5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
4W99A 3O38A 4BS9A 4R1NA 2GN4A 4M55A 5KJ6A 2DLDA 2JD0A 2C59A 3K6JA 3M1AA 2VOJA 1SEVA 4WNCA 4FC7A 2B5VA 3GVXA 1ZBQA 4P8RA 3DBRB 4A0SA 4BQPA 1LSOA 4R1SA 1T2FA 4DLLA 3P19A 1XEAA 4NK4A 2FWMX 5CDTA 3MJEA 3PGJA 3GR6A 2UAGA 4RQUA 2CDCA 3DZBA 3Q3CA 1LLDA 1OC4A 4NQZA 3O9ZA 4R9RA 1C0PA 5JO0A 3AY6A 1HDCA 4NFSA 4KDEA 2RAFA 1XQ1A 1DIHA 1B3BA 1H93A 1VL6A 1YQGA 1HE5A 3AOGA 4BIIA 3AJRA 4E31A 1BDMA 2X5JO 3JQ7B 4TROA 1N2SA 3NDIA 4I8XA 4IUYA 4OO3A 3BMCB 4PGFA 2GGSA 4S3MA 3TL3A 1DFHA 3GRKA 2DTDA 3GLQA 4ALNA 3D4NA 4BKUA 3HSKA 1U2GA 4IDDA 4RF5A 4GL4A 4E30A 3QWBA 3W4JA 3ZHZA 3PYXA 3TDKA 1LSJA 3ASUA 4GSLA 2ZB3A 4CM7A 1ZIDA 3HJAA 4L8VA 3MJSA 4DIBA 4N5NA 1YDEA 3U4DA 4WKGA 2HCTA 1ZNQO 4J0EA 3LC2O 2Q46A 3GVCA 3K92A 2C2XA 4G65A 1BXGB 4MVJM 2WSBA 1CQIA 1HLPA 2EGGA 4URFA 2X0NA 4DWVA 1XQ6A 2X9NA 3OBBA 4OOFA 3TFOA 4IINA 2UYYA 5BSEA 2NVBA 1DFIA 3O8QA 3IDSA 4I9UA 5DBFA 2VUSA 2JHFA 3D64A 1YE3A 3DQPA 5JAQA 4CM4A 5ICSA 3WGTA 4KWIA 5EL0A 1GV0A 3IIEA 3VZQA 2Z1MA 1IZ0A 3DOJA 5I7VA 3OJ0A 1YO6A 3F4BA 3KSUA 1JKIA 4WCFA 3JQFA 1Y7TA 2VRCA 4I08A 1Y6JA 5B4TA 3MOGA 1A7KA 4MVJG 3TRIA 2X1HA 4W7HA 1KIFA 2DKNA 4R4JA 1EEHA 2V65A 3H4VA 3U0BA 3VZSA 2EP5A 1TT5A 5A3JA 3PQFA 5AXBA 4UAGA 2CFCA 4AJKA 4YT4A 2X7HA 1YL5A 5CPBA 2IRWA 3VZPA 1R66A 1X13A 2HDHA 4GMFA 4L4SA 1QKIA 3QVTA 5JDIA 3ZDFA 4DBZA 3K96A 5JAZA 3KYDB 1F8FA 2EKQA 3DBHA 4LW8A 4RDHA 3I9KA 4FGSA 1A71A 1JKFA 3IUPA 1LLQA 2BI7A 3L9XA 4QFDA 1R37A 4NBUA 3VVBA 1KERA 2ET6A 3MEQA 4GLOA 2EF1A 4CMBA 4GKVA 1QORA 4M49A 3FNHA 1B8VA 1WWKA 1U3UA 3GHYA 4XCVA 4U6SA 3RWBA 5JS6A 5G0TA 3GRPA 3ZNNA 3GEGA 1E3WA 5I7SA 2ZB7A 2EG9A 3JQEA 3O03A 1N9GB 4DYDA 4ONEA 3UFXA 5THKA 1W73A 1EBFA 1Q0LA 3GVHA 3UICA 3ZNPA 1VJ0A 3S55A 4NR0A 3GGOA 1KEVA 4WJZA 1GZ4A 4HFMA 1WZEA 4CMIA 4QUKA 3HNPA 3KLMX 4E5KA 4E5NA 4ZJUA 4G5HA 1KC3A 3N74A 1J6UA 5HA5A 3I9JA 2E48A 3W4IA 2AXQA 1ZKMA 4IZIA 4Z6KA 3W6ZA 1UR5A 3CIFA 1PZEA 2AW5A 2JCVA 5HTOA 3LLVA 4ALKA 5EQFA 4GX0A 2DBVO 1ZSVA 4Z9YA 3ZWPA 4J4BA 3IL2A 1M6HA 3HFSA 2BFPA 4NBTA 2BI8A 1SOWA 5IJZA 3GAZA 4L75A 3WGOA 2IEDA 1IZ9A 1NPDA 2B5WA 2FHSA 4AJPA 4K6FA 4BGEA 2G76A 3B20A 1BHSA 3PWKA 3PXXA 3UAGA 3U09A 2R2GA 4FFOA 4GPD1 1DRVA 2ZB4A 4ID9A 4QQRA 5JAIA 5KJCA 3NT2A 1GR0A 3TZCA 3WJAA 4DVJA 4HBGA 5ENVA 3JYPA 2J3KA 1EVJA 4A5OA 2HRBA 3G1TA 1EQ2A 3F1KA 2YHIB 3ONEA 4XGKA 2A9FA 1MB4A 1P77A 5TC4A 4Y6PA 1PQUA 5L95A 2VZ0A 4BV9A 1KY5A 2JJYA 4RDIA 3T4EA 4IQ0A 3QV1A 4MIEA 3H2SA 2GYYA 4RQTA 1UXGA 5A03A 3TZHA 4XWYA 1QMGA 3HFGA 3KVOA 1D3AA 3IJPA 2CDBA 3M1LA 3OMLA 4IMPA 4YQYA 5A05A 5KWEA 4BNZA 4LMPA 5ER9A 4XRRA 2OZPA 1N5DA 3DO5A 3OJOA 3ZZNA 4B3HA 4IJVA 3KSDO 4IM7A 4ROSA 3RBXA 2AE2A 4UUMA 3KXDA 2DFDA 1YWGO 3SEFA 4R1TA 1SB8A 2HJRA 2DTEA 3DONA 3QLJA 4NBRA 5L4SA 2AEJA 1DIGA 4YBZA 1DRUA 4IDBA 1J5PA 1K89A 4OYRA 3U62A 3WR5A 2HK9A 1PGOA 3EY4A 4J7CA 4QO7A 4TSKA 3S8MA 5JCXA 1N1EA 3DBRA 4E0BA 3VOSA 1EVYA 1MV8A 2OGUA 1NVMB 1PSDA 3T7CA 3GEDA 4KUGA 3QIVA 4E6PA 1BVUA 4J7XA 1G1AA 3D0OA 3GMSA 4CMEA 3PFWO 4I9NA 1JN0A 3KOUA 5B37A 5T67A 3B1KA 3MCVA 3C24A 2NU8A 4EEZA 5IG2A 3BAZA 4CM5A 3E6AA 4RORA 5AVOA 4PVDA 3HB5X 3JQ7A 3WSWA 5AQ1A 3GDGA 5HWSA 4MJLA 3BMCA 3FNFA 3OH8A 1Z7EA 3BTVA 1U5CA 1VJ1A 1JVBA 4LCJA 1NQTA 1NPTO 4IXWA 1UP7A 4JNKA 3TSCA 1TLTA 3DOOA 1U3TA 4IGFA 1NHWA 3GK3A 5L4LA 3EUWA 2IYPA 3P2YA 4LCEA 5TNXA 4BUCA 8ADHA 1R0SA 5K6AC 3JD1A 4CLOB 4OKIA 1VSUA 1I36A 2WD8A 4DIOA 4JQCA 4J6FA 2P4HX 4B4OA 4YCAA 3T4XA 4D7AA 3PZBA 1LRJA 3ITDA 4XB1A 4GGPA 1IOLA 2DVMA 1P1KA 1OAAA 1HT0A 3U4CA 4OM8A 1Y1PA 1B0AA 5EMHA 4YAGA 3AOEA 4Y8VA 3TWOA 1OOEA 4DA9A 3C7CB 5TJ9A 2X58A 3ZV4A 3I6IA 5B4UA 3Q11A 3UKOA 2ZYAA 1ZMTA 3QWIA 2P2SA 3DL2A 3WS7A 3P5SA 2VCYA 4DLAA 1XHLA 1ID1A 3TOXA 3TN7A 5A5FA 9LDTA 1E7MA 1E7RA 4FCCA 4WPGA 3LT0A 5L7WA 3BMNB 2GSDA 2H1SA 4NBVA 1I2CA 4RZHA 4MP3A 2B36A 1ENPA 4TMFA 5JC1A 1UP6A 2G1UA 3GPDG 3X2EA 3DC2A 1R4NB 3E9MA 3R3SA 2HMUA 3GZNB 4U0KA 1CRWG 3BTOA 5DDIP 5TJHA 3ZU5A 3WYEA 1W6UA 3F5SA 2CSUA 5AXAA 1DC5A 4BB6A 5C37A 3ANLA 3B1JA 5I9NA 3SVTA 1R12A 1P0FA 2PZMA 3SJUA 1M67A 4NK5A 4AJOA 2Z95A 5DP2A 4RJTA 1YONA 1U8FO 3BZUA 1ISIA 2W4QA 4K28A 4UVGA 5L45A 1ZVMA 2VRCD 5BQFA 1GD1O 4HWKA 1UJMA 3KYDA 2X22A 4BQRA 5EERA 3GUCA 3PLNA 2BD0A 2UVDA 3GG2A 3DXFA 4X54A 1T26A 2NM0A 2OP0A 2OXIA 2JCXA 5HM8A 1XGKA 4R69A 3ZW9A 3JQAA 4YEDA 2YDYA 1YH3A 3NT4A 1U7HA 3DTYA 4ZRNA 7MDHA 4ZQBA 3GOHA 4J0FA 3UW3A 1PEDA 1C0LA 4DUPA 1JVSA 1DSSG 5TRTA 1E6UA 1N9GA 1GADO 4BGUA 3TQHA 4MPDA 1UXKA 3AFNA 1ISMA 3F3SA 1EE2A 3ENKA 4A03A 2JAPA 5IDWA 1I01A 5CFZA 2B69A 1ZXBA 2PA3A 3DMTA 3MJ4A 3TOZA 4F6CA 1B14A 3QA9A 3PQEA 4DTIA 1NAHA 4M54A 3KUXA 4QXMA 5EQDA 5TT1A 4CMAA 1C3VA 2R00C 4HNGA 3LC7O 5FF9A 3K2EA 2DUUA 4CMCA 5JC8A 1GY8A 4RV9A 1NFFA 2ZCVA 4BO6A 1GU7A 5HBRA 2PZLA 3WGIA 4JROA 2Y67A 4YJHB 4BNTA 1HLDA 5I8ZA 3Q6IA 1DC3A 1ORRA 5G4KB 4BO0A 1KETA 3KO8A 1E1KA 1I8TA 5BSFA 3LC1O 4B8ZA 4DQUA 5B1YA 2GR9A 1ONPA 3KV3O 4OQYA 1S7CA 5FYDA 3CMCO 1XLTA 4BKQA 2I65A 2B0JA 1BWSA 3I9NA 3AU9A 1JWBB 3IMFA 3IAHA 4OXKA 3L6OO 4XQ9A 1X7DA 