5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
3Q2IA 1J0XO 3LC7O 3GF4A 5EIOA 1T25A 4E5YA 4FDAA 2V7PA 1RJWA 3C24A 3ZWMA 4L76A 1R0KA 3UXYA 2XF8A 4XYGA 4LW8A 3FN4A 5KVCA 3WBFA 4EUHA 4AJOA 2WDZA 4PRLA 3PLRA 3WNQA 4DA9A 3S2IA 4BQPA 2AQ8A 1R16A 2X0RA 4R4JA 2QRKA 2C82A 3MWEB 2DBQA 3AW9A 3K2EA 4PN3A 3COSA 4A26A 1F8FA 4CM1A 4DBVO 4B4VA 3JQ7B 4ONEA 2DFDA 4G81A 2YHIA 2VTEA 1EMDA 1N1GA 3IDSA 3BMCA 4XZ3A 1NFRA 1JKJA 1R6DA 3VZSA 3IS3A 4LSMA 3O8QB 3GUYA 1S6YA 4BKRA 1PEDA 3B1FA 1UAYA 1I0ZA 4YQZA 2EJVA 4YB8A 5F21A 3IKVA 4YPOA 1GEEA 4O1MA 2BGMA 4BNZA 3WB9A 4GH5A 3VDRA 3KYDB 5KJFA 1CDOA 2FZWA 4IIUA 2W2LD 4RPJA 4WLFA 1YJQA 4L0QA 3VZQA 3ZHYA 4E3ZA 5JC1A 2CNBA 3GLQA 4YAEA 4AJEA 2EKLA 4E6PA 1DRVA 2FZEA 3PFWO 5JE8A 3PYLA 2JCXA 4ZQGA 1SNYA 4H7PA 3I6IA 3ULKA 4TVOA 1QYWA 1T26A 2G0TA 4FQ8A 3WYEA 3LT4A 3DZFA 3PPIA 4QX6A 2EGGA 1PJSA 3ABIA 3UICA 3BA1A 1DSSG 1GQQA 5I8WA 5IG2A 2O3QA 2YYYA 5IF3A 2QG4A 4FFMA 3AFNA 3PIDA 3ASUA 5CDYA 1LSUA 2X0IA 3ITKA 3NAQA 5EMHA 1YRLA 2DLDA 3QWFA 1Z7EA 2UUOA 2YW9A 1T2EA 5H81A 3QP9A 5THKA 1PL8A 2CDCA 5ITVA 1PJ4A 3BHIA 1IYZA 1DXYA 4R54A 3HDYA 1E7SA 4JJFA 3HFSA 3ZZNA 5BQFA 3GH3A 4FSHA 3HZZA 3CTMA 4EITA 4UVEA 1EZ4A 1NPTO 3RIHA 5MDHA 3Q0EA 4DQUA 1YL7A 5AXAA 5HS4A 1PGJA 2Y0EA 4K6FA 1SAYA 1XWFA 2NQ8A 3H2ZA 4DIOA 5EERA 1ULSA 3CKYA 3HDJA 4N18A 2J3HA 2V65A 2ZYDA 1PR9A 1PS8A 3PJGA 4CJXA 5HWSA 3W8DA 3AFMA 4GWGA 4BVAA 4W6ZA 1KEWA 1DAPA 3LSYA 4GX0A 1BDBA 4E2WA 5G4KB 4BO3A 2HJRA 2P9EA 5TC4A 1K0UA 1X1EA 4B79A 5I7VA 3LQFA 4HUJA 3D5QA 4W7IA 3ZWPA 5BNFA 1N92A 3JCZA 4NH4A 4BNKA 1U5CA 2GZ2A 3CZRA 4WLEA 3HNPA 3WICA 2E6UX 2ZB8A 1ZMOA 4CL3A 3UUWA 1BDMA 4KZPA 1DBVO 1HTBA 3QWAA 1KEVA 3ZH2A 3ZHXA 1A9ZA 1PZFA 4U0KA 2Q1WA 1VM6A 5COBA 5FI5A 3RUEA 4Q3BA 4E4YA 1D4FA 3EY4A 5G2OA 4JBHA 3LU1A 2VZ0A 4DL9A 1ENPA 3C1AA 4J3FA 4PLPA 3SLGA 5C3MA 4QXMA 1LLQA 2BMAA 1GYPA 1P44A 1XG5A 2X5OA 4BO4A 2IZ1A 1B2LA 3FPCA 3VPXA 4X54A 4PRKA 1Z7BA 1A27A 4YJDA 1C1XB 2ZK7A 2FSVA 2HMTA 3BZUA 3H9JA 3MTGA 2A94A 3T7CA 1UZMA 1Q0HA 2JD1A 4JNKA 2O3JA 4CV1A 2XXBA 3ONFA 3WLFA 4R1TA 4CQMB 4D3SA 3DR3A 3SJUA 3GFBA 5CDGA 4YACA 2ZTUA 1YQDA 2HK7A 3ZV5A 4OM8A 3KYCA 3FD8A 3ZI0A 5IDQA 2I67A 1UR5A 1NQTA 4JLWA 3PRJA 3CSDA 2NVUB 1SOVA 4NFHA 3U62A 3DZBA 1HE3A 1YOVA 3GY0A 3WGTA 3H65A 1ADBA 1O5IA 1W73A 3ZU3A 4EJMA 1XU7A 3K2BA 4ZQFA 2OGUA 4J1TA 3S2FA 2Z5LA 3E9NA 1L7EA 4HFMA 1ZFNA 3ETEA 4IM7A 4IDFA 3BHMA 3DOJA 4DPKA 1QYVA 3C1OA 3DBLA 3O4RA 1YBMA 1YBVA 1P31A 1RKXA 2VYNA 4K9DA 5G0WA 3ZWWA 4CUZA 5JCJD 4N5LA 4H16A 3PI7A 1UP4A 4QEDA 9LDTA 1SEPA 1BXKA 2F1KA 5C7OO 1MA0A 4Z9FA 2WD8A 4S1VA 1PQUA 5CG1A 1YJ8A 2BRUA 3WWZA 4FB5A 2NVBA 2DTEA 4II2A 2OP1A 3BYZA 1X0VA 1WDLA 4XJTA 4D79A 1N8KA 2JHGA 4F46A 1CQIA 2VZ8A 4DQXA 2NLOA 5U1PA 5CP8A 4CM8A 1HDOA 1Y6JA 4PG5A 1VL8A 4UEOA 3VH1A 3U5TA 2C2XA 4Q3CA 2B69A 2ZB4A 1E6EA 3AI2A 4B7XA 3W8EA 3BTOA 3QIVA 1C0KA 2W2LA 2QX7A 5CDTA 1ZUD1 5DCWA 4B3IA 5DZSA 5BT9A 5JYDA 3DZKA 3K92A 1JA9A 3UHAA 3GEMA 3QJ5A 4YJHB 3OA2A 4WECA 4XA8A 4YTEA 2O23A 1SB8A 3L4BC 1DFGA 4R5MA 4BMNA 2CVZA 1ZH8A 2VUUA 3GRKA 4BV8A 4LMPA 3G49A 5A4DA 1I01A 5T8KA 4ND1A 3V2UA 4FFNA 3DC2A 4XRGA 1SZJG 3HN2A 2HAEA 3HB4X 5J23A 1PIWA 4YRBA 2VN8A 3RUAA 3D4PA 4YVFA 5ADHA 3QSGA 4E5NA 1W0CA 1HDGO 1P1KA 3AU8A 1OBFO 1WP4A 4J4HA 4OAQA 1F14A 1K2WA 2I9PA 3F4LA 4QT0A 3TWOA 2X5KO 4KWHA 1ULUA 2C7VA 3GT0A 2X9VA 2PA3A 3H9UA 1GPDG 1DHRA 3VPHA 4R41A 1YL6A 4YAGA 5DCYA 4WK6A 3OMLA 3RQSA 3GPIA 1LXCA 3UF0A 3S55A 4NMHA 2Y1DA 3U4HA 3V1UA 3PZBA 3GRPA 3OFSA 2AQHA 2FR0A 3BMOA 1K89A 3UH1A 2D1YA 3ZN2A 7MDHA 2I3AA 4BKOA 1YE3A 1L1FA 5ENVA 4CQMD 1VE9A 4RGBA 4UREA 3H5NA 4R3WA 3AM4A 1CERA 1MG5A 3TF5A 1YQXA 1P45A 5F5NA 3DMTC 1F0YA 4WEOA 4UVDA 3NGXA 1ENYA 3QVSA 4UEJA 5DP1A 5B4VA 4MVJF 1UXHA 4XCVA 3PXXA 2GN9A 3H8VA 3JYLA 3ANLA 4OIMA 1UP6A 1Y5MA 2J3KA 1EDZA 1LDGA 2VYVD 4IS3A 2R00C 3NTRA 2ILTA 1LC0A 2R2GA 2PGDA 3O38A 4XYLA 3FPLA 3UN1A 3VH3A 1DFHA 1WLYA 2PKQO 2PNFA 1C0PA 2I5PO 2VQ3A 3JYQA 3QY9A 4QFCA 2FOIA 1XQ6A 3RKUA 2VT2A 5DBFA 3WQRA 3WJAA 3S8MA 2SCUA 1O9BA 1PU2A 4FCCA 4D43A 2A35A 5JDIC 1Z82A 3FNHA 1RM3A 1I30A 1KVUA 3Q6IA 