA 4CEIA 3K3PA 2YZ2A 4JI2B 3Q5GA 4XJVA 1RNLA 1ZWKA 1T6YA 5JRZA 3GELA 1DEAA 3LRPA 2ZRBA 1FFDA 3SC4A 4BCDA 3V34A 3UCEA 3PICA 2QNIA 1USKA 3QXGA 2O5VA 1RQNA 3AF0A 1QR6A 4KGDA 2L42A 1N2JA 2MTBA 4PHCA 1DBWA 4RIGA 1YS1X 4QGGA 3WKCA 1II8B 1U65A 1XC7A 3NEJA 3ODGA 3ONWA 4DLYA 4DZRA 4D6PA 4UTVA 5LIRA 2FEMA 3D4OA 2ETVA 4NS4A 1DJLA 4BX2A 3IDAA 2I03A 2IDKA 2GEFA 2IW1A 4DCNA 4MJLA 1J8YF 3RVNA 2DPGA 2XD4A 1XZBA 1EAYA 1PKEA 3E7WA 2DHQA 4D4IA 3A7DA 3PQ5A 5KTPA 1NMEA 4CTJA 2JJ8A 1IJKA 4H59A 3UGJA 3LQQA 1X9GA 4YRMA 2W90A 2E3JA 3DVLA 4CM9A 4ETMA 4GBGA 3KLMX 4JVLA 3E70C 2ZJ2A 2UYYA 3TLMA 2NZ2A 2FP4B 4HGOA 2AZTA 2NUAA 3TBFA 1VBFA 3MT0A 1M8KA 2R8YA 3QKTA 1TVCA 1N0HA 3QVTA 4KIUA 1F0NA 1E3LA 3K1AA 3QLVC 1GUYA 3GWZA 3HJNA 3HKDA 1CDZA 2FGKA 4UEQA 1JEYA 3NW9A 3ZHQA 2GARA 2OTCA 3JAKB 5FRDA 3FCYA 1W9MA 3DEJA 2NYAA 1KIMA 1RI5A 2XEXA 3SX2A 2VXOA 3ZQKA 3BK1A 3IURA 1NVWQ 3SLRA 3QEMA 3W8EA 1PRYA 3GQBB 2V7QD 3GFTA 4MROA 4OU4A 5ILGA 4G84A 3TIVA 4WGGA 2YY6A 2HK6A 3BBLA 1JQAA 4JBNA 3UPDA 1QHEA 2PGDA 3LVFO 4QQKA 4YPFA 4CR8A 4NATA 1L7PA 1E5QA 2K6GA 4QDJA 3MCAA 1E3QA 4XX0B 1C29B 4RV9A 3GJYA 3GGCA 3ONNA 1CP2A 5F7OA 2GN1A 3U4DA 5HIIA 4MA5A 1RWWA 3OX2A 4QYWA 4ZHQB 5BR1A 5CG2A 4LYGA 5K0BA 2R6AA 1U2DC 2HL6A 2PZAA 2P91A 3B6ZA 4HK4A 4LRWA 4PCAA 5FPQA 4YHHB 1L3BA 4S1NA 3AVOA 1NE7A 2JARA 2JF0A 4WHMA 2OM2A 4R8SA 3ZNNA 1YCDA 3DYIA 3D8BA 2HCTA 3VAYA 5BWLA 1VJCA 4XVUA 3IP6A 4JROA 4QOJA 1KZ9A 4OHBA 2N42A 1H85A 1T3GA 1Y4DE 1D03A 1XLTC 3K72B 4LJ6A 4HG2A 3KKOA 1PJ8A 3M2PA 5F2OA 4B6GA 1FXSA 2Q8QA 1TECE 1JDVA 2XTMA 1D2CA 3O2JA 4D25A 5TARA 1TEZA 2HJ9A 1MX5A 5LD2C 4IGIA 1UZMA 2ZRLA 3UH1A 5L3QA 4HNUA 4AQDA 1JMYA 4XPZA 2J5KA 2WM8A 3DMDA 1K7EB 1X70A 4X6UA 5DHPA 3KHSA 5KTNA 5DM70 4FZ3A 4C6TA 4F2DA 2VA8A 3AL2A 3K35A 5T4EA 1C0KA 1JQKA 2ABWA 1QC5B 4GEGA 4QE3A 2IZ6A 4UASA 3FKJA 4YRFA 1BCRA 1J2JA 2H5LA 1XQ6A 2RHLA 2WK1A 3TTUA 4AJKA 3ED1A 2QU8A 4EG7A 3DC2A 5FR2A 2WLSA 1V8PA 4A91A 3LPNA 4O1IA 3JQ7A 4PSDA 4BFZA 2CUNA 3VGPA 1JG3A 4ZXFA 5CM9C 4AJPA 4P4TA 2QV0A 1T6ZA 1JECA 1RIIA 3L82B