1ZSNA 5JO9A 3TPCA 1ADFA 4BNGA 4F6LA 1EDZA 4DPLA 4GQAA 4BNVA 3H9UA 3ZWMA 2YHIA 4CM4B 2NACA 4TRRA 1JWAB 2HMWA 2O48X 2VTDA 3VPXA 3G1UA 4Q3CA 4UULA 1NQOA 1EQUA 5H83A 5IXYA 2TMGA 3LLSA 1PU2A 4BGVA 2IZ1A 4E3ZA 1RPNA 3GA0A 2O4UX 2Q1WA 4J1QA 4MDHA 5KJ1A 5LC1A 2PD3A 3N58A 4RLHA 1KEWA 3D3EA 1C1XB 1GYPA 1P74A 4IS3A 4K26A 1K6IA 4PLWA 3RBVA 3H9QA 3KEQA 1ZUD1 5CHEA 3GG9A 4KMSA 2O3UA 1F12A 4LISA 1EUDA 1XYGA 4J4TA 3ONFA 4OSPA 2PZKA 5F21A 3LVFO 4RF4A 4BNIA 4B7XA 4L4RA 1DC4A 2X6TA 3CH6A 4ND3A 4DC0A 3G79A 3L6EA 3PYMA 3NJ4A 1S6YA 2HU2A 1SBYA 4J9UE 2O7SA 4R01A 2BFAA 1JKJA 2JD2A 3OIGA 5COQA 3CE6A 4AVYA 5CDYA 3OSUA 4MIOA 2FSSA 1GCUA 3IP3A 2Y0EA 3D5TA 1KVTA 3IS3A 5EESA 2ZQZA 2AQ8A 3ULKA 3V2UA 1QLHA 1UAYA 2J5QA 1BTOA 3FD8A 5ADHA 2PR2A 2B4TO 3PDJA 4EJMA 1GYQA 3S2IA 3GDOA 1LLCA 3JCZA 4R68A 4YAKA 1O89A 3ROPA 4TVBA 4BO1A 4AJNA 3DTTA 3IKVA 4AJEA 1IHXA 5JNLA 4FOSA 4IJUA 3UN1A 5TLSA 3ZU3A 1PIWA 1WPQA 2BKAA 2EW2A 4TKLA 3WXBA 3DOCA 2SCUA 1HE4A 3U3XA 4E21A 3ZWAA 4I5FA 3E5MA 2PFGA 2CDAA 4YRDA 1H0KA 1KYQA 4UVHA 1XKQA 4D3DA 2F1KA 3JQ8B 1ZK4A 3R3JA 2VUUA 3GGPA 1VPDA 3AUTA 4CV2A 3JQCA 1B3RA 3W8FA 4E13A 3D3WB 2VHYA 3OETA 3B6ZA 4Q3AA 2WYUA 2CVOA 2FRDA 3ASVA 5HS4A 1Q0QA 2Y1DA 1UUFA 1FDWA 1A9ZA 3AFMA 4CLOA 1RM3A 2Q1UA 1QYDA 3LSYA 4XJTA 5H81A 4EBFA 1Z75A 4JJIA 5C7IO 3K31A 3AI3A 4ITUA 1AHIA 2I6TA 3NJ8A 1O95A 1ZK3A 3I3OA 4BNYA 3NT5A 4PRKA 4CQLB 1HDRA 1FXSA 2PLAA 3LT4A 4ZQEA 4HX5A 4HXYA 2E49A 2B4RO 3L4SO 3K2BA 4B79A 2A4KA 1IE3A 3RFXA 3WFIA 3FWNA 4J90A 4QO8A 2C82A 3BMOB 4LRSB 4WNIA 5IZ4A 1UZMA 3KBOA 3WGQA 4MKRA 5KKCA 1HE3A 1RM4A 3BMNA 1EFKA 3B70A 1U4OA 2BH9A 1E3LA 1ENZA 4Q3EA 1A4UA 2I76A 2PH3A 3V5NA 5IZCA 1WDKA 4CLHA 1RJWA 1R4NA 1YOVB 5CDSA 5KNLA 2IE0A 3GZNA 3ON5A 5COBA 1ONOA 4IS2A 5JDCC 1YB5A 4N5MA 3DEYX 4O5OA 3C3XA 4AJJA 3RFVA 4XDYA 2CF5A 3HDJA 3QHAA 3RU7A 2TMDA 1LA2A 3GDFA 3C7AA 2X23A 2XOXA 2Y93A 3QVSA 5F5NA 1U2DA 3NTOA 3JQBC 1YXMA 3FTPA 4Z0TA 4B3JA 1DOHA 2VHXA 3OP4A 4J91A 4FJ2A 3UGKA 1HDOA 4XGNA 1WXDA 3PQDA 1LQUA 4BMVA 1TI7A 3FI9A 3K9QO 5TGDA 4YR9A 3DMYA 3QRWA 4RVFA 3WNQA 1I3NA 1LLUA 2DPGA 1AN9A 1P45A 4XR9A 1DIAA 4GX2A 1Y5MA 1RKXA 4EUEA 3FTNA 4R1UA 4TZKA 1N8KA 1ZXLA 1DPGA 2P5UA 4YT8A 1DIRA 2Y05A 2Y0CA 2ZYDA 3U4IA 1UXJA 1F8GA 1E6WA 1PS0A 2E6UX 4I9HA 2NWQA 3JYNA 5F3RA 5GZ1A 4XR4A 1V3UA 2P91A 3RJ5A 2FPPA 1BW9B 3M2TA 1VJTA 3ZN2A 3PJFA 4PLVA 3SC4A 5DN9A 5KVQA 1V6AA 2HK7A 3WBFA 4CV3A 3RUIA 2DC1A 1P1HA 1GCOA 3R6DA 2ZTUA 1MC5A 3NEPX 4MVJA 1Z74A 4LK3A 2ZTMA 2FZWA 4DMLA 1PJBA 2Q4EA 1NWCA 5BSGA 1E3IA 5THQA 1Q7GA 3LZ6A 4W7IA 3R0IA 4JX8A 4BO7A 5CEFA 4U5QA 4YJHA 1JQBA 3TL2A 3SX2A 4NJOA 3HQ4O 2H9IA 1E92A 3IC5A 5G4KA 2ILTA 3RCBA 4DLBA 5BR7A 2GF2A 5DCYA 3ZWCA 3FSRA 1U4SA 1I33A 3BXXA 5MDHA 2QYSA 2P9EA 4PLYA 5A04A 1KEPA 1IHYA 3DHEA 4J2HA 5GMOA 3BTSA 4H7PA 3RD5A 3IQDB 2J6IA 4EYEA 1DO8A 1MX3A 1ULUA 2I67A 1SZJG 3U49A 4FFRA 3AUUA 4XZ3A 2QRLA 4RVHA 4ZA2A 4YWJA 2I5PO 3ITKA 1NX6A 3VZRA 3GT0A 3RQSA 1PJ2A 1WMAA 5C5IA 4EI2A 5C3MA 4M8SA 2O3TA 2NADA 4NIMA 2EJVA 1GTMA 2W2KB 4D79A 3JQ9A 1W0CA 3H7AA 3FNEA 3GQVA 2QZ9A 3MTGA 4JN6B 1NFRA 1C1XA 1FJHA 1HYGA 1ISHA 1X0VA 2NUAA 4H16A 4YTEA 4CV0A 3S2GA 3H3FA 2NU6A 2X5OA 5I8WA 5ENDA 1DC6A 4N5LA 3BIOA 1WLYA 3PRJA 1DJQA 2YV1A 4F3YA 2QQ5A 2UDPA 5T8KC 1XR3A 3E8XA 4KUHA 2C5AA 2V6GA 3GN1A 4CL3A 5H82A 3UCXA 1MA0A 1E7WA 3OJFA 1UXHA 3FR7A 4XYEA 4TZTA 3WYBA 2VRBA 2OMEA 3H3JA 1Y8QB 2V6MA 3H9GA 1XCBA 2AEFA 1T25A 2YFQA 3HN7A 4YB8A 5JYDA 2FR8A 4D0SA 3JQAB 3ST7A 4NJMB 3GNQA 4GGOA 3WMXA 1XDWA 2A35A 4IIVA 1E7QA 1Q0HA 4FQ8A 4PG5A 2JFFA 4QEDA 3RUHA 2C54A 3PIDA 4E5MA 4DXHA 3FBTA 2Y1GA 3DDNA 2WWRA 2RBEA 1IULA 2NU7A 2D0IA 4NH4A 4O0LA 1KC1A 3I6QA 4A2CA 1PWXA 1UAGA 1YL6A 1FF9A 2X4GA 3CUKA 1C0IA 4PZEA 4WLEA 1LDYA 5A9RA 2Y66A 3OQBA 3I52A 3ETGA 1D4FA 1U28A 5IN4A 1J4AA 3JQ8A 1BXZA 1RM5A 4BO9A 3FRJA 3H65A 3F9IA 4YACA 1GEEA 2YHUA 3WQSB 3D3WA 1OMOA 1P0CA 4RVUA 4JJGA 4PZDA 4PZCA 1Q1NA 3P2OA 1YS4A 5JAMA 5HRUA 4QFCA 5IXSA 4AJ4A 4F46A 2NTJA 4B4VA 1KVSA 2ZJ0A 3AY7A 2YW9A 4HY3A 1PGQA 1PZGA 4KOAA 4L76A 4F45A 1AXGA 3F6YA 1FDSA 5A4DA 3EGOA 4XRGA 3QJ5A 4EITA 2LDBA 2CD9A 3UUWA 3E9QA 3JD2A 4D44A 2YZ7A 4BO3A 3HDYA 4L9RA 3GVIA 4G81A 4E2WA 2NQTA 3B1FA 3L4BC 4TVOA 1L7EA 4MO2A 3N7UA 4EEXA 3RC9A 2FR0A 1NASA 4CQLA 4R5HA 1LDEA 1HXHA 3WQRA 2QHXA 4H3VA 2X0RA 1VE9A 4O1MA 2UV8A 4QX6A 3RSHA 1NR7A 1X1EA 4YPOA 5K9ZA 3BMOA 3GPIA 1E7YA 1PR9A 1PWZA 5EPOA 4DRYA 2DFVA 4U0JA 2CVZA 5G0WA 5KTKA 3VKUA 4R54A 1CDOA 4ZD6A 1NQAO 3WMWA 1JTVA 2D3TA 4ZHSA 2ZKLA 4PLFA 1ADCA 3DZFA 1YOVA 3COSA 2D8AA 4D45A 4OQZA 3A06A 1PJCA 3EHEA 1TEHA 4CMGA 3QVOA 3SXPA 4RLSA 5ER6A 2DAPA 1TB4A 2Z1NA 5CDGA 4Y67A 5CEEA 4MVJH 1B8PA 3WNVA 1ADGA 3WLFA 4D3FA 1ARZA 4PG6A 4XQGA 1UDAA 5J23A 4PLGA 2EGHA 3ZI0A 1UDCA 2D1YA 1JDJA 1I0ZA 4YAEA 9LDBA 2H6EA 2IZZA 2XF8A 3RFTA 4RVDA 3LQFA 1VRWA 4JIGA 1LBEA 1WDMA 2J3IA 4NFHA 4CLDA 1QYCA 3LF2A 4XX0A 2NSDA 1NR1A 3CMMA 2FPIA 1V9LA 2GO1A 1R15A 2VN8A 3ANMA 2ZB8A 4RVSA 4RPGA 4KQWA 1QV7A 2IYOA 4MVJI 4Q39A 1K5HA 4WOKA 4P4LA 1B2LA 4GLLA 3VVCA 7ADHA 2VHVA 1BW9A 2W2LA 1I30A 