1SO8A 3NT4A 4I5FA 4WPGA 1A72A 1P1RA 1FF9A 3OJLA 5JO9A 4F6CA 3IKTA 4DWVA 4J4BA 2DKNA 3VAZA 2EP7A 1DOHA 4MP6A 4B4UA 3B6ZA 4BNMA 3ENNA 2C2YA 2VHWA 4YCAA 2HMWA 4IQ8A 5F1KA 3AOEA 4I1IA 4TKLA 3B20A 3OIGA 3P7MA 3QVTA 1KY5A 3KEOA 3F4BA 3BMQA 4IQ0A 3ENKA 1PWXA 2PH3A 4YAKA 1E1MA 3VTFA 1DEHA 4BIIA 1E7RA 2BFPA 4M55A 4XYMA 3VVBA 5DBGA 4BNFA 4C7JA 5B4TA 1GR0A 1ZIDA 3D4NA 3QV1A 4BGIA 5A3JA 3V8BA 1CQJA 1LRLA 3QQPA 2HK9A 4PG6A 4J4TA 5K6AC 4Y9DA 4TRMA 4FC6A 1F06A 5EJ2A 4D44A 3KZVA 2DU8A 2NM0A 1XSEA 2PZMA 3KV3O 3PZRA 4CQMA 1D3AA 3KB6A 5GZ6A 2BLLA 2IXAA 3CIFA 2HUNA 1XR3A 4HNGA 4FFLA 4QFDA 3NDIA 2RH4A 4PVDA 2ZTMA 1ORRA 3FBTA 1CIVA 3WX0A 2X86A 4OYRA 2RIRA 3BMNA 1E6WA 3G3EA 2YDYA 4WLOA 1KERA 4KP7A 1H6CA 2Y99A 3MJ4A 4EW6A 3JD0A 5U4QA 3ZNQA 1KC1A 1LTHR 2C5EA 3I1JA 3JTMA 3L0DA 3EHEA 3GAFA 3GDOA 2Y66A 4A03A 3IL2A 3DBRB 1LDYA 5DOZA 2BI7A 1U4OA 1CEQA 2ZTLA 1NTOA 3P2OA 5HBRA 2X23A 2E4AA 1LJ8A 3PP8A 1U2GA 4JROA 5K6AA 3ST7A 4CM7A 3E8XA 3I9MA 4HWKA 1XIVA 2I65A 4CLOB 2B83A 3INRA 3GFGA 4P4LA 2QYTA 4IIVA 3W6UA 3PJEA 2E82A 5FI3A 3RUFA 3ZWVA 4H3VA 2JJYA 3GMSA 3DFZA 3DHEA 4WLVA 3ROPA 2ZJ0A 5A9SB 4W9NC 1DLJA 2A92A 3DMYA 3HG7A 2I6TA 4AJLA 3LC1O 2JCYA 3DMTA 2AEJA 4XD2A 3FF4A 4L4SA 1LSOA 2X4GA 3L4SO 3JSAA 1JWAB 1C1XA 1P0FA 3JYPA 4Q3NA 2AEMA 3UKOA 3UVEA 4D7AA 3QVXA 1ISFA 2O7SA 1E3WB 5GMOA 3GGPA 2NQTA 1VC2A 2NVUA 4R01A 1J4AA 5BSGA 4JQCA 4BUCA 4IXWA 4O6VA 3VDQA 1MUUA 2EKQA 2GCGA 2WE7A 1H6BA 4ALKA 1UDCA 3AUSA 3JQEA 3W4KA 3NUGA 4NQZA 4EUFA 1BVUA 1GADO 1I36A 1IZ0A 4TRNA 1Z74A 4IINA 2GZ1A 1BXGA 4UVIA 4P22A 4IMPA 5IZ4A 5KCZA 3CXRA 3ZNNA 3KTDA 1AHHA 4GBJA 1E0DA 3HDQA 4JIGA 2C0CA 3I9JA 1DC6A 4QO8A 1ML3A 4DLAA 3L9XA 4D3DA 1EFKA 2Z95A 4A73A 4YBZA 3RU9A 4ZGWA 2X6TA 1R0SA 1LDMA 3GGOA 1BXZA 3NKLA 4OHUA 3WMWA 1U2DA 4J0EA 1MXHA 4C7KA 1MV8A 2JFGA 3EW7A 3GG9A 4U0JA 3KBOA 4P8RA 4BL5A 1Q0LA 1V35A 4MIEA 1E3IA 4GLOA 2CSUA 2HDHA 4CQLA 1Z6ZA 2NTVA 4XEHA 3RKRA 5FYDA 1I33A 4MKXA 3TRIA 1U7TA 4AJKA 2WYUA 2LDXA 2Y68A 2CF5A 3DFUA 5DDIP 4ILKA 5B37A 5KWEA 2RBEA 2YV3A 5IJZA 4M86A 3O03A 5JCXA 3VVCA 3EDMA 4Y8VA 2W2KB 3LVFO 4IGEA 5A05A 4LCJA 3RSHA 3K9QO 4IUYA 4AICA 2EP5A 5IDYA 4EJ6A 3TL3A 1HE2A 4NBTA 5T8KC 4CM9A 3ZGYA 2YJZA 3ZWNA 4J0FA 1MFZA 2PKRA 4RPLA 3DZGA 1MP0A 3WIDA 3PWKA 1IHXA 4I8XA 1RPNA 1RYEA 2B35A 2PK3A 3TZKA 2AQKA 2HK8A 3FI9A 4N54A 4PZCA 4BS9A 4UUPA 2OOSA 4AJNA 3AI1A 4NJMB 1NVTA 4LRTB 2B36A 2D4AA 1C0LA 5FF9A 2QHXA 3MCVA 3KLPX 1GUFA 4CLDA 1GFSA 3PDUA 2PZKA 1B26A 4DYDA 1ID1A 4RF4A 3ZWBA 3AUAA 3PJDA 3BTSA 5TS3A 3M1LA 3ZHBA 3C1TA 3ITDA 1PZEA 5BNTA 2GR9A 3KSZO 5GY7A 3NJ4A 2Q50A 1IZ9A 4BOYA 3QRWA 3RFVA 2NADA 4WEQA 1N9GA 2I3GA 4BNTA 5AQ1A 1Y7TA 1S7CA 3WDSA 2BF7A 2WD7B 4ND4A 1B7GO 5MGBA 1TLTA 1H2HA 4W9NA 3QWIA 3VPGA 2X8LA 1DFIA 1WVGA 2BI8A 5B4UA 1ARZA 4CMIB 3F47A 1FDWA 4CV0A 4D46A 4NDNE 1DRWA 3ZV3A 2H5LA 4IPTA 2VUTA 4B8WA 1IE3A 3RWBA 1PJTA 3DB2A 2PZLA 1U7HA 4GX1A 3MWDB 4KWIA 3JQ9C 2O7QA 3NTOA 1LRKA 4FBGA 2EXXA 3W6ZA 4IJUA 4LK3A 5A9TA 4XYBA 4NK4A 2YV2A 2PH5A 3DZHA 3IMFA 3OP4A 1HDYA 1E3JA 3N74A 3G1TA 2QRJA 5I7FA 3O26A 4L8VA 1IY8A 3JQAB 4CM3A 2ZQZA 4IDGA 3S1LA 2JL1A 1M76A 2AHRA 4W82A 2X0JA 4BO9A 1XGKA 1M2WA 1FJHA 1HSZA 3PJFA 4OSPA 4CR6A 5FEUA 3OSUA 2X0NA 1XYGA 2Y1GA 3WTBA 3I23A 1I2ZA 4F3YA 1Y81A 4E31A 1U8XX 4CQLB 4RO0A 1A7KA 1HEUA 2B5VA 2OBNA 2YHIB 4PIVA 4DIFA 4KUEA 2GASA 4A10A 4GKBA 4RVGA 3OQBA 4WGGA 2YQ5A 4XQCA 5KTKA 1YWGO 2DTXA 2VOJA 1MXFA 4QTZA 2EG9A 4U8GA 5G4LA 4YRAA 3ZWXA 4ZN6A 1U3UA 4B7CA 1DC5A 1DIAA 3NX4A 2JHFA 1T2DA 3U49A 4TRJA 3GVHA 5CEEA 1JVBA 2GSDA 3A9WA 3JQ8B 2QZZA 4IDCA 1PZHA 2YHUA 5KVVA 1T2FA 1HZJA 2ZCUA 4B4OA 4ALNA 1JQBA 3KSDO 2PD4A 1H94A 2O50A 3GMDA 4PZDA 5KJ1A 1E3WA 2IYPA 3RUHA 4BNUA 1HE5A 2X9NA 1LSJA 3ETGA 3ZWAA 3INGA 4XB1A 3LK7A 3UCXA 3FR7A 2DFVA 4R9RA 3QE3A 4GMFA 3D3EA 3D3WB 3E5MA 1EE9A 1OOEA 1T1RA 4FFPA 4I08A 2IRWA 2IDZA 3W4IA 1P1JA 3L07A 4WCDA 5JLAA 4BO5A 5HRUA 1NWHA 3ICPA 3OF2A 5IN4A 1KY4A 2B5WA 4OH1A 3NT2A 3BXXA 3G1UA 1X7GA 5AXDA 3M1AA 3KSUA 4JP2A 2WJPA 1BXGB 4KDFA 3RBXA 3RC1A 4J90A 1HRDA 5F3RA 3DZIA 5LCXA 3WS7A 4QO7A 5JBIA 4HNHA 3JQGB 3EMKA 2CVOA 