2AEMA 3OHSX 3AWDA 4HP8A 2OP1A 2VQ3A 4E5PA 3GMDA 3HWRA 1GDHA 3EDMA 4XYLA 4WLNA 2WMDA 3DB2A 4UUNA 3FCOA 3WGZA 3O4RA 2ZJ1A 2ZQYA 4HV4A 4AJIA 1HEUA 2PWZA 4XGIA 3WGYA 1DHTA 1MXHA 4E4YA 4PG8A 1NWHA 2GPTA 1MXFA 1QYXA 3CZRA 4OOEA 5I9LA 1G0OA 2EIHA 1ENYA 1N7GA 5K0ZA 1NAIA 4Z3DA 5DZSA 1XA0A 5GY7A 2GN6A 4CUZA 2A92A 4OHUA 1P1IA 4YAJA 1M75A 1E1MA 3KLPX 3QQPA 2JKVA 3OEWA 4FFNA 3H9JA 3W8DA 1ZH8A 4CMKA 1ISJA 4MVJD 4DMMA 1I32A 4IZHA 4BNLA 1YB4A 2AHRA 4INAA 3WQQA 4M87A 1ZW1A 1K0UA 2Q2VA 4XDZA 2GLXA 3I9OA 2EERA 4FR5A 1KS9A 3H5NA 1QV6A 1VKOA 1L1FA 1Z7BA 1HETA 2RHCA 5FI5A 4MIYA 4JCOA 2RIRA 4OGWA 3SC6A 1OBFO 2CMDA 2Y68A 3LT1A 3VTFA 3PWSA 1IYZA 3DR3A 3C85A 4J1NA 2EV9A 1LDMA 4FFMA 1RYEA 4O6VA 2W2KA 5JMPA 3RUFA 3ZWWA 2EHDA 4B4UA 3GEMA 4BO4A 4XKJA 4ZQHA 2W8ZA 4KQXA 3WG9A 2B37A 1HDXA 2R6JA 5HS6A 4FB5A 5ITVA 3WSVA 5C7OO 3EZLA 3JYOA 4BOYA 3EK2A 2O3JA 1NP3A 2DU8A 1MC4A 3UOGA 2DBQA 4YXFA 2ZTVA 1DIBA 1I2ZA 4AJ2A 4BKRA 2EP7A 5JY1A 4JLWA 3V2GA 3ZNOA 3AM3A 2GERA 3BA1A 3HZZA 5LDGA 1ISGA 4IPTA 5IDYA 2J5RA 2PGDA 1B26A 1QR6A 1I5RA 2VYVA 2QYTA 3NKLA 4D46A 2X9VA 3DFUA 1A9YA 2O23A 1E1NA 1VL0A 1XU7A 4KUEA 1J49A 1Y8QA 4W9NC 4R3WA 3UCFA 4L73A 2HAEA 1NVGA 2Q1TA 4XQEA 4NJMA 4J16A 2LDXA 3WICA 2D5AA 1H2BA 3BYZA 4BO8A 5DF1A 2QZZA 2XXBA 3MJTA 3V8BA 4CV1A 1VSVA 4LVUA 5KJEA 5KOIA 4TWRA 4WEOA 3ZV6A 5DBGA 3A4VA 1TT7A 1GPJA 5A9TA 2OO5A 1O0SA 2AG8A 3FHLA 3X2FA 1DJNA 4GVXA 4BKOA 4JGBA 4IDGA 4NU5A 5JYEA 2P5YA 4IMRA 4OAQA 3WIDA 1E7SA 5L7YA 3G49A 1YB1A 3UHAA 4CPDA 1DFGA 4CLXA 1DDOA 1L7DA 2EW8A 2VUTA 4ALIA 2WD7B 2GN9A 3PWZA 1BVRA 3QE3A 1Y81A 2W90A 2C0CA 4OL9A 3VTZA 3F1LA 1H6DA 3K8ZA 1ZFNA 3MOIA 3Q9UA 4RPKA 1K2WA 4GI2A 3AW9A 1XELA 5F1KA 1H94A 2BGLA 3AM4A 4LMRA 1SB9A 2FPGA 2NLOA 3I4FA 3DBLB 1O5IA 5FEUA 4XYMA 1WNTA 1X1TA 2PGLA 3JSAA 1CEQA 1EDOA 1EFLA 1PS8A 5G2OA 2E4AA 2JFHA 1HYHA 2VWGA 3PI7A 3Q1LA 1ZMOA 3WYCA 2V7PA 1I10A 3D5QA 2PY6A 2O7QA 5KVSA 5TS3A 3WWYA 5A06A 4PLCA 3PDUA 1HWYA 1KEUA 4CM6A 3INRA 2VNAA 4Z0HO 4EJ6A 5LCXA 1Z82A 3PJDA 4JK3A 1KBZA 2C29D 4UVEA 2AG5A 3WWZA 2E82A 5JPIA 2PV7A 1Q7CA 3GZ4A 1LU9A 1H6AA 8LDHA 3UXYA 3ZGYA 1QRRA 4W82A 3VDQA 1PJTA 1Y8RB 2I66A 2YQ5A 1ISFA 1G6KA 1OC2A 1P3DA 1EK6A 2NU9A 4NHEA 3PJEA 1NPYA 3PPIA 1U7TA 2O50A 4MKXA 2OOSA 2Y99A 1KOLA 4YDRA 4YVFA 4MVJE 4KP7A 1ZK0A 2OBNA 4UUOA 4EDFA 3E5RA 1SNYA 1JW9B 4PLTA 1M66A 3PHHA 3JV7A 4EGFA 4PN3A 3FNGA 3HG7A 2PKQP 3JQFC 4WCFC 3GN2A 4Y6RA 3NDJA 5L9AA 2AE1A 5BSHA 2BFOA 5A5EA 1RM0A 1NQ5A 1PL6A 3Q9NA 2DBZA 4CMHA 2OUIA 3NX4A 4AL4A 2O3SA 4L0QA 4CM9A 2IXAA 2JHGA 1SCUA 1V3VA 1ENOA 4I5DA 1FK8A 1XIVA 4K9DA 4OXYA 3WJ7A 4FFLA 3NAQA 3F46A 3ZHXA 1T1RA 1P31A 1HKUA 3W8EA 1Z6ZA 4YJDA 3NTQA 1YGYA 1F06A 1ZJZA 1E3JA 3KETA 1YJQA 3AUAA 4YJGB 5JDIC 2Q1SA 1ONNA 1VKNA 4A73A 4UVIA 1UP4A 1QLJA 1G0NA 4LVCA 1F0YA 2OBYA 3W6UA 4GKBA 1QXSA 1LTHR 5CPFA 3KRTA 3GF4A 4IIUA 3W1VA 1AHHA 4BO5A 3HHPA 3PFFA 1N1GA 2Y1FA 4UUPA 1BG6A 3QP9A 4W6ZA 1GAEO 3FN4A 4BHTA 4XA8A 1CYDA 1P1FA 5K6AA 3BTUA 2OL4A 5IF3A 2IDZA 4NBWA 3PHJA 4I5GA 3D7LA 1ZO8A 1E6EA 4PVCA 2O3QA 4N18A 1AUPA 3VAZA 1AE1A 2DT5A 2HO5A 3ZHYA 2GCGA 1GEGA 2WYWA 2W2LD 4ZN6A 3NGLA 5JSFA 4U6QA 5I7EA 1UDBA 3AI1A 1PZHA 2PKRA 2DQ4A 2BELA 4CL8A 4RGBA 4R5MA 4ND5A 3RC1A 5DNAA 2Y0DA 1VLLA 4B4WA 4PFJA 3GGGA 4E2XA 2HQ1A 2HJSA 3I23A 2YV2A 2NVUB 2Q99A 1Q2XA 4ZGWA 1ZEMA 3G17A 1HZJA 3IKTA 4U8GA 2DM6A 5KJFA 1ZJYA 1MGOA 3RI3A 1LXCA 3PHGA 3RBZA 3DHYA 4II3A 4TKMA 4LSMA 3RKUA 4CUKA 3P7MA 2PKQO 4H15A 3MJCA 1WW8A 4N54A 4IQ8A 1PJQA 1NFQA 3UH1A 3CZMA 4DREA 3GAFA 2VWHA 1FDTA 3V2HA 3HB4X 3OEYA 2QG4A 5ILGA 3WDSA 2P9GA 2H63A 5L40A 1PJ3A 3A9WA 3SLGA 3RU9A 4RPHA 3K30A 4PG7A 4CUJA 1GQQA 2Q45A 4I5EA 4OMUA 3SLKA 2AQHA 3WBBA 4KTTE 4J1TA 1PJSA 1NM5A 3C8MA 3RC7A 3JTMA 2Q2QA 4J1SA 3AM5A 1OZAA 3ZU4A 1PGNA 4GSKA 5JW6A 4M89A 2YDXA 2VNSA 2C20A 5TT0A 4KWHA 1O9BA 2BMAA 3QVXA 2YUTA 1B16A 4NFYA 2PD6A 2UUOA 4R16A 1U9JA 4D41A 4HFNA 2WYVA 4YRAA 1SMKA 1XU9A 4P22A 3VH4A 3ETDA 3TF5A 1T2AA 2BRUA 2VYVD 3LYLA 1WVGA 3D4OA 4WGGA 4DGSA 3TFQA 5TX7A 3GNSA 1UXIA 3BHIA 4UEKA 4FN4A 4YQZA 5FWNA 1Q7BA 3DFZA 4NZ9A 5JMWA 4J7UA 2R00A 1ZZEA 2GZ2A 2GZ3A 4NI5A 3JQAD 1V8BA 1GV1A 3MWDB 3PVZA 2WTBA 5IDQA 2WD7A 3KTDA 3H2ZA 2B83A 3MTJA 3STHA 3JQGB 1A7AA 1M2WA 5DOZA 4CR6A 1JLLA 4AJHA 2BLLA 2VYNA 4CMEC 3K73O 4IDFA 1P33A 4RF3A 2NQ8A 4MKZA 4XJSA 3ADPA 3RIHA 4C7JA 5TSDA 1UH5A 3ZWXA 4JBGA 2ZATA 3DBLA 4P4NA 4J3FA 3EAGA 1YKFA 3KM0A 3VC7A 3KZVA 5EN4A 4PLZA 1BXKA 5KCZA 4E32A 1E3SA 4PG4A 4S1VA 2C2YA 2PNFA 2D5CA 3ONDA 4RPJA 4FGWA 4IJWA 4CM3A 1O8CA 2O2SA 4B8WA 4CQMB 3OQ1A 2HSDA 4WCDA 2PGJA 3QWFA 1IB6A 1PQWA 3HN2A 4XQCA 2P9CA 4QECA 1E3EA 3OIFA 1WZIA 1CF2O 1KY4A 4FD3A 5DCUA 1Y8RA 1X0XA 1GL3A 4K6CA 3QY9A 3ZWBA 3F5QA 3AOEC 4FC6A 6LDHA 2X9GA 1A5ZA 3VPSA 3RJ9A 1PX0A 1ZCJA 4ALMA 3EVNA 4Y9DA 4FW8A 4NU6A 3HDQA 1EUCA 3ZNQA 1VC2A 4U7WA 3JD4A 1RYDA 3GNTA 1U5AA 1LEHA 4JP3A 4GAEA 4Z3KA 5I7FA 1B15A 1U3VA 1OI7A 2VTEA 3K5PA 5U4QA 4ZICA 1E77A 1CJCA 1GQ2A 1T4DA 1UZNA 2J3HA 2FSVA 3QW2A 4YJFB 1O6ZA 5U9CA 1H6BA 4MVJF 1YQXA 3ZV3A 1BGVA 4QT0A 1T2CA 1NYTA 3ZWVA 3TZKA 1QSGA 1R0LA 1R4MB 4ZRMA 4BGIA 4Z0PA 3I5MA 3PHIA 1U3WA 1HDGO 3SJ7A 5I9MA 3OQ6A 3VHRA 2X0IA 1U8XX 2OFPA 5JCJA 1GPDG 3T7EA 4RVGA 1I2BA 1AXEA 4LN1A 3IUSA 1X15A 1M76A 3MZ0A 2FY8A 3PEFA 2X5KO 3WLEA 4FDAA 4C7KA 4MINA 2UUPA 4XYBA 4BMSA 3KYCB 2RHRA 4YJGA 1Z45A 2Y1OA 4NG5A 4BKPA 5CEJA 1HE2A 2D2IA 1FMCA 3ICCA 2V6BA 2GASA 5F1PA 1N7HA 4BV8A 3VKVA 4BNJA 1GQYA 2EJWA 3GUYA 4M1QA 3OICA 4B3IA 4CM9D 2ZTLA 3HE3A 1LRLA 1T1SA 5B4VA 5L4NA 1D7OA 3WIEA 3U5TA 1HTBA 2C7GA 4MOWA 4Q3DA 1LDGA 2P4QA 1DBVO 3VH1A 1GUZA 3EC7A 2W98A 2PH5A 1SPXA 2OORA 2WEKA 3CEAA 3E1KA 3WX0A 1T2EA 4QTZA 1QYVA 1H9BA 3VH2A 3O26A 3W4KA 1LC0A 4CR8A 5MGBA 1R6DA 3EVTA 5L51A 2J3JA 4XIJA 2PD4A 1TA4A 4R9SA 2ZK7A 3DMTC 1R16A 1J0XO 4ZQGA 1LUAA 2C5EA 4FFPA 4DQVA 1CIVA 2BGMA 1C1DB 4AICA 1GZ6A 2FMUA 1DLJA 5DCWA 1XWFA 3JQDA 1QYWA 2V6FA 1GYRA 3WOHA 2HKIA 2VT2A 4A10A 3S2FA 3WB9A 1PS9A 2HLPA 1NTOA 3HADA 3RROA 1PJ4A 1WAMA 2NVUA 3ICPA 2EXXA 4MP8A 2GZ1A 3CKYA 4UREA 3HUDA 1YJ8A 3RUDA 5T5QA 4CLEA 3ETEA 4BNKA 2PTGA 3LF1A 5FFFA 4Y98A 1MFZA 1QG6A 3M2PA 2O2YA 1LDNA 1EMDA 1X7HA 2WM3A 5JDCA 4TRNA 4WUVA 4AJLA 2NNLD 4DBVO 1B8UA 1BDBA 4CM1A 1KVQA 4D3SA 3BHJA 4PRLA 3V1YA 5L53A 1C0KA 1TXGA 2ZIZA 4BVAA 3FR8A 3R1IA 5A9SB 4CLRB 2D59A 2AA3A 5U1PA 4WLOA 4FBGA 4LGVA 4DYVA 5GZ3A 1DLIA 2NV6A 1HRDA 2F00A 3JQBA 2HMSA 2Q4BA 2RH4A 3H8VA 3AY3A 5JBIA 5ES3A 2YYYA 5AXCA 3OJEA 3DBVO 1LSSA 4IGEA 1SOVA 1X7GA 4E2ZA 4OKNA 2FOIA 4DQXA 4LSWA 5JFOA 3A1NA 3Q2IA 3QWHA 3QVWA 1SEPA 2ZCUA 1IPFA 2YQ4A 3MWEB 4IY1A 4UEOA 5G0VA 2POQX 1ZK1A 3I83A 4CM8B 2NVWA 4ILKA 4XD2A 1YRLA 3OM9A 5KIAA 1I3MA 4II2A 4OJNA 3TZ6A 5IN5A 3CINA 3L0DA 4XB2A 2YY7A 2CNBA 2WJPA 3H9EO 3OIDA 4ZVVA 4ZU3A 3LDHA 4RO0A 1H2HA 3PK0A 1YDWA 3MJVA 2GD1O 1H5QA 1GZ3A 3PHLA 4JP2A 1V35A 2FP4A 3V1TC 5EINA 3FPLA 1LRKA 4Z9XA 5CG2A 1DAPA 1YQDA 4O63O 3U9LA 3JQ6A 1HL3A 4R51A 4RL6A 1AGNA 3F4LA 5DULA 3E03A 3C1AA 1YBAA 4G2NA 5JLAA 3UVEA 2JFGA 3DAGA 3ZWNA 2YFHA 3JQGA 5DOVA 4HKTA 2GUGA 3WTBA 3DHNA 2P68A 2EEZA 3H6KA 5CDUA 4PLHA 1PQPA 2AQKA 3A14A 3JYQA 1P1JA 1VI2A 4BNHA 4BNFA 3JYLA 5KVCA 4GX1A 4HUJA 1ADBA 2QRKA 1WDLA 3DAFA 3ZV5A 1NHGA 5LDHA 1BRMA 1ML3A 4N7RA 1EVZA 4EZBA 1JAXA 1JU9A 2ZYGA 1EUZA 1DHRA 4XYGA 5L3ZA 5DT9A 1ZK2A 1MLDA 4WLUA 5TF4A 2CUKA 5IDXA 1PZFA 4R3NA 3CSDA 4HNHA 2I3GA 2VYND 3ZCXA 4EW6A 2HRZA 2VHWA 4CQMA 3C7DB 5AOVA 3WTCA 3AUSA 4JBHA 5DBIA 2GN8A 1GUYA 2YV3A 4HFRA 4ND1A 1LX6A 1T24A 1PGPA 2QX7A 3GC6A 4IDAA 4ALJA 2PZJA 4O59O 1BXGA 3DAPA 4AJ1A 5CG1A 1A72A 4BO2A 4A26A 2O4CA 3FF4A 3LK7A 2G5CA 5IFLA 4WLFA 5T64A 1YL7A 1DRWA 1MP0A 4NNJA 1D1TA 5EJ2A 2VZ8A 4BNWA 3KYBA 4YRBA 3A28A 4FSHA 2DTXA 4E5YA 5T8KA 3ZWOA 2VZ9A 4YT5A 4ND2A 2QRJA 4J49A 5A1TA 1P44A 1QP8A 3DZHA 3E82A 2I9PA 2AQIA 4L74A 3NV9A 3NTRA 2AMFA 3FWZA 3GFBA 4B7UA 5CAEA 1F14A 4QSMA 4CJXA 1KVUA 2Q3EA 4KZPA 3IJRA 2IEBA 2RH8A 1NXQA 3PZRA 3IP1A 4PLPA 4WEQA 4BL5A 5BNTA 4J43A 4YJFA 1HF3A 4IXTA 5DP1A 1BSVA 5CP8A 2JAHA 1PL7A 5IZCC 4UEJA 1R4MA 2DUWA 1PGJA 5TQVA 1E5LA 1NBOA 5JY6A 4NMHA 3VPFA 4AFNA 5TIIA 3E9NA 4FIZA 5A02A 2OHXA 4Q9NA 2CF6A 1LSUA 3BMQB 4BMNA 3RUAA 1X14A 1ZSYA 2C7VA 1R0KA 3E18A 3G0OA 4CODB 5COAA 2HMVA 4PIVA 3RAJA 1CERA 2CVQA 3KYCA 1PJLA 4DL9A 1EVIA 1O94A 1LNQA 2BGKA 2O3RA 3DWFA 4WOJA 4DIFA 1CWUA 3RVDA 2XPCA 5JXWA 4J4HA 4CMJA 4HFJA 4IDEA 4WASA 3ZWYA 4BNNA 2XXJA 1LJ8A 3GHHA 3EZYA 4BB5A 5IAAA 1DXYA 2VOEA 4RPLA 5JCJD 3KEOA 4JBIA 2IODA 3GVPA 3NRCA 3ANNA 1D8AA 2QW8A 4OIMA 1MG0A 3SBOA 1RWBA 3C1OA 4JJFA 4EUFA 1GUFA 1A4IA 1E5QA 3GFGA 3S1LA 4CR7A 2NTVA 1F17A 1D1SA 3DZGA 4FS3A 1MFPA 1FDUA 3FBGA 4BNUA 5G0SA 4YA6A 4HADA 4GVLA 2BF7A 2B4QA 1PR3A 4JXKA 1Y9AA 5T57A 3VDRA 2DPHA 3L4BA 1C1DA 2G0TA 1B7GO 1E1LA 2JL1A 4E2YA 3ROKA 3BHMA 4P4GA 5EIOA 2FZEA 4NPCA 1UZLA 2Q2WA 4IDCA 2EKPA 2D4AA 2HK8A 2YJZA 4Q3NA 1BMDA 3UF0A 1T2DA 2X86A 3GH3A 3KSZO 1YVEI 4XEHA 1DAOA 3OECA 1HZZA 1TVEA 5G0UA 3L07A 3INTA 3JD0A 4FJ1A 1E0DA 5F5LA 1V0JA 2WE7A 3D1LA 5FI3A 4OXNA 3E48A 4IBOA 1LC3A 4AG3A 1MG5A 2Z5LA 1EE9A 1SAYA 4P38A 2BFMA 3WGGA 3PJGA 2X0JA 4E12A 3O8QB 4BNMA 2Y1EA 4YT2A 2VT3A 4IQGA 2GDZA 4Y6SA 4C4OA 5BT9A 2JCYA 3WFJA 1HDYA 3UCEA 4FPXA 1H9AA 2BHLA 3S2EA 3RKRA 3IOYA 3LU1A 5A9SA 4CLRA 1ULSA 2Y1CA 4TRMA 4WCFB 4UVDA 1EK5A 4Q3BA 1VM6A 1IY8A 4I1IA 4M86A 1I24A 4R41A 3RASA 5T6BA 3VH3A 4GWKA 4LRTB 3NGXA 2X8LA 4K1LA 4DC1A 3ADOA 2G17A 3C1TA 1U1IA 3JQ9C 4XIYA 1EBUA 3PTZA 4YAIA 1TT5B 1HDZA 1FDVA 3H5RA 1JA9A 4ND4A 5ILOA 3ZHBA 3V1UA 4GX5A 1P9LA 1IL0A 1HSOA 2B35A 3QSGA 4GH5A 4CM8A 1C14A 3TZQA 4A7PA 2IXBA 3RUCA 1CETA 1K6XA 3OF2A 3CTMA 4GBJA 2E37A 4OSOA 2H5LA 3ZW8A 2VWQA 4TRJA 3ORFA 3DBHB 3DZJA 4EJ0A 5C7LO 4D0RA 3EMKA 3HDHA 2GNAA 1CQJA 1DB3A 2HUNA 1WP4A 4D42A 4EUHA 3U4HA 3ROQA 3M6IA 1KVRA 5AXDA 2VHZA 4WECA 2Q50A 3VPHA 3INGA 1Z73A 1E3WB 1H6CA 2XAAA 4KDFA 2QIOA 4RF2A 4B7CA 1JAYA 5L7TA 4IJKA 2HMTA 1VL8A 1P1RA 4RCVA 2I99A 3DZKA 1YBVA 2RCYA 3EW7A 5BNFA 5A3VA 2Q49A 3I1JA 3I9MA 3ZU2A 3L9WA 1A27A 3AK4A 3EYWA 3NUGA 4BNXA 4DPKA 3OA0A 4YYZA 2GRAA 4TQGA 1V3TA 1HSZA 1HYEA 4CMIB 3ROMA 3KHUA 3PLRA 5AYVA 4PCVA 1OFGA 4DPMA 3QWAA 3Q2KA 5GZ6A 