4CR8A 4J7CA 4KQWA 4XKJA 2C07A 2CUKA 4RPKA 1NR1A 1P3DA 4GX2A 5G0SA 1H0KA 2ZQYA 1DJQA 1Y8RB 3C8MA 5CAEA 1IOLA 2POQX 2VWPA 2Q2WA 4ID9A 2QYSA 2FN7A 4LVUA 4D0SA 3E1KA 1GQYA 1G6KA 2AW5A 2VTDA 2XAAA 3JD3A 3MJEA 1ZMTA 2Q3EA 4PLHA 2OP0A 1TI7A 3H9QA 4P4NA 1D1TA 1B16A 2CY0A 1R4MA 2FHSA 3F6YA 3RCBA 3WYCA 1E6UA 2IE0A 4KOAA 3IIEA 4YAIA 3L6OO 2PTGA 4GWKA 5TJ9A 1YXMA 2AG5A 3OM9A 4II3A 4Y67A 1H2BA 4KDEA 4ESOA 2J5QA 3E48A 1I3NA 1XA0A 3LZ6A 3N7UA 3NRCA 4BV9A 1GUZA 4ROSA 2HCTA 5KVSA 1UXIA 2PV7A 3LLSA 5JSFA 1NQOA 4RVHA 3RASA 4BNJA 1JLLA 4PLGA 3MOGA 3HB5X 2RHRA 2ZJ1A 5DN9A 6LDHA 1YDWA 1UAGA 4WNCA 4FR5A 3U4CA 4DUPA 5A1TA 5JMWA 4GLLA 2WSBA 4IDEA 3WBBA 4B7UA 3ANMA 1OAAA 4WLUA 3AWDA 3T4XA 4CV3A 4OXKA 2FSSA 3DWFA 4BMVA 4HBGA 2LDBA 3EZYA 4M87A 4NIMA 3GNTA 3AOEC 2W4QA 2CD9A 4ZQHA 3ZW9A 8ADHA 3JD2A 4ZQEA 2B4QA 4OJNA 1ZZEA 5KJ6A 3LF1A 1MX3A 3DO5A 5I9NA 1J5PA 2X7HA 3BTUA 4XX0A 3GPDG 5CPBA 4DPMA 2PWZA 4Z9XA 3Q1LA 5TX7A 4R1SA 3BHJA 3U09A 5TT0A 1KC3A 4DMLA 1LI4A 1B8PA 2HMVA 3AUUA 1K3TA 4BMSA 3K31A 4K6CA 4YAJA 4H15A 3T4EA 4ZJUA 5DBIA 5TRTA 4OKIA 5IDWA 1ADGA 1B3BA 4U5QA 4N7RA 3D7LA 3AY6A 3LYLA 4CLXA 4FGWA 1BVRA 4OXYA 4MVJD 1R4MB 2PFGA 4RVUA 1LA2A 4YT5A 2E37A 3INTA 4FFRA 5A9SA 1TT7A 4Q3EA 4FC7A 4EGFA 1AXEA 1VRWA 1SOWA 3ZHZA 2WMDA 2GPTA 2Q46A 4HFNA 2BFOA 3GR6A 4GL4A 1ZJYA 3RUIA 3GDGA 3W8FA 3GK3A 3SXPA 1MC5A 4MVJG 2AA3A 2NVWA 4RZIA 1ADCA 2O3UA 1IUKA 3UCEA 3SC4A 4KUGA 4YJFB 4JXKA 5L45A 3ASVA 1G1AA 1HYEA 1VSUA 2E48A 3FRJA 3OIDA 5ILGA 3GG2A 5ILOA 1BGVA 3ETDA 2FR8A 5FFFA 3SVTA 3H6KA 1VL0A 3AUTA 1NASA 4IZIA 2H6EA 2HMSA 5JAIA 4IXTA 5K9ZA 3OJOA 1PJ2A 5L7TA 5CDSA 4R9SA 3B70A 3UFXA 4E30A 4DPLA 2VHYA 4AJPA 1VJTA 1K6IA 4XR4A 2ET6A 3CUKA 1TA4A 3JQBA 4MKRA 3L6DA 2HRZA 4Y6PA 1KVTA 2GRAA 3AM5A 3PHHA 3P19A 4RVFA 5AXBA 2BHLA 4BNGA 3IP3A 3L6EA 3NDJA 4Z6KA 4CUJA 5EQDA 4IJVA 3KOUA 4LN1A 4TMFA 2HU2A 3L77A 3R0IA 1YB4A 4CLOA 4CLRA 1U9JA 2FPIA 1BG6A 2DPHA 4BNNA 2J5RA 5HA5A 1FDUA 4BO0A 1O6ZA 1E77A 3AOGA 2GZ3A 1XDWA 1EUZA 5IFLA 3GZ4A 2UV8A 3GNQA 3B1JA 1RM5A 3KYDA 4J2HA 3AY3A 4E5KA 1YH3A 2JKVA 2W8ZA 4XWYA 1LLDA 2YZ7A 4WKGA 4IDAA 4LISA 3VKUA 1E7WA 3MTJA 4GGOA 3ROMA 2IZ0A 2VRCA 4LSWA 3DZJA 1HL3A 1Y8QA 3OA0A 5C37A 1B8VA 1H6DA 3WSVA 3F9IA 1CRWG 1KEUA 3VPFA 1Z45A 1QYCA 1NAHA 3ONEA 4O0LA 4R51A 2NU8A 4QECA 4YEDA 2OHXA 4Q39A 5T64A 1B3RA 3VPSA 1GY8A 4P4GA 5I7SA 2PLAA 5JFOA 1JTVA 1NBOA 2WE8A 1E7YA 4R16A 1NVMB 1QG6A 4I5GA 1FMCA 4WOJA 4XJSA 3ZWYA 4JN6B 1QKIA 3RFTA 1XEAA 4GGPA 4Y6SA 1E1NA 2Q1SA 4A2CA 4BNIA 2D0IA 4UAGA 3LDHA 4NG5A 1V3VA 3PQEA 3K8ZA 3PGXA 1WPQA 3G79A 1ZKMA 4CMCA 4AL4A 4IMRA 1NQAO 5IXSA 5I9LA 3HQ4O 3DQPA 3U0BA 4E13A 3LT0A 1YQGA 1DHTA 4JJIA 4PG4A 1PGOA 2Q2VA 4YXFA 2UDPA 4OSOA 1NR7A 3LLVA 4HP8A 3VC7A 4FIZA 1P1IA 2BGKA 2NNLD 4TVBA 1JAYA 4U6SA 4XGIA 1JAXA 2O3RA 2RHCA 2D5AA 4L4XA 2P4HX 4CMBA 4QUKA 4TZTA 4J2OA 2UAGA 4RLSA 5L95A 5B1YA 3I52A 4LVCA 2YFHA 4XIYA 1U1IA 1PQPA 1MGOA 3WMXA 4LRSB 4WE3A 4FJ1A 2JAHA 2DBRA 5ER9A 1GCOA 3RJ9A 3DAPA 2O2YA 4PCVA 4IQGA 4ZRMA 4JCOA 4FGSA 4UEKA 4R1UA 4DQVA 2QIOA 3PK0A 2GUGA 1XU9A 4GVLA 4XQGA 1J6UA 5H83A 1QRRA 2HJSA 1U28A 2PD3A 3PGJA 4Y98A 3VHRA 2OFPA 5HTOA 3VTZA 5A04A 3QA9A 5JCJA 1WXDA 3PHIA 1D7OA 4NBWA 3C7AA 3KLMX 4R69A 3AK4A 2OUIA 3FR8A 3PTZA 1I3LA 3RC7A 4E5MA 3HJAA 2HMUA 4ZA2A 5F1PA 1DC3A 1RM0A 1I24A 3FCOA 2X9GA 3E18A 2I99A 4PLCA 2YUTA 4XGKA 3GC6A 4LMRA 4CM8B 1ZVMA 5L53A 2BGLA 3ZDFA 1O89A 2HKIA 1N7HA 1EFLA 4R5HA 3EVNA 3ROKA 5CHEA 3HWRA 3I9OA 1LRJA 4U6QA 5A9RA 3NV9A 3V1YA 3ADOA 1E7MA 3UW3A 2VNSA 4RZHA 3JQGA 2VUSA 3M2PA 4J9VA 4R1NA 2OZPA 1LNQA 3Q11A 5HS6A 1GYQA 2FPGA 1XELA 4K1LA 1TT5B 5L4LA 4B8ZA 3PHJA 1ZJZA 3VKVA 1N1EA 1QORA 3OEYA 3V2GA 2GN4A 5AYVA 3TZCA 5A02A 1GU7A 3UAGA 4EJ0A 3TZHA 1PGNA 4YQYA 2Y05A 1GD1O 5KVQA 4MP8A 4C4OA 4KTVE 2EGHA 2NUAA 4PLFA 3KYCB 3PVZA 4E2XA 1HETA 1ENOA 2YY7A 4YRDA 3Q2KA 3IAHA 1HDRA 4K26A 3GNSA 2DQ4A 5CEFA 2J6IA 3DAGA 3PFFA 4CMJA 1IB6A 4FOOA 1E1LA 4BO8A 1V8BA 1V3TA 3SEFA 5CG2A 1P1FA 3GVXA 1EQ2A 3H5RA 2P9GA 4NZ9A 4UUNA 1N5DA 4URFA 2FP4A 1HDXA 2AEFA 1K5HA 5JY6A 3AY7A 1E92A 2HRBA 1H93A 4RF3A 1E3LA 3DBLB 4GI2A 