1YBMA 1IPEA 4L4XA 3OA2A 3FPCA 4J9VA 2NTNA 4MP6A 2EKLA 4WE3A 4ALLA 1NNUA 1W8DA 3ENNA 1LI4A 4MVJP 1Y5RA 3AI2A 3G3EA 1PTJA 2EWMA 4WLVA 3ZH2A 4A27A 1N92A 3TNLA 3KB6A 2I3AA 3NDRA 5BNIA 1M6WA 1PL8A 1NVTA 3L77A 2CY0A 1WMBA 3CXRA 1LQTA 2IZ0A 3OFSA 1ZEJA 1W4ZA 2VWPA 2WDZA 3WGHA 5JE8A 1IUKA 5B12A 1LDBA 3L6DA 5G4LA 5KKAA 2DBRA 2G82A 3F47A 4FOOA 4ZQFA 5ITWA 3NYWA 2J8ZA 1Y9EA 2CZCA 3TJRA 2PK3A 1T4BA 3PYLA 3GY0A 1I3LA 3D4PA 5F1OA 3PIIA 3ABIA 1EZ4A 3DZIA 4CQMD 4KTVE 4RZIA 3RUEA 4Z9FA 4OH1A 3OJLA 6ADHA 2JD1A 3VPGA 3I4CA 3LT2A 3AU8A 1I3KA 1SO8A 3H5AA 2J5KA 1K6JA 1XSEA 5ICMA 4GWGA 1K3TA 4FJ0A 1GFSA 2FN7A 4W4TA 2A94A 4W9NA 4D43A 3I9LA 1XG5A 4E33A 1SC6A 4WK6A 1MUUA 2WE8A 4J2OA 2C07A 3PGXA 1DEHA 3RC2A 3PP8A 5KVVA 3CPSA 4NDNE 4ESOA 2FR1A 4GMGA 3JD3A 3Q0EA 3BMQA
chains in the Genus database with same CATH superfamily
5BW8A 2WYHA 4W99A 3O38A 1W88B 1AD2A 3SHOA 5KNBA 2GK6A 3OUUA 3SQXA 3D8BA 2C59A 5HFAA 2CMKA 1VB3A 1YRBA 3S7ZA 4KX3A 1SEVA 1TYZA 1W2HA 2QMUA 4QELA 2BFNA 1O4WA 2VJAA 5CA1F 4JV5B 3MRSA 4IMIB 1Q5PA 5IX8A 1LSOA 2C2ZA 4E22A 5BWLA 3UK6A 3TLKA 1IBSA 1I14A 3GLVA 3GUVA 4YCBA 4O1IA 2FWMX 2XUOA 3LHDA 3PRHA 3EN0A 1IK6A 2PGAA 4UM8B 3R9XB 3EEIA 1A5BB 1RYYA 3BJMA 3DDCA 3LRPA 5ALHA 2AG1A 4CDGA 1BN6A 3OZXA 1GIAA 1T5SA 3RAEC 3UM9A 1M1ZA 3ABOB 3O9ZA 3L8MA 4R9RA 5JSUA 1YR3A 3S2UA 1Y0BA 1JDNA 3U3KA 4B81A 1H4VB 4MV3A 5JO0A 3AY6A 2O5EA 2AXNA 3CO0S 4D9JA 1GM5A 4EI8A 2NU8B 3ZDEA 3FCEA 2BTOA 4KDEA 5JD6A 1DIHA 2BKVA 3M6VA 1H93A 4JVOA 4FEGA 4O33A 4RKFA 5F64A 3UHJA 1CDZA 3AJRA 1ZMBA 2F3SA 4E31A 3DOIA 1DBPA 1Z08A 2XIJA 4IUYA 5J2TB 5TVGA 3U17A 1DFHA 3REOA 3ORSA 1JR3A 3BJIC 1IH8A 3HSKA 3EBPA 4IDDA 3TW6A 3M89A 4HWOA 4RF5A 1OWNA 1YRQA 2YY6A 4C0LA 2QTNA 1XZQA 4KU4A 3Q7EA 3B52X 4K40A 2WSSD 3GIDA 4LZZA 4QSHA 4PC1A 3I1YA 1NP7A 1BDJA 3T52A 3ZXIA 1G21E 5KS2A 3BGIA 1GAXA 3MJSA 1J97A 2A9PA 2EL7A 4N5NA 3ZKWA 3BF8A 5FUXA 2PL5A 5FBHA 1MO6A 2IITA 1KY2A 3NMUF 2FCRA 3LC2O 1JAIA 1XAJA 2I2FA 2DJIA 3K92A 3MCZA 1SQFA 3W77A 2C2XA 5B7QA 4GC5A 5AWFC 3QFRA 4GXTA 3TNYA 3NB0A 1H2FA 3AXTA 1HK7A 3ZVRA 4C43A 2WSIA 1E2JA 4DWVA 2X9NA 3PC3A 3KQHA 2GVDC 1N1DA 1PG5A 3R3YA 4IINA 2GM9A 1X3SA 4TS4A 4DDTA 1T0HB 1DFIA 1YZUA 3EH1A 3O8QA 5FKJA 3KUKA 4KN9S 3DV2A 1CR2A 3ELDA 1MAAA 4HQRA 5CDHA 3IDSA 5IARA 4I9UA 1DX9A 4X1YA 4D4JA 1Z2OX 3GGJA 4M1OA 2IS2A 3DQPA 3N70A 1YE3A 4CM4A 2O7RA 1V95A 2JGFA 2P9YA 2X8WA 3WGTA 5ICSA 2XWJI 4G63A 1YZQA 3B5EA 3WNBA 2Z1MA 2HO4A 3DWGA 1YO6A 1YDFA 2HGSA 3KSUA 3MCWA 2FA9A 1Y7TA 3NALA 2FMKA 2VRCA 3B6IA 4M46A 4ENQA 2OCGA 3EFHA 3HBJA 2HYDA 2XA9A 3O8BA 3PCRB 1ORTA 3TKAA 4C3VA 1KBOA 3UMBA 5B4TA 4N41A 5KYNA 2QMZA 3NNDA 4W7HA 3OJCA 5C8XA 2X2EA 2V65A 3P27A 3W5CA 1D6SA 1JFFB 1VP3A 5AJXA 4D9EA 2FG7C 4GM1A 2HLDD 3JR7A 5AXBA 4QAQA 4ZKDA 3DAYA 1QAOA 4KXYA 5JJBA 4YT4A 3DCYA 5I3CA 2ZAIA 4TLAA 4DSZA 5I7OA 4OX9Y 2C83A 3I09A 1X13A 2HDHA 2O8CA 1Y1KE 3DP9A 5AK6A 1RT9A 4TGLA 1D4OA 4QDJA 1GPWB 3IOCA 4KZKA 4QJBA 3ZDFA 4DBZA 4YMVA 1LPPA 3K96A 1J25A 2G7MC 4E15A 3EZGA 2QRGA 3PQ6A 3GLIB 3G2KA 2FUG1 2GJAA 4YMTA 3U1VA 1D2GA 1AS2A 2GJ9A 3I9KA 1VG8A 3TRFA 3H97A 3CN7A 1HL7A 1SCIA 1XZGA 2XD9A 3ONWA 4F0JA 3WDSA 2R47A 4P34A 1SIWA 1J2JA 5AVUA 1GZSA 3QU7A 4GKVA 1K7FB 3AHDA 2XOKA 3FI0A 4R8VA 3F9RA 1CZUA 1OD6A 3KWMA 3PGA1 4U2KA 3UA4A 3A1TA 5G0TA 3C2QA 3ZNNA 4Y1RA 1VE5A 2XBLA 3DZDA 2ZB7A 3JQEA 4FUQA 3OAAD 1M5UA 4GUAA 1CNEA 3BE6A 1N8TA 3QVGA 4BP3A 3AXSA 1G9XA 4OJKA 3A7DA 1M2KA 3G85A 3GLHE 3QU4A 3UICA 1DE0A 1N6LA 1FTWA 1CNMA 1CRLA 1FU7A 4NR0A 2OO5C 3MS2A 4KRYA 5ERXA 3GGOA 1VPEA 3KOZA 4YJ3B 4CI9A 1WZEA 1NG1A 2VBCA 4RXMA 3UK2A 4TYYA 1L7PA 3QBEA 1CDDA 3ZJ5A 1OKKD 1KC3A 3DVRX 4QQKA 5IMBA 1J6UA 1SVIA 3NI2A 2C9MA 3ZDZB 1L7BA 1CUSA 3W4IA 2AXQA 4MGYR 3RU3A 1SG0A 2YFYA 1PZEA 1EP9A 4HNAB 2H59A 4JT8A 4OI1A 3R7SA 4EATA 5EQFA 3ZWPA 4F3KA 1ZSVA 2AW3A 4C2BA 3WLQA 4NBTA 2PGIA 3Q8KA 3AVXA 3RVPA 1BHO1 4L75A 5IJZA 3WGOA 5CFPA 1WZCA 3CRRA 4UM9D 2ZGVA 2IH5A 1O9HA 3P97A 3OJXA 1Z6QA 2PWBA 5LL6P 1II8B 5EZYB 1KDYA 4BGEA 2G76A 2NO7A 4M0CA 3IV9A 4KL8S 5EJEA 1CR1A 2HCBA 1JEQA 2JH3A 3E9DA 4MUMA 3EQ6A 1I5EA 2R2GA 4FKMA 4V2UA 5BSVA 2ZB4A 1FRZA 4GLFA 4O2BF 2QGFA 2XKJE 1GPAA 4QQRA 2P2GA 4Y2VA 5DTMA 5IYZF 3GCGA 1GR0A 1K0FA 4AY6A 2BL4A 1ZNWA 3UAZA 3BL6A 1U0BB 5ENVA 4G0XA 4UZFA 5DLYA 4ZIRA 1EVJA 2VSFA 3OLVA 3ZR4B 3MTIA 2JLYA 1IOZA 4QNMA 3V32A 1RTTA 4KE6A 1EGHA 1NXTA 4I46A 2FK7A 1XQ9A 4OL0A 3FTQA 1RP7A 2F1RA 1MQAA 2QM0A 4KO3S 1U8ZA 1MB4A 2JC3A 4KXFB 4PYIA 5TC4A 2YXNA 3CLSD 2M6SA 2PFKA 2ZJ7A 1Q1BA 3HXLA 4Y6QA 2B8EA 2JJYA 1J8QA 4RDIA 1QG2A 3QV1A 1KWKA 3H2SA 1AUQA 2R9VA 2OGTA 1QIKA 2GRUA 4QPPA 1IWPB 3TZHA 2QVGA 2VDLB 1C29B 4ZCRA 1MV5A 5FB3A 2JJMA 4TS1A 3QBTA 4AZ3A 5AJZA 5LQDA 1D3AA 2VLIA 5F2EA 4KI0A 4RTPA 3MAJA 3OMLA 4NEQA 3C3DA 3TGWA 2YVKA 3N8IA 3O84A 4BNZA 5A3QA 1SM4A 1EUDB 1OUMA 4FX2A 2ZI9A 3WMRA 5C7YA 2OZPA 3FKSA 4L1KA 3DO5A 1NVDA 3RBXA 3ZI7A 1YI0A 1M3SA 3SEFA 3OWHA 2X9QA 4MS4A 3WI7A 2EKBA 5DLEA 5ALUA 4RC9A 2P4EA 4OFWA 3LGXA 4NBRA 3GLFE 4XUCA 5A0TA 4QPCA 5L4SA 1QQAA 4YBZA 4JZYA 2E5FA 3EBLA 2XCOA 1K89A 