3IQDB 3ZNOA 3M2TA 4DMMA 5KKCA 1I3MA 4CMAA 3GDFA 5A03A 2ZCVA 4NJMA 1LBEA 3R1IA 4I9UA 1YB1A 2FPPA 5IAAA 3ZU4A 3OQ6A 3LT1A 5A06A 3PYXA 4NK5A 1U3TA 5IXYA 1A4UA 1NM5A 2Y1FA 4ALIA 1XHLA 3DONA 1T2CA 1ISGA 3DHNA 2G1UA 3I6QA 4RQUA 1T4BA 1EDOA 5I9MA 4LGVA 2C54A 4AJIA 5JC8A 2P5YA 4NBUA 2BH9A 2OO5A 3ON5A 2O3SA 1UDBA 2GERA 2VRBA 4I9NA 3CE6A 1I32A 2DAPA 4IDDA 5G0UA 3U9LA 1IULA 3TOZA 4B3HA 3N58A 3QWBA 2VZ9A 3OQ1A 3TZQA 2C29D 3WXBA 1ZNQO 3OJEA 1ZK1A 4DRYA 2DBZA 4DBZA 2NTNA 1GYRA 3FWZA 3MJVA 1GEGA 2OXIA 5LDHA 1NPDA 3NJ8A 4R68A 1FDTA 1LC3A 2P4QA 4OGWA 1B15A 1HYGA 4RLHA 4IJWA 1YB5A 4WASA 1W8DA 3L4BA 1QR6A 2EKPA 4J9UE 1BTOA 1NNUA 3DOCA 2C20A 1NPYA 2ZB3A 1VKOA 2J5KA 3LF2A 5CFZA 4MP3A 4L9RA 1GL3A 1SMKA 1P1HA 4QQRA 1I8TA 3PQFA 4ZQBA 3R6DA 1SEVA 4WUVA 3EAGA 4WCFB 2BD0A 1KYQA 1KOLA 2P9CA 1RWBA 3DBRA 3U4IA 4FJ2A 3F5QA 3SC6A 4MVJI 4W99A 3OH8A 3HFGA 5DCUA 4JX8A 3E6AA 5DNAA 1YL5A 4NR0A 3JYNA 1J49A 4TKMA 4AJJA 1Y5RA 1M75A 3FNFA 3VZPA 3FBGA 1PSDA 5TGDA 3JQ7A 4NBRA 4WLNA 2BKAA 1SC6A 1YDEA 4J7XA 1R37A 3RFXA 4FFOA 2CFCA 2VYVA 2ZKLA 3VH2A 1NQ5A 2RAFA 3A1NA 4CL8A 4CMEA 4FJ0A 1NP3A 3TFOA 1UXJA 2CZCA 1UUFA 2E49A 4HX5A 4Z0PA 4OO3A 1PJBA 4EDFA 2Y93A 4W7HA 5COQA 3K5PA 3KVOA 4MO2A 1A71A 1XCBA 4EEZA 3HDHA 3ZV6A 1UZLA 4W4TA 4BB5A 4Q9NA 5I8ZA 4YT4A 1R12A 1F17A 1X7HA 4INAA 2FMUA 2EERA 2WTBA 4CMIA 4UUOA 3GOHA 4A7PA 5IZCA 3PIIA 4J1QA 5AXCA 3KXDA 3KRTA 2O48X 4J43A 1WDMA 4LCEA 1K6XA 1EEHA 4BNVA 5H82A 3O9ZA 2BFAA 3CMCO 4XQEA 2AE2A 4YJGA 2NV6A 5F5LA 5JXWA 3T7EA 3VZRA 2IEBA 4PLTA 1Q2XA 5ER6A 3NYWA 1YONA 3OETA 3KEQA 4JBIA 4Z0TA 1OZAA 3FSRA 2DM6A 3RROA 1XLTA 2ZB7A 3MEQA 2NSDA 3WSWA 3H5AA 4F6LA 1U3WA 3CEAA 1MFPA 1OC2A 4OQYA 4Y6RA 4WCFA 1D8AA 3TSCA 3BMNB 5TNXA 1L7DA 1LLUA 5THQA 2EWMA 3WGGA 1UZNA 1RM4A 2J3IA 1X1TA 4BO1A 2O2SA 4TWRA 4D0RA 3KETA 1Q0QA 1A4IA 1GTMA 3WOHA 3DDNA 1T4DA 1NFQA 2VRCD 2W98A 1C1DB 1Q7GA 4NU6A 1YS4A 2JCVA 1DIHA 2PZJA 1TXGA 3V5NA 9LDBA 3EZLA 3K96A 4ZU3A 4CLEA 1JDJA 1KIFA 3D4OA 4IS2A 5KKAA 4OKNA 3M6IA 2DVMA 4FW8A 5KJCA 3ROQA 4DXHA 1X13A 4E33A 1ENZA 1PTJA 2H9IA 5TF4A 3TNLA 1BMDA 2VWHA 1HDCA 3FHLA 4DYVA 2I66A 4OMUA 4CM5A 4YYZA 5EN4A 2Y0DA 1YGYA 3DBHA 1TB4A 3JV7A 2W90A 4MVJM 4YJFA 3TPCA 3ONDA 4Z3KA 1W4ZA 5JY1A 3QW2A 3RI3A 1ZSVA 4RQTA 1JW9B 3V2HA 5JDIA 3I9NA 1H5QA 3CPSA 5JDCA 2DBVO 2AMFA 4EYEA 2DC1A 1OFGA 3TQHA 2WM3A 1SCUA 4RL6A 4GMGA 3I83A 3FWNA 4CMGA 2Y1OA 3WNVA 2VWQA 3A4VA 5DF1A 2RCYA 5BNIA 2CF6A 5CPFA 4G2NA 2EF1A 2XOXA 1UP7A 3D1LA 1DIBA 1UXKA 3Q9NA 3B1KA 4CV2A 1QLHA 1VPDA 4MDHA 4RJTA 2CDBA 3SX2A 3ICCA 1LX6A 2G76A 3H3FA 1EVJA 3PDJA 3O8QA 1PJQA 2PY6A 3TFQA 5IDXA 4ZVVA 5TSDA 3LC2O 1PJLA 2CDAA 3WGQA 4OXNA 3TL2A 2EIHA 1Y1PA 1ISJA 4MJLA 2G5CA 5U9CA 3WGOA 1AE1A 4TRRA 3C7DB 3DL2A 5ICSA 4XQ9A 4AJ2A 4G5HA 1PGQA 2VHVA 2A9FA 2V6BA 3JQ6A 1U5AA 4NHEA 2R00A 2P5UA 1F12A 2EW2A 1R66A 2W2KA 3GVCA 1BW9B 4A5OA 5TQVA 2ZYAA 5TIIA 1TEHA 4GVXA 1EVIA 3MOIA 1E3EA 3ZV4A 4IZHA 4PG8A 2VYND 1DDOA 2O4CA 3WIEA 2D59A 3X2FA 1O0SA 1U4SA 3HSKA 1BHSA 1R0LA 4DIBA 2BELA 2XXJA 3KYBA 1SBYA 3CMMA 1VL6A 4J1NA 2EW8A 5EESA 1GZ4A 3HUDA 4HKTA 3RC9A 2NU7A 3DTTA 4RORA 4BKPA 4D42A 5TT1A 4NU5A 3IJRA 2VNAA 1FDVA 3ADPA 4FPXA 2EHDA 4PLVA 2QZ9A 1YVEI 1YO6A 5C7LO 4P38A 3BAZA 2AE1A 1QV6A 3H4VA 4TSKA 5C5IA 4AJHA 1OC4A 5L9AA 4PLYA 3WGIA 2C5AA 5TJHA 4AJ4A 2ZIZA 2D5CA 2C7GA 4E12A 1I2CA 3DBVO 3OJ0A 3GZNA 1P9LA 1U8FO 4N5MA 5EINA 4GX5A 3D0OA 1E5QA 3I4FA 4YDRA 2Z1MA 4HFJA 3WLEA 3IUPA 5ENDA 1GPJA 4NNJA 4D45A 1QV7A 4CM4A 5AVOA 4NFYA 1PGPA 1CYDA 2JFFA 3RJ5A 2GNAA 2OBYA 1MC4A 5DP2A 1ZK2A 2HO5A 4RDIA 4J7UA 3RD5A 3DBHB 2Q4BA 3RC2A 1GCUA 1JU9A 4RPHA 3DAFA 1Z73A 1HT0A 2B4TO 3R3SA 4HV4A 5BSEA 2V6FA 4DC0A 3C7CB 2NACA 1HLPA 1HLDA 3PHLA 4JGBA 1K6JA 3WFIA 4U7WA 5HM8A 3GN1A 3IOYA 4MPDA 1E7QA 5BR7A 3AI3A 1H9AA 2O3TA 4GAEA 4IGFA 5JMPA 1E5LA 3RBVA 2GGSA 4CMKA 4DLLA 1IHYA 4ZHSA 4L74A 1ZK4A 1LU9A 1H9BA 3GEDA 3KHUA 4WCFC 5A5FA 1DC4A 3QHAA 2G82A 2R6JA 3GVPA 4Q3AA 2GO1A 2DT5A 3OEWA 1M67A 1IPFA 1WDKA 2VHXA 4FS3A 2VHZA 5L51A 3A14A 5FWNA 4B4WA 1XKQA 1EBUA 1EE2A 2DUWA 2PKQP 3IUSA 5G0TA 5A3VA 3R3JA 3GHHA 3VH4A 1EUDA 