2W8BA 4OYRA 4MITA 1EYZA 3AETA 4FW9A 1U6IA 2NNWB 3MNFA 4E0BA 3DBRA 5TQ2A 3VOSA 4C87A 1ZNZA 3HN6A 4JODA 5FI1B 3RVOA 5IU6A 2QP3A 1MV8A 3R6LA 4RIGA 3NHLA 1PBNA 3O3NB 3C87A 4AYXA 4EH1A 1BX3A 1V25A 3BERA 1C4WA 3QIVA 1NOIA 3JWHA 1RAHA 3SK0A 4XWAA 1M2JA 4J7XA 1K75A 1G1AA 3AVOA 2JLQA 4I4TF 5T4FA 2EBFX 1RHQA 2V3WA 4MEAA 5CW2A 5E0KB 3PFWO 1V7ZA 2GVZC 1TMGE 3TAXA 2G0AA 2A78A 2V7UA 4ZEWA 3D4BA 3VKFA 2AT1A 3MCVA 3QKTA 1Z0KA 2E4UA 3LM8A 4FHGA 4EEZA 2P2LA 2W0SA 2ALJA 1WQ3A 2QD4A 5IG2A 4MXDA 4IDPA 1E9AA 1L5SA 1UJBA 4Y2XA 4F2PA 4PVDA 5AQ1A 1Z7WA 2J0EA 3CH4B 4G0QA 4KQIA 5CYGA 2HREA 2QGNA 5D3KA 1UBMS 2HU8A 3OH8A 5EMNA 1Z7EA 2VCEA 2ZIUB 5GV8A 3S7TA 1T4GA 3MMXA 1EM8B 4JS0A 4JP1A 4PFSA 1P91A 2R4TA 3TD6A 4C4ZA 4KACA 2BEJA 3MJHA 4BJHB 1FRVA 3O4IA 4JNKA 4TWIA 5AKIA 2ZSBA 4X7PA 1XJWA 3TSCA 3QPUA 3UV7A 4IGFA 4MV6A 4ZT2A 3P2YA 1Q95A 4BUCA 4MWEA 1QE5A 2X2OA 2DGDA 4FEYA 2E5LB 1W36D 5AR1A 3JD1A 3RYTC 4DIOA 2H0QA 3EWNA 1VP9A 1W581 4FGUA 5DU2A 3K4HA 4ZANA 2CSXA 2PUFA 4C7MA 5JALA 2ORIA 4WQMA 4B4OA 4C05A 3IDZA 4MR8A 3HWWA 2YJGA 2KB0A 4TLCA 3UWMA 5KX5B 2H65A 1P1KA 1YFKA 1TFRA 1OAAA 4LHEA 4UDXX 3RRFA 3TLEA 3TNJA 2RJNA 3TECE 4D26A 1FRFS 2I1WA 2F1OA 3AOEA 2IBSA 4Y8VA 1C9MA 2FZVA 1NLMA 3EVEA 1Z18A 1NF3A 4GMKA 1KTVA 1JEOA 3SKVA 5KNDA 2J87A 1ETHA 2JW5A 1JT2A 3T34A 4HAYA 1ZMTA 2QMQA 4Q1DA 2P2SA 5TS2A 3BUSA 3WS7A 3P5SA 4RAOA 2NG1A 1N5JA 3AY0A 4C88A 3TN7A 2AN9A 2O8VA 5CFRA 2PLFA 1HG1A 1PT8A 1E7RA 2P7HA 2QEQA 4ERNA 5L7WA 2ZAMA 2BC9A 3BDIA 4NBVA 3V8EA 2JFOA 2OTCA 2B36A 2VXCA 5JC1A 2HSWA 1UP6A 2G1UA 1GZUA 3IULA 4B45A 2IUTA 2ZULA 3DC2A 2PUDA 3GRFA 3O4VA 1J39A 1OASA 3OCUA 3R3SA 1P19A 4G4JA 1CRWG 3QE0A 4QOHA 4K7JA 2SBTA 5IT4A 1CJSA 4MHSA 1XPRA 1DC5A 4OMDA 4BB6A 5C37A 1EP2B 1TVKA 4G0VA 5H68A 4YMUA 2Q3JA 1Z13A 1MCZA 3DL0A 2REOA 1P75A 3CNEA 3NBAA 1YB6A 1YC5A 2H1VA 2VJLA 4NK5A 4AJOA 3FTDA 4PRZA 4DV6B 1Q20A 4QRIA 4HRXA 3UB3A 3BZUA 1ISIA 1JJ7A 3D8SA 3WRVA 1SCAA 2XDQA 2WTXA 4DGQA 2Z5FA 1WUYA 2VSNA 4Q7QA 2X22A 1CEYA 3I01M 4TMYA 2O1SA 1E2DA 3GUCA 4GQIA 3WLMA 4W1QA 4X54A 3GG2A 1VYTA 1X9GA 2Z3VA 3EFEA 1NM5C 1UC8A 4MS1B 1Z28A 3HGMA 5ERYA 3U31A 3W5BA 1FC0A 5D5QA 1DUVG 5HM8A 3MIZA 2ZSIA 3ZW9A 3JQAA 4YEDA 1ESCA 5ICCA 1YJAA 2YDYA 3F67A 4V38A 5JWRA 3DTYA 4ZRNA 1S2LA 4ZQBA 3RSLA 1DWPA 5GJCA 2MU1A 1C0LA 1YIDA 3KZXA 3QLTA 1JVSA 2V7WA 4DUPA 1R74A 5TRTA 2WPDA 1GADO 3HRKA 3PDIA 5AKJA 1AB5A 4Q02A 3F3SA 4AS3A 7GPBA 2SKDA 2WSYB 3EUFA 2BFCA 4FQ5A 1KHTA 1NIJA 3HKDB 3SNHA 3G68A 3PVSA 5J58A 4A03A 3TPFA 4EQZA 5IDWA 5CFZA 3HEAA 3O9VA 1S02A 2PL1A 2FSPA 2FRXA 2PZ8A 1MX1A 2XNKA 3HCWA 2P2DA 3PDWA 4O8ZA 1B14A 2ACKA 4S0ZA 1VBFA 2PZFA 3PEEA 4DTIA 1NAHA 4A92A 2ATCA 5TT1A 5EQDA 4OBWA 5B1HA 5AW6A 3PRKE 4GC9A 3ESRA 3CJTA 1RWMA 4P4SA 3ILVA 4ZVRA 1GY8A 2XVXA 5ITZA 2Y1XA 4ER0A 4AP6A 4EY5A 1AHPA 1ATZA 4MV1A 4BO6A 4DKJA 5I9IA 1IBCA 4HVTA 4JOQA 3JQPA 1S2DA 3BCHA 4FYJA 1JFLA 2GNOA 4JROA 2K4MA 2JJ1A 3T7SA 1RWOA 3Q6IA 3LGAA 4JI5B 2IU4A 2RI6A 4BATA 3ODGA 1YD7A 3GCDA 2FW6A 4H1WA 4RJKA 1UBNA 1XRMA 1ONPA 3DUFA 4JHLA 1ZBDA 1BWSA 4B82A 3I9NA 2BCGY 4EKGA 3SSNA 4K2AA 1UANA 2I91A 4K9PA 1BEEA 3DTVD 2WUFA 1DJPA 2ECPA 1X7DA 1ZSNA 3WKAA 3M6FA 3OPVA 2VP3A 3BWDD 2QE7D 4UBNA 2PZBA 2YOGA 5DHQA 4GQAA 4DPLA 3U2QA 4DDWA 3RARA 3SQWA 3NANA 2XMBA 4JLBA 1QDEA 3VPXA 1PJRA 3G1UA 1DJOA 3FYUA 4O2AA 1U0RA 1E4OA 3ZJVA 1US8A 3IBTA 4OXXA 1L5VA 1RBQA 2YXDA 3VBCA 5ICFA 4NE2A 3GA0A 2O4UX 4P7FA 1G17A 4NATA 4PZ0A 3U3RA 5L6MB 4ZVLA 2AFIA 2Z98A 2PU5A 3OFND 4G9EA 3UUFA 4RTSA 2GBFA 3FVVA 2QJFA 1ZGGA 2TRSB 1C1XB 4A6PA 1P74A 1QOZA 2NUAB 4PLWA 3CU5A 4CCAA 5TDHA 1LTKA 1ZUD1 3O93A 1BMTA 1TU3A 1NBAA 1W0JA 4TMWA 5AVTA 1W47A 2AF3C 1XYGA 1DBIA 1WNFA 3N8KA 4J4TA 1OXSC 5CTAA 5D00A 5G1OA 2DSTA 4G8CA 4P1ZA 1G3MA 3U13A 3TK1A 3LVFO 3JASA 4RF4A 2JH8A 4L4RA 4B7XA 4BNIA 3CH6A 3BJRA 4C78A 4Q4JB 5KSPA 2UVQA 2V0NA 3SZUA 1W7AA 2G88A 1S6YA 1M8GA 4PONA 4WZZA 4YI5A 4J9UE 3DV0A 2BFAA 1JKJA 4R01A 3A32A 4XWTA 5EYPA 2ZWIA 4TWAA 2ZUFA 4JC5A 1GCUA 2FDRA 5KNCH 2FSVC 3IP3A 2Y0EA 5T6MA 3T7JA 1KVTA 2CXPA 4LOJA 3HB7A 1SKYE 2ZQZA 1GFZA 2RKOA 1D4AA 2BBOA 1YDHA 2AQ8A 3IP8A 3T95A 3AHHA 4CF5A 3V2UA 4UNSA 4Z1OA 1BTOA 2Q62A 4F2GA 2UYHA 3F74A 2PT7A 3IIKA 1FL9A 2B4TO 1MC1A 3MWJA 1GYQA 2VPIA 2RONA 2QR2A 4TSRA 2V96A 3VDNB 4BV2A 1C5KA 3D1VA 1LLCA 1TJYA 3Q5DA 3V9PA 1JRLA 1C9KA 1L5QA 3ROPA 5JH7F 1BD3A 5F51A 1RNLA 4BO1A 4AJEA 2BT4A 2QPAA 4WCVA 4DRXA 4L7QA 1PIWA 1WPQA 2Q9BA 2NU7B 4GU5A 2BKAA 3RTBA 3LK6A 3MWLA 3WWCA 4U7TB 4BX2A 3O2NA 1S9HA 2YMMA 1XZKA 1A9TA 2RI0A 1W85B 3CLTD 3OM1A 4YRRA 3GWGA 3HUTA 2RKWA 1JV2B 4OB6A 1D9XA 4I5FA 3S5JA 2HNAA 4YRGA 2CBZA 4JOBA 4KIUA 3W1EA 2BJVA 1WEKA 4D3DA 2OBMA 3LPMA 5ALPA 4I50A 3AF3A 2ZDHA 3B51X 4YJ2F 3I5UA 1B3RA 4E09A 4E13A 3OETA 1U3DA 4L3OA 4MRSA 4MR9A 2BTQB 3PR1A 3ZDBA 3TBKA 4IOMA 5IJ0B 4GOKA 4HBZA 2ZYVX 3JAWA 1FY2A 4C3ZA 3OZVA 1NUQA 2OORC 2PUTA 4KEAA 3NHJA 3KT8A 2AC2A 2BM8A 5FJJA 1UUFA 4W1SA 1E9DA 1XU4A 2A9JA 2QV7A 4PZ9A 3NQ41 4GIBA 3MOSA 3O91A 4D80A 1GA6A 1MC8A 2WIBA 3H87A 3VU9A 4CVNA 4QODA 1XZIA 2R7NA 2O7VA 4B46A 4CLOA 2Q1UA 4XJTA 3LSYA 2C84A 1U8UA 2QZPA 1G8SA 2Z2IA 1XNQB 2ZIWB 4XE5A 3U4QB 3I1IA 3VRHA 3FFAA 4UBIA 5MFPA 2OD7A 1Y7LA 4KPFC 4BMXA 3AI3A 2I6TA 1W9HA 4PPYA 1PWEA 1JE1A 4YECA 1M34E 2Z09A 3M3PA 4ND7A 1RXYA 4NJEB 4C4TA 4GXRA 1CW2B 1V4BA 2VHEA 2B7LA 3BGDA 2COUA 2PLAA 3IDAA 3KDAA 3LT4A 5AK3A 1S3GA 2WK1A 4Q4AA 4ZQEA 5ECDA 1N6KA 1XZEA 4MPPA 4U7HA 2QN3A 4HDQB 4HN4B 2A4KA 3RFXA 2WF8A 3WQBA 4UUBA 2OO7A 2ZYWX 4J90A 4WNIA 5BMVF 2H1LA 2NZJA 2RGNC 3D02A 3HJCA 2FHPA 4RK7A 4URUR 3WGQA 4BU0A 3U3OA 2NXCA 5KKCA 1VB5A 2BM9A 1RM4A 2GD0A 1N7IA 2J31A 4MWCA 4Q4DA 1EFKA 5K3FA 2EZ8A 4Q3EA 1AQNA 1A4UA 2GEUA 3E9ZA 3HTXA 2BEUA 2GPSA 5IJWA 1E98A 1U7PA 1R4NA 2PU7A 3E22B 3QBVA 5ICEA 2AR9A 3ON5A 4URYR 1JQAA 4LMAA 3LL7A 4E7PA 1QQ6A 4IS2A 2HDOA 1C9DB 1CUUA 1H05A 4K8OA 1QVVA 2SHKA 4XDYA 4E5VA 1N2IA 1RABA 1U2PA 4JLVA 2E4XA 2E0IA 2QRNA 2R8PA 3C7AA 3GDFA 3DLHA 2X23A 5E1OA 2XOXA 1U7XA 2G0NA 1NDQA 2GI4A 3CNOA 3LUPA 5ISMA 3TLZA 1EIZA 1SUIA 2NSLA 1K06A 3JQBC 3L6RA 3FTPA 4D3SA 4ZYXA 4FJ2A 4XGNA 2WIFA 3MT8A 2V4UA 2YIMA 5ANRB 1AF7A 2FUNB 4B76A 3LA8A 3O90A 4PYRA 3AESA 2BGWA 1T4CB 5EC8A 4YR9A 3R3WA 3VI4B 4ARIA 3QRWA 1USUA 3LYHA 4WN3A 3PX7A 1GILA 5L3SB 3DEIA 3HNRA 2RBGA 2R60A 3OZUA 2JI9A 1LLUA 3S29A 1BIFA 4TYQA 4ZV7A 2MSDB 1GN8A 3DCJA 3E8MA 2YJ6A 4NE7A 4BLRA 1SBQA 3M6MD 1WB6A 2FEWB 5CB8A 5C31A 4TZKA 4ADSG 1DPGA 4BQSA 4YT8A 4MQLA 4U63A 1DIRA 4R2IA 4UNNA 4RGVA 3VJMA 2Y0CA 2ZYDA 5B7PA 2DMRA 5GZ1A 2NWQA 3N8NA 4MRAA 2TMYA 3UWDA 5EJ9A 2PXCA 2VAVA 4RYDA 2B3TA 1D5CA 4LSZA 5SV2A 4YI3A 3RJ5A 2QUZA 1GQRA 1Z9BA 3RODA 1TLFA 1OXUA 3MCTA 3LX8A 3SC4A 5DN9A 2XCSB 1EJ2A 1KRHA 3LDUA 1ZJ6A 1MC5A 4M0PA 2I34A 4R98A 1UKBA 3T1NA 2RI1A 1RLIA 3OT5A 4G37A 2FLWA 4RPIA 1YZGA 4D9CA 3SS9X 1NWCA 4E08A 3IXQA 4FCWA 4HUQA 3TLXA 2ZREA 1Q7GA 3PRYA 4RY0A 1R0WA 1QK5A 4W7IA 2GEKA 5CEFA 5K45A 5IC6A 1ZD8A 1N5OX 3F90A 3OHPA 1XD9A 4RADA 4NJOA 4ZC1A 3SX2A 3DA8A 1E92A 4JKOA 5G4KA 1QLWA 1VDMA 2ILTA 1NXVA 3DMDA 3QVVA 4KW7A 1CIJA 3TLGB 4C20A 4OHYA 4M76B 3LRTA 4XCXA 4B2YA 5DCYA 2F8SA 3FSRA 4Y2PA 1I33A 1SK8A 2R1TB 3BXXA 2QYSA 2P9EA 1EX1A 1XWIA 4P98A 1IN4A 4B9AA 2GD2A 2UUAB 4ISBA 3N39C 4J2HA 1TJ4A 2XTNA 1PT9A 2Z9CA 1DO8A 1VHQA 2LCFA 2HC9A 3ID6C 1B74A 3FSEA 1GAQA 4XZ3A 4DRZA 3K9CA 4RVHA 1NNEA 1DOZA 3ITKA 1BN7A 1TECE 3VZRA 5HQ3A 1UPBA 1PJ2A 1Z2EA 4F11A 2IOFA 2NADA 1Z06A 1A76A 4AK9A 4NBSA 4NIMA 2FGJA 2CD7A 3E61A 1GXSA 1GTMA 1WUTA 5E6UA 2FI1A 3ZDYB 5C1BA 1KR2A 1BOFA 4D79A 1W0CA 4F8EA 1XDDA 3TR0A 4HJRA 1AF4A 2QZ9A 2J1LA 1X0VA 4E94A 2O6HA 3TI7A 1OAKA 2B4AA 2QT0A 4ZCMA 2NU6A 4Y2HA 4WMLA 5ENDA 1NSYA 1J99A 1WLYA 4WJLA 3FWYA 5HDQA 1V8FA 2YV1A 3C6ZA 4IIYA 1ZH2A 5DK6A 2FSFA 4N7MA 4F3YA 3QEAZ 2OGWA 3ND8A 3RRJA 1D1PA 5BN4B 2GLUA 1FQKA 2WKSA 2XZPA 1Y8CA 2W6JD 4WBNB 5BWMA 2HTFA 4O5AA 1WD7A 3UCXA 1MA0A 3AJAA 3O47A 2WHXA 4GYWA 1ZJJA 4I1UA 1GAWA 3UAGA 3QLVA 3FR7A 2ICAA 5EUMA 1QR2A 2OZLA 3QKIA 2OMEA 3OUZA 1DINA 1Y8QB 1W1UA 4UNPA 1IXKA 2AEFA 2BPOA 1YS7A 3HN7A 2E5WA 4YB8A 3AB8A 4D0SA 1QH1A 3PNOA 1E9SA 5BYJA 2IEAA 3I9V6 4NJMB 3GNQA 4O2BA 3TSAA 5JYBA 3R5FA 1ODTC 4IIVA 1HO3A 1Q0HA 4FQ8A 4K5QA 4PCUA 4PG5A 4BB9A 1DJLA 2H17A 4PZPA 4QEDA 5JEEA 4IH9A 2FB9A 5J2UB 2MMCA 4DXHA 1OYVA 3BEDA 1YU9A 5SZHB 2XWBF 1FA9A 4U1RA 3VU1A 3O92A 4J29A 1FFWA 2X4GA 1GZDA 1YL6A 4HPJB 4CNQA 1OFUX 3WAJA 3QEMA 1H2AS 3A27A 3OQBA 1W93A 1BXRB 1TUIA 1XD8A 1L4MA 3PUXA 5LOVB 2CXQA 1UOQA 2RBKA 2OV3A 2C9YA 2CHQA 5JCPA 1FVOA 1BXZA 4LUCA 1RM5A 3BSYA 4FNAA 1BE0A 3WKEA 5K8LA 5AVSA 4R1MA 5ARCA 5E9AA 1DKOA 5PGMA 4YACA 2OR3A 2YHAA 5LP6B 3D3WA 1OCEA 1I5OA 1P0CA 4E1AA 4PZDA 2X8JA 1YS4A 2V8OA 3B78A 1REQB 4QFCA 2ZR9A 1LV7A 4GZLA 4N5IX 4B3BA 1ZU4A 3STTA 5J4YA 3NONA 4BMPB 1GVHA 3B7WA 1PGQA 1PZGA 4LJRA 3I8OA 2XI4A 4CF6A 4KOAA 3KJGA 4G0YA 2B2CA 4L50A 4UCFA 4N7BA 2FSHA 4GD3Q 4QKQA 5I7RA 2Z8ZA 4LVOA 4C1BA 4XRGA 2CBGA 1SXPA 2LDBA 3NW9A 4DDMA 3D9QX 2JHCA 3UPUA 3EVCA 5KNBH 2JIPA 1O9GA 1RHRA 2NQTA 4C14A 1N2OA 4OBXA 2XADA 2FEKA 1L7EA 1ZA2A 4RHEA 5DMXA 5C34B 3BG5A 2GHRA 2JGKA 4MO2A 3PV0A 4EEXA 3RYIB 5D2CA 4BV3A 1J9ZA 2PA0A 3F5FA 4LXHA 2J9ZB 4CQLA 3OU6A 4DYHA 2ZBRA 2XNHA 2Q0SA 3J81k 1NLZA 5K1ZA 5ALEA 4US1R 1M0WA 4OB7A 4FFDA 2X0RA 3M33A 4B6SA 1VE9A 3N53A 3NIFB 4LWQA 3QEBZ 4CEHA 4LY0A 3RSHA 5E9JA 5K0NA 1HNZB 3BMOA 1UMBB 1HZZC 1T8SA 2Y0BA 3OOEA 4I4TA 4POAA 4D4GA 2DFVA 1UT8A 4U0JA 5G0WA 5KTKA 1E79D 3VKUA 1WZ2A 4JITA 1JIUA 4TXJA 4ZD6A 3FPAA 5CRIA 5JBQA 3DKRA 1GKUB 2ZXEA 3NVAA 2CJWB 4ZHSA 4UTXA 1ADCA 1CB7A 1NSFA 2XB4A 4CKWA 2D8AA 1XRQA 2HQSA 1IN7A 4FHDA 4OQZA 1ZLXA 4LF9B 5BN5B 4UZSA 1P39A 4RLSA 1RIFA 2WDPA 2DAPA 1TB4A 3T1YB 4ML3A 5JSZA 2UZ0A 2YWEA 3K0EA 3WNVA 3WLFA 2QSZA 1RW4A 3LVRE 2CXRA 3QM1A 3HEBA 1JR6A 4OA5A 1MNAA 1SVSA 4X60A 4AI6A 1Z36A 3PXDA 4XM2A 1L5ZA 3MWGA 4Q4HA 4PSVA 3FUCA 2QN8A 4I2NA 4N03A 3HXMA 4ZAFA 1GDTA 2FVXA 3WB0A 9LDBA 2A1UA 2H6EA 1QBKC 1KXZA 2JHAA 1V8ZA 2IZZA 3O4GA 3OLYA 4HHEA 4KXMA 4AZWA 1D6NA 3VUFA 1O97C 1WDMA 2AFHE 2ODNA 3TG8A 2J3IA 3WRXC 3ICOA 2W5UA 4CTOA 3H1GA 4NFHA 2GEBA 1QYCA 1AKYA 4HLNA 5LLTA 3LPLA 1G21A 3LF2A 4YP5A 3IDOA 4QTYA 4C29A 