1JKIA 3GEGA 4PLZA 1GDHA 1Z75A 4BGVA 3HHPA 1PR3A 4CR7A 2Q45A 3FNEA 2YFQA 3GVIA 1SB9A 3GA0A 3I5MA 3S2GA 3KM0A 1I3KA 1PJCA 3DOOA 5BSHA 1EK5A 1JVSA 1PZGA 3NTQA 2C59A 4QSMA 3ZW8A 2GN6A 1Y8RA 4XDYA 3U4DA 3C3XA 1T2AA 4UVGA 5JO0A 1AN9A 1D1SA 3NGLA 1R15A 4M1QA 4JBGA 4YT8A 3OECA 1H6AA 4J6FA 3S2EA 1E1KA 2V6MA 3EC7A 2QW8A 3GN2A 4BO2A 2JFHA 1EK6A 3CINA 1ZBQA 5KJEA 4ZD6A 4YT2A 4F45A 5EL0A 2X58A 1I5RA 2AG8A 2GYYA 1LQTA 3GGGA 2CMDA 1ZSNA 3IP1A 2YV1A 2PD6A 2VOEA 1OI7A 2OL4A 2Q49A 3DHYA 4MIOA 3ZCXA 5ITWA 1V6AA 4I9HA 1LDBA 2PGLA 4MVJP 5IZCC 1KVSA 1X0XA 1WNTA 2OMEA 4UUMA 4CPDA 3CZMA 3MZ0A 3E9QA 1U3VA 3JQDA 4BGEA 4DC1A 4E2ZA 4E21A 1QXSA 4BB6A 4HFRA 4E2YA 1HKUA 2GD1O 5JNLA 1V0JA 2EJWA 3H9EO 1GQ2A 1N7GA 2BFMA 1V3UA 3H9GA 1O94A 2GDZA 3BIOA 1LQUA 4XDZA 2JAPA 1PL6A 3F3SA 4JJGA 4AVYA 4MVJE 2TMGA 4RVSA 4WJZA 4KTTE 4CMEC 6ADHA 4E5PA 2D2IA 1M66A 3E5RA 3FTNA 2Y1CA 3BMCB 3DTYA 3Q9UA 3Q3CA 4Z9YA 3GZNB 1NAIA 3BMQB 1AGNA 2VCYA 5JS6A 3HE3A 5T5QA 5LC1A 2NWQA 1ONPA 3CH6A 3DXFA 1E3SA 3PEFA 5C7IO 1DIRA 1PWZA 2RH8A 1PS9A 1HE4A 4NI5A 2V6GA 2IEDA 4BO6A 4TROA 4Z0HO 3IC5A 4CM6A 1AUPA 4GPD1 3OHSX 3QVOA 1ISHA 3TJRA 2YQ4A 1HXHA 3ANNA 3IJPA 2EEZA 1ZK3A 5AOVA 1SPXA 3AU9A 3E9MA 1P33A 1ONNA 1YOVB 2JD2A 4IBOA 4J1SA 1V9LA 1ISMA 5L40A 3PWZA 4AG3A 1EVYA 3FTPA 4YWJA 3X2EA 1EQUA 1WW8A 5A5EA 3WWYA 3OJFA 1NFFA 3ZWCA 3L9WA 1EUCA 1W6UA 3WGYA 4OOFA 3JQ9A 1YKFA 2XPCA 3LT2A 1KEPA 3SJ7A 4CMHA 1Q1NA 1ZXBA 1C3VA 5CEJA 1I10A 1Q7CA 1X15A 4M54A 3OBBA 4MIYA 3WGZA 3WR5A 1AHIA 3KO8A 3P5SA 1G0OA 3SLKA 4Z3DA 1CJCA 4BNHA 2O4UX 2JD0A 1LDNA 1N2SA 3I4CA 1Q7BA 2B0JA 4RCVA 1QP8A 2X22A 4JK3A 4AJ1A 2P2SA 3QWHA 4S3MA 2H1SA 4WOKA 5BSFA 3F1LA 2UVDA 1NYTA 4R3NA 2P91A 1JWBB 4CLHA 3F46A 3WYBA 2G17A 3TZ6A 3WQQA 3JD1A 1WZEA 3GQVA 4GKVA 4BHTA 4O63O 1Y9EA 2NU9A 3JQCA 4FOSA 1LSSA 1X14A 4HXYA 2B4RO 4E0BA 4ALMA 3K73O 3VOSA 3ZWOA 1GUYA 4DREA 3NT5A 4XR9A 4NBVA 2HSDA 1ZEJA 5CDUA 4FD3A 4I5EA 3W4JA 3WGHA 3BTVA 1WWKA 3EVTA 5T6BA 4XIJA 1B0AA 1C0IA 1TVEA 1MB4A 2WWRA 4Q3DA 1R4NA 1DIGA 1VSVA 4DVJA 7ADHA 3E03A 1ISIA 2Q2QA 5LDGA 5IN5A 3ZU2A 1DRUA 2WEKA 4KQXA 4B3JA 2ZTVA 4ALLA 3H7AA 1Y8QB 1PS0A 1KVRA 3WG9A 1ZSYA 3EYWA 4EUEA 1ZO8A 2FY8A 4A27A 2UYYA 2FRDA 4XB2A 4UVHA 5KIAA 1VJ1A 8LDHA 4YA6A 4EBFA 5B12A 5ICMA 4EEXA 1FK8A 1FXSA 4RF5A 3PLNA 4GSLA 1HYHA 1PJ3A 2VT3A 4PFJA 1LUAA 2IYOA 3NEPX 4J91A 4WNIA 4MKZA 3I9LA 1CETA 1OMOA 3GUCA 4L73A 1BWSA 4DLBA 4PZEA 1O8CA 5JAMA 4TZKA 3I3OA 2IODA 4CUKA 1LLCA 3ORFA 3QVWA 1HDZA 4K28A 3TOXA 4YR9A 1EVZA 3WFJA 1PL7A 1WMBA 1IPEA 1YBAA 1C1DA 2PGJA 3W1VA 1A7AA 2PR2A 5ES3A 2TMDA 3K6JA 1KVQA 4MVJA 3JD4A 5L4NA 4E32A 1M6HA 4MINA 4NPCA 1IL0A 3BMOB 4KUHA 3FNGA 1LDEA 4BQRA 5JPIA 4G65A 4J49A 1GV0A 4OQZA 1JKFA 4A0SA 4CM9D 4RF2A 3WJ7A 1ZCJA 2CVQA 2DTDA 4N5NA 3TDKA 2GF2A 3RUCA 4YJHA 1ADFA 3DEYX 3UCFA 5KNLA 2WD7A 3F1KA 5COAA 4BNYA 1DAOA 1PQWA 1BSVA 5G4KA 5JYEA 1JN0A 2A4KA 2Q99A 4AFNA 3V1TC 2Q4EA 4I5DA 1DO8A 3MJCA 5DULA 1MG0A 1GZ3A 1KBZA 5T57A 2J8ZA 4MVJH 5JAZA 1LEHA 1I2BA 3GHYA 3MJTA 2Q1TA 3D5TA 3OIFA 3EK2A 4ALJA 4EZBA 2GN8A 3QLJA 1UJMA 1VI2A 1AXGA 3AM3A 5DOVA 3H2SA 1QLJA 2UUPA 2QRLA 3RUDA 2I76A 1QYDA 2B37A 2Y67A 5JAQA 1C14A 4J16A 4IY1A 4NJOA 1KETA 3UOGA 2IZZA 4IJKA 4PG7A 4PLWA 3JQAD 4CLRB 4L4RA 1ZW1A 2GLXA 5I7EA 4TQGA 3PYMA 3STHA 2YDXA 4D3FA 1DB3A 4M8SA 1N9GB 3AJRA 3G0OA 5L7WA 4HADA 2P68A 1T1SA 1TT5A 1A5ZA 4CM4B 3JQFC 4IDBA 4GQAA 1B8UA 1R4NB 3SBOA 4O5OA 5JDCC 1VLLA 1MLDA 1UDAA 1QSGA 4RDHA 3ZNPA 3C85A 1FDSA 3JQFA 4M89A 5L3ZA 2D8AA 2F00A 4RV9A 3D3WA 1GV1A 1GAEO 4XRRA 2J3JA 3PQDA 4FN4A 2DPGA 3NDRA 3E82A 2AXQA 1NXQA 1WMAA 1BW9A 3H3JA 2NTJA 3U3XA 1NVGA 1A9YA 4ND5A 1WAMA 4UULA 4ZICA 4HY3A 5L7YA 4BNLA 3HN7A 4O59O 5EPOA 4RVDA 3JQ8A 2HLPA 2VWGA 1XQ1A 2DUUA 3ZU5A 3JYOA 2ZYGA 3KUXA 4MOWA 4D41A 1P74A 4DTIA 3RVDA 1X7DA 3JQBC 1CF2O 1NWCA 4BGUA 3RU7A 1HWYA 3K30A 4NFSA 1T24A 3JQAA 1HZZA 2X5JO 3WQSB 1ONOA 3MJSA 3F5SA 4ND2A 1QMGA 1ZEMA 1G0NA 4DGSA 1PX0A 4L75A 4PVCA 3RAJA 1KS9A 4RPGA 3GAZA 5K0ZA 2FR1A 3PWSA 2EV9A 1M6WA 3RBZA 1VJ0A 4BNWA 1HF3A 4EI2A 1WZIA 4XGNA 3HADA 4JP3A 1ZK0A 1ZXLA 2ZATA 3A28A 4OL9A 1GZ6A 2OORA 4BO7A 1Y9AA 3EGOA 2IXBA 4M49A 4XYEA 1QYXA 5DT9A 1NHWA 2H63A 3D64A 4KMSA 1DPGA 3G17A 4BNXA 3A06A 1DJNA 3OICA 3UGKA 1BRMA 2WYVA 2Y0CA 1UXGA 1NX6A 2Y1EA 5EQFA 4ITUA 3TN7A 3PHGA 3I9KA 5JW6A 2D3TA 2X1HA 1P0CA 5TLSA 2FWMX 5GZ3A 4OOEA 2WYWA 3EUWA 2AQIA 2NU6A 2Z1NA 1NHGA 2Q1UA 1P77A 5KOIA 1UH5A 3P2YA 4YJGB 4CODB 1EBFA 5L4SA 1CWUA 3WTCA 5F1OA 2HQ1A 1VKNA 4BKUA 5GZ1A 5G0VA 1DLIA 1RYDA 2QQ5A 1B14A 1O95A 4ZRNA 1F8GA 4GSKA 1HSOA 4PGFA 5T67A 4ND3A 4BKQA
chains in the Genus database with same CATH superfamily
3O4JA 4E88A 1GGVA 3VVLA 2ATCA 3SR0A 4DNXA 1XKTA 4M37A 4QUJA 1R0KA 4QJ4A 4RMGA 3IQIX 4RV4A 3UXYA 1NW9B 2BTQA 2IIPA 4XYGA 4F5EA 5KVCA 2R6R1 1MX5A 1Q1EA 4ZV7A 4ZI5A 4AJOA 3WNQA 2C9DA 2GPBA 1H66A 4PHTA 2BVNA 2PBZA 1K7YA 2XXAA 1Y4AE 1S89A 3SSAA 1AS3A 2HLDA 3R5KA 3CVXA 4ZREA 3CG4A 5D6NA 4OFWA 4F6RB 4Q93A 1QWSA 2RGBA 5LVAA 2ONKA 2Q5OA 3RVOA 4CHTA 1RQLA 1PV1A 4PN3A 2ZYVX 2HSWA 1HH4A 3LQ1A 2NYRA 2OGSA 1F4VA 1DO2A 2Y2VA 2ZS7A 2BUAA 3HV2A 5IKXA 3PNSA 2YHIA 3ETJA 3D7KA 4UDNA 1UDXA 4Z1OA 5FJIA 5JRJA 3NHMA 1EMDA 1VQ1A 1D1QA 1JXQA 2RBGA 4JEHA 5KNCD 1U2SA 3OFNA 2NUAB 1H3EA 2OZEA 2KS6A 2B82A 1Y1KE 3HC7A 3LUFA 1S6YA 4JUCA 2HW8A 2OR3A 2RHWA 3LCJA 1NRJB 3B1FA 5JXHA 4JT4A 1RHRA 5AVUA 3I53A 3CZPA 1I0ZA 1N7IA 1NONA 3AZPA 2BRUC 3L92A 4YB8A 1CIJA 5JPIA 1D2CA 2MJLA 4YPOA 1YFZA 2CBZA 3K70D 1GEEA 8OHMA 3R9XB 2BGMA 4TUYA 3QBDA 4ZT7A 3ZTYA 4BNZA 1MQ9A 4GZMA 4JSYA 4PF1A 3M3HA 5FRDA 2PUJA 1L5NA 4D74A 1BN6A 4IIUA 5JC1A 3SZOA 3MM4A 2CNBA 2ZYRA 3IAS1 4FYHA 5CH5A 3ZVLA 2CC2A 4CM4A 4AJEA 3LSTA 1V5GA 4E6PA 5JIBA 5HGXA 5EKDA 3A31A 4DLZA 2FZEA 1E6CA 3L7NA 1KORA 3PFWO 3JQRA 1N2XA 4ZQGA 4LF6B 4H7PA 1SVSA 3I6IA 3I37X 4KR7A 4RH1A 4G0NA 4B3DA 4TWIA 3V4SA 1GTJ1 4Q1AA 2O05A 3GJ8A 4LPSA 3WL3A 1SA0A 3LT4A 3WYEA 4KHPB 5CVDA 1WX1A 1PSZA 5CK5A 3U4QB 3ZGXA 1E79D 4EG1A 8AT1A 2Q21A 2VAPA 3GJXC 4EELA 4KODA 1DSSG 1GQQA 1WMSA 2VNIA 1TPZA 2VNJA 3TAHA 5C8YB 5KNCH 5IF3A 4V2IA 1X8JA 4DV3B 3AFNA 4IEEA 4MGZR 3ASUA 4UD6A 3H1TA 3QE0A 2NYVA 4G0OA 3LY8A 4I1PA 2PT9A 1XWWA 3AEUA 3QP9A 4XW2A 4MI1A 5THKA 4DWJA 3QX7A 1SJ9A 2CDCA 1JI0A 2VH5R 3QXXA 1PJ4A 4UHBA 1IYZA 4R54A 4LHZA 1TLFA 3C8HA 1GPKA 5HK9A 9MHTA 3W5BA 4A8HA 1FSGA 4JJFA 3HFSA 3HU3A 1G60A 5CCBA 4ZWNA 4NZNA 2INGX 1Q17A 1EXWA 1SQ5A 2V1XA 4FSHA 4Y6LA 3VPDA 3ILSA 4CKCB 3ECAA 1CUXA 2GZMA 1ZGGA 1I2DA 3IQHX 5CH3A 3A0UA 4HYQA 1B41A 4FLMA 3H2ZA 3G0GA 1NATA 1L7PA 2C4KA 2DPXA 1CUDA 1OR8A 1QZUA 1QIEA 2ZYDA 1IB0A 1PS8A 2BR4A 2HA0A 1E6LA 3PSHA 1EA5A 4QU0A 5K3CA 3W8DA 3AFMA 1E3TA 3HGQA 1CDEA 3G5LA 2W5UA 2DHQA 2V4ZA 4AYWA 4EYGA 3ZJTA 4AKTA 3I2KA 1XYYA 2Z58A 1CEEA 1Z6XA 2L19A 4E2WA 5I9BA 2HJRA 2P9EA 2V0NA 5ICEA 1AKVA 4R1LA 3UHFA 1K0UA 1X1EA 5AOAA 1LNSA 4G0PA 4B79A 5I7VA 3D5QA 1RZUA 3ORQA 2QG9A 4DDVA 1Y8ZA 1Y37A 2I8CA 5BNFA 2V7XA 4JB3A 3JCZA 4IO1A 3TZEA 1Z26A 4JVMA 2XGJA 2GZ2A 2QGZA 1MTOA 2DR0A 2E6UX 4KRXA 4X1YB 1SD5A 5C31A 2P9TA 3AKYA 3UUWA 3OESA 4CL3A 4EI8A 4Q7QA 1RXWA 5JNWA 3PVCA 4TLAA 2FWRA 2OYCA 1A9ZA 1PZFA 3BX1A 1M33A 1LCIA 4AZSA 1QZTA 1G8PA 1SVNA 4WVFA 2BKXA 3WADA 1VM6A 3U3KA 2GQ0A 1Z4OA 1COWD 1NYLA 1W5SA 3KWLA 3EY4A 4Q3BA 4LE0A 4NEQA 5EJAA 5G2OA 2D1TA 2VZ0A 1ENPA 4DL9A 4PLPA 2IELA 4FLEA 1KWKA 3BWCA 1FMJA 1GPBA 4EMTA 1LLQA 5ALHA 1US8A 3KIPA 2X5OA 4BPRA 2EQ5A 2Q5EA 5DRYA 2Y27A 2IZ1A 2O6LA 1B2LA 3FPCA 3NWPA 2C7QA 1ZM9A 2B1JA 1N6IA 4LHSA 3AHHA 2ANCA 3JVVA 4IH1A 3NM4A 1O87A 3VI3B 5FOVA 3WGVA 1P4SA 2XB8A 2HMTA 4UFOA 2DY1A 2QNRA 3H9JA 5GONB 1XNQB 3O21A 1EUYA 1UZMA 4MGHA 1Q0HA 2JD1A 4JNKA 5K8IA 1V8DA 4M6WB 4CV1A 4CYMA 3QE9Y 3ONFA 1XAIA 1YQTA 3LI2A 3OQJA 5SYAA 4D3SA 4XTRA 5DVZA 1O3YA 2X2OA 4ZALA 3LM8A 4Q19A 3L4KA 2AR0A 2XGMA 3GARA 2ZRKA 4JP5A 4YACA 2GVNA 2ZTUA 1DX6A 1YQDA 4TS3A 1V1RA 4C4AA 3NYIA 1C9YA 1EWYA 2ZSFA 5CYPA 3MVEA 1CZNA 4NMWA 1QS0B 3V55A 5K0CA 1YJAA 3OZEA 2X0EA 1NQTA 1KMQA 1SOVA 2A1UB 1WNFA 2XNKA 4NFHA 4ABYA 2QD3A 4ETIA 5LJLA 1YOVA 2OT3B 4GYWA 3BM5A 4FGUA 4MR8B 4B31A 4DVGA 4OXRA 5CYGA 2YS7A 1W73A 5JD3A 3QKRB 1JAIA 5BV7A 2JLSA 1G5HA 3K0HA 3Q1KA 1WQ3A 1EYZA 4JR1A 1G4UR 3DOJA 1ZNXA 1JLMA 4UCXA 4CDNA 3HKCA 3C1OA 3DBLA 