1NR1A 3UWOA 1TD9A 1DZ3A 1V9LA 1R15A 4FFBA 1ZOPA 1ZX1A 3E7PA 3OEED 2FFQA 5EY5B 4Y2GA 5G3YA 1FPQA 3INNA 5AW4A 4OA8A 2GB4A 4JI6B 3EGXB 4GRIA 4RELA 1QV7A 3OCJA 1OLUB 4Q9KA 3V1MA 2PTHA 1Y33E 3BE8A 3VVCA 7ADHA 3N0VA 3K6RA 3OIYA 1WHTA 1RYBA 1XYVA 3V8QA 5CA0B 5KTSA 1Q0PA 3KZCA 4INZA 4GPTA 4HP8A 4E5PA 2X1VA 5D87A 5WRFA 3HWRA 3Q12A 5CM9C 5C1OA 2XGJA 1LZLA 1EA7A 2P5TB 3EXFA 1PEAA 3KOXA 4TLDA 4MPRA 4XYLA 3GP3A 2WT9A 3A3YA 4O4IF 1XRLA 4UUNA 3FCOA 3RS5A 3VU8A 4I9GA 3WGZA 4HV4A 4FQ7A 1CPYA 3PIRA 2IW3A 2G6TA 1CUJA 2QD2A 4JL5A 3WGYA 1MXHA 1MXFA 3LXXA 2ZUBA 3CZRA 4II7A 1OV4A 4NABA 2YS7A 1NAIA 4JFAA 4KB5A 3FY4A 2ZBPA 4LRWA 5KQRA 1CYEA 1OXTA 5DZSA 5LXTA 2LV8A 1CU1A 4P33A 1PZNA 1Z6YA 3L40A 4OHUA 2A84A 4IIBA 1M0EA 1NW6A 1E1MA 2IOHA 1M5RA 4FXPA 4FFNA 4EX6A 5LR6A 3UAVA 1JQJC 4KO4S 4IFBA 3DGEC 5HJ7A 3EXIA 4BNLA 3PX2A 2ANCA 1TEVA 1DBSA 2YRWA 5C52B 2ZSFA 2AR7A 1ZJWA 2EERA 3N2NA 4FR5A 1RWWA 3V4ZA 1QV6A 2YVAA 1PTJC 1Z7BA 3QNMA 4DA8A 2DECA 4D9GA 1BKDR 4KI7A 4OGWA 3SC2B 1G3RA 4EZIA 3S2YA 2YNMC 4IDOA 4JXXA 2R68A 3I8XA 3QG5A 3HKEB 1HR0B 3LT1A 3JPYA 1G41A 5LZ2A 3N86A 2BBSA 4MQ5A 1AZWA 1UWKA 3C85A 4IJMA 4J1NA 4RA9B 3L49A 1U8AA 2VUHB 4M0KA 4MDFA 2W2KA 2OOKA 1EFUA 2PUVA 3DEZA 5JMPA 3RUFA 3R7LA 4BNDB 4D4HA 1J07A 3X3HA 4M1EA 1BFDA 3CW8X 4PO3X 4XKJA 2IU6A 2B3DA 2C03A 2ZIFA 4KQXA 1ZIPA 1EZ1A 1P6UA 1OFVA 2P9QA 4C7BA 1HDXA 4FB5A 1RJDA 3GLHA 1CVLA 3ER9A 5C7OO 1Y3AA 2O3JA 2FFHA 3Q3GE 4MSUA 3A4TA 4CHTA 2V7TA 3TUZC 2BEWB 3GEIA 4DDHA 1FNBA 1FYWA 4AS2A 1A97A 5FUYA 4AJ2A 4NKRA 2JBAA 5EWMA 2PAFA 4BQEA 1DO0A 5I9TA 4Y6OA 5CFMA 4ZAYA 5J2TF 4DSAA 2P35A 3NH6A 4WI1A 5FBVB 4IPTA 5IDYA 2FYTA 3V33A 1B26A 1I5RA 1R0XA 2VYVA 3LDAA 2PKEA 3TKYA 4EHHA 2X9VA 2EAUA 3SDBA 4CT4B 1J2TA 2O23A 4NCKA 4P36A 3F71A 4HXEB 5BSUA 1A8UA 1VL0A 2GF9A 3SD7A 3FRHA 1J49A 4W9NC 3EARA 2C88A 4EK9A 4G1MB 4BZXA 1NVGA 2IYVA 1JHPA 3PXUA 3ELUA 1EKXA 3FKJA 2RJOA 1J0DA 3WICA 2D5AA 2QYOA 1IHOA 1TZJA 1V39A 2QF7A 4LGYA 4ARBA 4DDUA 1WBDA 1E4VA 1P5HA 1X1AA 2XXBA 1FMLA 1EG2A 1XFAA 3L0CA 5EUCA 1SOAA 4EUSA 1W9MA 1SHTX 1NURA 3GUUA 4WEOA 4FNOA 3RWOA 2IY8A 1RMQA 1IM2A 4BLOA 5A9TA 5K0GA 2OO5A 4IUDS 3KD3A 3X2FA 4N3CA 1RPZA 3L0IB 4IDGA 3VSBA 1PKEA 4UNQA 4A8JB 2PL3A 3EUEA 1DG9A 3FCUB 3E7DA 4IRXA 5LMUB 2XE7A 2DPMA 3WIDA 4BUJA 3OKFA 3DGFC 4MRMB 4X94A 5ALMA 5BSMA 5L7YA 4TTIA 2BHSA 1N2CA 1XE3A 3KTAA 1DFGA 1XN4A 2A9KA 1DDOA 2PGNA 2EW8A 2YJ5A 1JQKA 1Y8AA 2R7KA 2VP4A 3L7YA 2ZEJA 2G70A 2GN9A 2Q2OA 2V1XA 3AEYA 3DKKA 4UHFA 4ETMA 2ZZMA 3QE3A 1VPTA 2RAUA 3QEKA 4TUYF 3Q3IA 4OL9A 4X1IA 1ZDMA 1HGXA 3F1LA 3K8ZA 3LQRA 1C8KA 4YRZA 3LDFA 1GNTA 3MOIA 3FVRA 4ZALA 3O4FA 4JSRA 5D1HA 1XELA 3KVVA 2F43A 1ZQ9A 2BGLA 3VBEA 4LMRA 3M1IA 3K0FB 3ENZA 2IXDA 2YVUA 5D5HA 3IAS1 5T3YA 4AMVA 3DBLB 4TTVA 5HRCA 4B3MB 1O5IA 1U7OA 4AY2A 1X1TA 3H5IA 2NT3A 5GGYA 1PS8A 2FWAA 1SBIA 4HYEA 4Z53A 3KVRA 3WAGA 3K70B 3LW7A 2VWGA 4HXFB 1WKBA 4OH7A 5JECA 3ET4A 1I10A 2CB9A 1MQ9A 1R2QA 2PY6A 4JWKA 1Z0ZA 3GW8A 4PLCA 3GLFA 4QU9A 4CM6A 2XHZA 4Z0HO 4EJ6A 4PE5B 1YIAA 4JK3A 1HY3A 1ZNYA 2FH5B 4MQEB 4Q37A 4UVEA 5CK4A 5IULC 3ZIAA 1NYLA 1TM1E 2WM8A 1XV5A 3C48A 4F9EA 2ZRJA 3IP7A 4HR7A 1ZRMA 5JFTA 1G9TA 3EOAI 3FAKA 3P0FA 5JPIA 3R20A 2GJKA 1Z4MA 5EJIA 3ZVMA 1YGPA 4YJ2B 4XJXA 8LDHA 1NW4A 3HA2A 4W82A 2I1QA 1Y8RB 5FV4A 1JEYB 2YQ5A 1ISFA 4G0OA 2OB2A 3LVQE 1P3DA 1EK6A 2NU9A 3C4QA 2WB4A 3CA8A 3HZOA 3PJEA 4EW3A 2P79A 3IP6A 4IG4A 1JSLA 1V5IA 5EJFA 3U9TA 3M3DA 4OF4A 4BAZA 3RTCA 3PX3A 1ZPDA 4D5EA 4F9TA 5E4FA 5HSGA 4V1CB 2OOSA 3SN6A 2NYRA 1I7QB 3S44A 1UEJA 4YVFA 4KP7A 2OBNA 4UUOA 4CEIB 4ZZ1A 1RVDA 1VJ5A 3DXZA 3LOUA 4LOHA 4PLTA 5BSTA 4AJ9A 2BVNA 4YJ3F 4UOZA 1XALA 3KHSA 1F2VA 1YK1A 4N47A 3RK1A 2COKA 5A4JA 3H3XA 2XEXA 1P72A 4U6NA 3HG7A 4AU1A 2GA8A 4Y6RA 3ZCSA 3HO8A 3NDJA 4FWBA 5L9AA 4XI9A 1SXIA 3KPJA 3F97A 1RM0A 3VC3A 1FRNA 3NX4A 4AL4A 1DMRA 2O3SA 3ZDCA 4L0QA 4Q48A 4XM0A 2WJYA 1ZUNA 4CM9A 5HJEA 1TL7C 4UXJA 2XH8A 2Q4TA 4WTOA 1AUOA 4Z2AA 1FK8A 1XIVA 2PUHA 3MMZA 2Z8YM 2Q21A 4JY7A 1T0PA 2BFBA 3NP9A 5DGTA 4E1BA 4GP6A 5A2QA 1PAUA 1DCFA 3NTQA 4ZOLB 4GI5A 3T3PB 4OUDB 5EZYF 4UHKA 3TQQA 5CVTA 1XKXA 2Q1SA 3PEWA 1VKNA 2BKLA 5EZ5A 3NGMA 4LAFA 4OJQA 1E1DA 5KNDH 5AVZA 3DE3X 4GKBA 2PX5A 4W5QA 1QXSA 4CL2A 1C41A 4PO1A 5D84A 1GPKA 1XMVA 3RRZA 2UUBB 3GF4A 1F3OA 3UPTA 3TZEA 4PSKA 1D2EA 2X13A 3W1VA 2QRVA 2OB1A 4EQ6B 2E1PA 1U65A 4FEAA 3PFFA 3UK1A 3OZBA 4P7KA 1AA9A 2I4LA 2AC4A 2RARA 1NXXA 2XGOA 3RSGA 3OLZA 4HQ0A 3R09A 1SC3A 5DNWA 4D3XA 4PX5A 4ERXA 2Y3IA 1P2UA 4BHTA 1L8QA 1ZMXA 3FN4A 3KQLA 1CYDA 1MR3F 3K1AB 2IS1A 1G2PA 1UPTA 5EIWA 2REQA 1U0HC 3BTUA 2OL4A 3OURA 2IDZA 5IF3A 1F4VA 1WY5A 1J8YF 1WB5A 1CS0B 2A4MA 1BX1A 2I6FA 3NHZA 3PHJA 5EAIA 2GM5A 2IYYA 1AUPA 5JANA 1Q6YA 4YY3B 2KJQA 3EYAA 3FDZA 3I12A 4U7FA 1F9EA 2CYBA 1Q16A 3AF2A 3LX6A 5AHRA 3O1LA 2W2LD 3PPVA 1KTIA 4OU5A 2C3YA 1CG6A 3D2AA 4M37A 4AZ0B 4DJJA 1Z4LA 3AEUA 3E3MA 3KYIB 1VBMA 2JLRA 4IGKA 4MYRA 2IIPA 4N40A 3QH4A 3C3KA 4D0GA 2Y0DA 1NVWQ 3QKSB 4QRDA 1S2NA 3G8YA 4QPZA 3VFDA 3GELA 2HJSA 2J3MA 3LY7A 4G85A 4XD7D 4LHVA 3KPWA 2Z1DA