3IIIA 2XJ9A 3O4RA 4V0QA 3TQQA 2CXOA 3KB2A 3O8OB 3D4LA 2HWXA 4XARA 3EEFA 4AMVA 4OTZA 3NVDA 2F6RA 2WOJA 4N5LA 5AI6A 2DWQA 3GUUA 3PI7A 4JOCA 1SEPA 1BXKA 1UMCA 2F1KA 3CWQA 3JATA 3KZMA 4G86A 1YE5A 1Z6AA 3TTUA 2NAFA 2WC1A 1RLTA 1NJ6A 2WD8A 3DE5X 4PZ9A 4Z9FA 4N6NA 2CLOB 2QGFA 3LQ2A 5CG1A 2BRUA 1RKVA 3OZRA 1PFYA 2WY2D 2YV5A 3W2FA 2NVBA 2DTEA 4II2A 2OP1A 3BYZA 4IMIB 1I14A 2QI9C 2ZZMA 3RF7A 3AVWA 1ZDMA 4D79A 1L3IA 3O6VA 3QV2A 2FH5B 4PU0A 1B93A 2LW7A 5KYYA 3H3XA 3ZE8A 4BYMA 5U1PA 5J2UB 1APBA 1MORA 1PG5A 1WUTA 4P7JA 2Q4TA 3KOOA 4I4NA 4PG5A 2G0NA 3WA7A 4UEOA 3AV0B 3EG9A 2B69A 2J9YB 5F78A 2QS9A 5BN4B 2XD9A 1AQUA 4GBMA 4K9QA 1Q6YA 2Y9PB 4QGFA 4TLLB 4YCDA 4O4IF 3WGNA 3QFCA 4HJRA 4E51A 5DZSA 1VG1A 3EXEA 2B92A 3PC8C 2V7WA 1SCBA 1M2NA 2JVJA 5BT9A 4EB0A 2O7VA 3TIFA 3R8CA 3MK31 4DM7A 2D7JA 4WY5A 4F3NA 4WECA 4CDRA 4TQAA 3TOSA 4WW0A 3CJQA 2R3SA 3AKCA 4Q66C 3W34A 2R7NA 2C95A 4BV8A 4LMPA 2H2DA 4MYUA 1CQWA 4X1YA 1WB9A 5TQ2B 4FFNA 4ZQIA 4ZVLA 2QXTA 5ICFA 2OV8A 1CUVA 4YRBA 2VN8A 4MUYA 4F1WA 4P7GA 4E5NA 4DDUA 1W0CA 1HDGO 1P1KA 2A1IA 1OBFO 3EVGA 4MDYA 4OAQA 1F14A 3GJRA 5KAPA 3S1AA 3F4LA 3FYSA 1ULUA 1Z7YA 1E63A 1G8AA 2D5LA 3GT0A 3O7MA 4AY6A 4L6CA 1MRZA 4A6PA 1GPDG 3GPBA 4BN5A 3KOXA 3VPHA 4YXWA 3DMDA 4HTFB 2HGZA 3ZCTA 5C51B 4LV8B 2F9LA 2ZRDA 3W2GA 1LXCA 1OV6A 2GD6A 3MN1A 3PXCX 4X84A 5JSUA 2Y1DA 3U4HA 5FUWA 3IQGX 5GVSA 1LBIA 4IL5A 5JSHA 5I9TA 2E89A 1T1EA 1T6ZA 5NLLA 2FR0A 3UMCA 3BMOA 4UTXA 3ZU6A 3OBIA 1C2TA 3UH1A 1SRQA 2BSAA 2D1YA 3NHLA 1KK2A 1L4HA 1UDWA 1E2MA 2CCKA 3G9TA 2JFBA 1JXAA 4KKXB 4P3YA 4EFMA 1L1FA 5J4VA 1XJ5A 4BLPA 1QC5B 1WA5A 4R2XA 4RK7A 3ZJ4A 3VSDA 2I1WA 5HPYB 4HQNA 3T3NA 5FBLB 3W77A 4WEOA 3Q7RA 3CPHA 4UEJA 1ST3A 1Z2EA 2MOKA 3C3DA 3I04A 2EAUA 4MVJF 1L7QA 2HGSA 2F48A 4WADA 3R9IA 2YZNA 1TRKA 1NYRA 1ZNWA 2GN9A 3H8VA 1BWRA 1KEZA 2JVIA 421PA 4D8YA 4OIMA 5H59A 5C8ZA 4N41A 3LX5A 4JUAA 4D9NA 3VDMA 3N8NA 4TUYB 5BVGB 2C9BA 4JLKA 1HQDA 3KUUA 1BHJA 1IY0A 4HGQA 5CDHA 4KEAA 2I4IA 4XVRA 3UN1A 3O3CA 5TMPA 3BGIA 5CDFE 1LKZA 3OG9A 3DKRA 3IUMA 1THTA 4C30A 1XQ6A 5BV2P 1C3OB 5JS8A 1HQYE 3NANA 4RA6B 2VT2A 3ZD6A 5DBFA 3AFIA 3HL4A 2GEDA 2O0LA 1T9ZA 2A35A 5E3IA 1Z5ZA 2PDAA 4BLWA 1KVUA 1Z06A 3IYLW 4HNRA 5BSRA 4KNVA 4TV8A 1JIQA 1SO8A 2FQ1A 2KLBA 1HE8B 4M83A 4ND8A 3K4PA 1O6FA 2WMOB 4YP9A 1GOTA 3F0TA 4UAJA 4G1BA 2VTBB 1MAAA 1JXMA 5AKEA 4Q02A 1M0EA 2VF4X 3DNPA 3KQPA 2M1ZA 3NHWA 2OSVA 4J4BA 1AKNA 1KYWA 2XAUA 4MHSA 1RP7A 3VR6D 1EUDB 3ENNA 3OSZA 1QHXA 3U1BA 1U6KA 2ZJOA 5DH9A 4A6DA 4IQ8A 1FE8A 5JU6A 1YUMA 4I1IA 1Z16A 2QX9A 3WRXA 2YC4C 3F4BA 2YFYA 1AX9A 3ENKA 4C3UA 4LJAA 3HCCA 4TM7A 5FUXA 1KKLA 1P29A 1DMRA 2XNHA 2BFPA 4FQ7A 2N47A 2P9JA 4UZSA 4ZO8A 2K7ZA 3K53A 4EVQA 2IYZA 7YASA 5BW4A 1Q2UA 1Z9BA 4ZOLF 4U2EA 5B3KA 4ESVA 1H1TA 4BNFA 3PDCA 1R8SA 4C7JA 1GR0A 4JYZA 2RJNA 3JRWA 4BGIA 4X3PA 5AJZA 3SICE 3I2HA 5IH3A 1TQDA 3V8BA 2ORED 4W5RA 2O1EA 5PGMA 4AXBA 4ACAA 2FNAA 3KVNA 3N2GA 4EATA 1W2GA 1U3FA 3EE6A 4FC6A 1PJZA 4WA7A 5HMMA 2YWXA 1UFVA 1PQ4A 1Z17A 1JGTA 2DU8A 2HQBA 2QT9A 3VO1A 3FOFC 2PZMA 1Z37A 4Z49A 2R85A 4O1IA 2AD5A 2ZJYA 1KO4A 1OWNA 5GZ6A 3EXFB 2QVBA 2IXAA 4HNGA 2HUNA 1XR3A 2WKQA 3UJ8A 4Q9HA 2ZTMA 2R7LA 3N2YA 3FBTA 1CIVA 4Q3OA 4IDPA 1R9JA 3D4BA 4QAQA 2BSQA 2GBFA 2VPIA 4CU5A 1XMVA 3PD7A 3TLZA 3QEKA 5E7IA 5JXJA 3DLBA 1W36C 4I55A 3UJ7A 2HA7A 4KP7A 1SCJA 1VL5A 1SXGA 2A3RA 2XJ4A 3O8OA 5GVRA 4C07A 4EW6A 2ES4A 5BYAA 2QRVB 1ZICA 1IEVA 2C5EA 3EHEA 2ZDQA 1E96A 2J0UB 2NU7B 3GDOA 2DB3A 2R5NA 2QP3A 5HCNA 1E9CA 3JATB 3DBRB 1UMCB 4WJKB 3GGJA 3NHPA 3TCXB 4IRUB 2EKDA 1K8XB 3DBIA 2WA1A 1KI7A 2HPAA 2YY5A 2ZT7A 2X23A 5HJ2A 1V5FA 3ST7A 3WMRA 3UQYS 3I6MA 3OQMA 2Z5VA 3LVBA 2GA8A 4HH4A 2ZYWX 4Y6GB 4L8WB 2HHHB 1PNTA 5LM3A 2J32A 2WFLB 1YVPA 1WL8A 3H2GA 4OMDA 4NPHA 4H3VA 4NYMQ 2DFNA 2WSSD 3EG9B 3ROPA 5A9SB 3IXQA 3UTCA 1DLJA 2CXSA 2DUNA 3RVRA 4MI9A 3HG7A 1E2PA 2JZOA 2WF9A 2I6TA 3OC0A 3GW8A 4PPQA 3HCBA 5KOHA 1J97A 1W2WB 2P1RA 3OM0A 4M6WA 4JD5A 3UK1A 2AEJA 4XD2A 3R0QA 1CT9A 2FEMA 2XZDA 5JR3A 1LSOA 2X4GA 5BXQC 3L4SO 1SKYB 4DLRA 3JSAA 4PSCA 5JTTA 2QMOA 2VP9A 5EJFA 1Z4JA 4NEGA 3B51X 4Z4GA 3TFWA 3UWDA 2BFBA 2G4CA 4D7AA 2PZBA 5JUWA 1JFTA 1CIPA 1E3WB 1GZ5A 2PGNA 1E5TA 1YDFA 3QVLA 1QQBA 5CA1A 2HV9A 4Q37A 1IHDA 3OZBA 3LH5A 4GU5A 1FDIA 4IXWA 3JPWA 1J07A 3LV8A 4G23A 3VDQA 2EKQA 2WE7A 2XTAA 3CX6A 5EJ9A 1RYFA 3JQEA 3QOWA 3CZAA 3W4KA 1NNSA 1QQTA 1UADA 3NUGA 5AK3A 3WMGA 1GADO 1I36A 2IEAA 3CWCA 1B74A 1N2CB 3ETCA 1OT5A 2B4KA 3AW8A 1G20E 4UVIA 2FWJA 1ZIXA 5IZ4A 3A10A 4J3JA 1NI5A 3P9RA 2X2FA 4CN9A 7ABPA 3KTDA 1E0DA 1OTYA 1GFIA 3HDQA 3OLVA 3WNDA 4JIGA 5KDOA 4YO8A 1PUIA 2PR7A 1ML3A 4GS5A 2O7NA 4LKRA 1EFKA 2YWEA 3OF3A 1CQZA 4A73A 4ZGWA 1YZUA 4MULA 2G09A 1UC8A 3GELA 4L5IA 3H1BA 4XI9A 4OHUA 2ZRGA 1NBEA 4LOAA 3W3AH 2CL5A 4RZUA 4S04A 3EW7A 3GG9A 2VPTA 2HMYB 4V0SA 3RSOA 3KBOA 4H59A 4P8RA 4BL5A 4HGPA 4DDHA 5LQNA 10MHA 1N1DA 1Q0LA 1V35A 3OWXA 2XE7A 3GEIA 4LNAA 4QNMA 4RABA 1ZIPA 5FHQA 1PHRA 1S8OA 2YZKA 3NDBB 3D6MA 2ZJ2A 2C8KA 2NTVA 4XEHA 3RKRA 1E0SA 4YRKA 5BUQA 3S0JA 2C0PA 3TRIA 3LCRA 2Y68A 5DDIP 4ILKA 1C1YA 2RBEA 1JIKA 3IQZA 5DO9A 3Q8KA 5AD1A 4M86A 3O2NA 5CM9C 1RAFA 3T5CA 2RD2A 621PA 3EDMA 3WQHA 5E3HA 1ODCA 2W2KB 3ER9A 4K2HA 4IGEA 4Y9RA 2R6HA 3UKDA 2G9VA 1QH8A 3D2LA 2QM7A 3UZUA 1N6HA 3DOIA 4OLAA 1VKHA 4LCJA 2B7CA 3K9QO 5I47A 4FNMA 4LJSA 3TL3A 1DTWA 1TJ5A 3GRAA 1BGXT 2YJZA 2VO1A 4R31A 1YIDA 4YDHB 1IWBB 1EA7A 1FNMA 1G3UA 4MQ6A 2YRWA 2J9GA 4IFEA 4ETNA 1M7HA 5DNWA 2VSFA 2A58A 4O4JB 3BIWA 2WU4A 1QHEA 2R8YA 1CC1S 4PWZA 4B5LA 4QWMA 1PKXA 1RYEA 2C9ZA 3PKZA 3RB8A 5JXIA 1NXXA 4KX5A 3U3MA 4UUPA 2DCMA 2GKOA 1CZKA 3KQNA 4AJNA 4HAIA 1ZPDA 4NJMB 3EXG2 3DTNA 3MWFA 4L0MA 4D4IA 2W00A 5EHXA 3CZ9A 2QF7A 2HREA 3AUJB 1C0LA 1ANKA 3L79A 3M9XA 2QHXA 4M22A 5KI6A 5LB4A 4NHOA 1L5VA 1NNLA 1EWVA 2PZKA 4HB4A 4AUNA 3H2BA 4IH9A 2FEPA 2TRSB 4QZVA 4JI4B 1NTRA 2R8BA 3O8CA 4I50F 1WBDA 1TAUA 2IW1A 3QZUA 5TS3A 1F2UB 4JBXA 3C1TA 2QORA 3E70C 4KN6A 5AW6A 4LDZA 4H9GA 3T7JA 4YMUA 1RFLA 2O14A 5GY7A 3NJ4A 1IZ9A 2B8NA 1P1BA 4C4SA 2JRCA 2Y76A 1I6KA 3FMVA 2ZRIA 1GZ7A 1CR1A 1QNLA 3G7SA 4Q1EA 1QUFA 3O94A 1SC9A 1URPA 2I3GA 5DX0A 1IDOA 4F3KA 5AQ1A 4FKZA 3H5LA 4LHEA 3H1GA 1TLTA 1I7SB 4BFSA 3KTAA 1NBHA 1JMVA 1GNPA 1R2QA 2X8LA 4W9NA 3CNBA 2ZUFA 4V3CA 4WY2A 2BI8A 2PVPA 3UMRA 3F47A 1U9ZA 4CIAA 4YI5A 4R0NA 2R25B 3BFJA 4B8WA 1IE3A 3CN7A 1UOQA 4P5PA 4NOMA 4IZOA 2EP8A 4OK5A 4DCOA 5CFQA 4IQ4A 5IBQA 3OOYA 2H2AA 4B2PA 5JATA 4HLUC 4OFZA 1PAUA 2O7QA 1T3LA 1LRKA 3FUTA 2EXXA 3H8WA 3M5DA 4L27A 4RKWA 3KPWA 3V00A 4Z1MD 2PH5A 3LCVB 3NM5A 4EARA 5I3CA 4BMCA 1ZM3A 1BD4A 1E3JA 1ICEA 2BEKA 1EP9A 3RSFA 2CGEA 1G2IA 4DR3B 4L8VA 3EJ6A 3JQAB 4LY0A 1CP3A 3ET5A 3VPCA 1P2SA 2AHRA 2FUNB 3GEPA 4W82A 5BMVA 1UPCA 1DKRA 2CNWD 3FCEA 2ZDGA 1NNEA 4BO9A 4O4LB 1E6KA 1GJRA 3K70C 5E7MA 1FJHA 1CK4A 3MLAA 3AVVA 4ENPA 3PJFA 4OSPA 2GO7A 5E6UB 3KHKA 5FEUA 3L0IB 3DUFB 3BQ9A 5JJIA 2OCKA 4DGQA 2PX0A 2JJQA 2Y1GA 3FHOA 4Y2QA 1FXUA 3UNXA 4QEZA 3I23A 3WTBA 5LA6F 1Y81A 2XGSA 4U39A 4E31A 2FETA 5KOJA 5DTMA 4W5QA 3FLMA 1GNVA 2OBNA 2B9EA 3SAJA 3GLKA 4NE2A 4KUEA 5H3LA 3L7OA 5KYWA 4GKBA 4RVGA 4MPTA 4MV7A 1J2JA 1Z0AA 2WFLA 4ZT2A 4XQCA 3R3XA 4KWTA 3CW8X 4LJLA 1YWGO 1PF7E 2OCLA 3THSA 5KTKA 4NYJQ 4QYTA 3S40A 3EN0A 3OWHA 3WB1A 1AB5A 2YJ3A 3ZQKA 4XPIA 2WWIA 5JD5A 4BE7B 3LNTA 3D8RA 4DS3A 2DUJA 5F35A 3WYGA 4C2UA 2CW5A 2PYZA 3HVKA 3L7IA 4GLFA 4HLUA 2EX4A 5H3HA 1ZR4A 4B0OA 1GPUA 2CHUA 1WS6A 2GSDA 4TS4A 2NT4A 2Q5JA 2QZZA 1PZHA 3IOBA 1Z12A 4FXPA 4KMMA 5JPDA 3A1SA 1KGSA 4KLNA 1HZJA 2ZCUA 4UBIA 4YGXB 4ALNA 1XK6A 3W5DA 2XWQA 2O50A 2R9VA 5EWJB 4Z5XA 1L7AA 2R68A 3LCCA 6Q21A 5HRAA 2X9NA 1LSJA 3ETGA 5ARCA 3ZY2A 1IATA 5JYBA 2DFVA 1D0SA 3FCAA 3HL0A 4EKGA 2JB9A 2HA4A 2KM1A 3E5MA 3DH0A 4S1NA 4XDGA 5D7BA 1P62B 5DLYA 5DHRA 3WWDA 2JA1A 4RETA 2WRZA 1VHJA 2WT4A 4FZJA 3A37A 2X3YA 5K8VA 4B3RB 1RU3A 3OUZA 5C3UA 3W4IA 5JWOA 3L0BA 3MC1A 3DZDA 4AF8A 4UHKA 2DEUA 4LGMA 5JLAA 3ESQA 4BO5A 1COZA 2DULA 3UUFA 4XVCA 5IU6A 1KY4A 5AVXA 3AWIA 3KSUA 3FIJA 1WMDA 1UBFA 4N39A 1SULA 4Q1FA 1FYVA 4IGKA 2WJPA 2OOKA 3A2LA 3GJ5A 3I1FA 4ID3A 3ZGYA 4KDFA 2V4MA 3IEXA 3RC1A 4J90A 2HCJB 2XCUA 4NPAA 4QO7A 4ZV4A 4NZYA 4EQZA 5JBIA 5K4HA 3L8YA 4P82A 4AMZA 2C3PA 4RENA 1LK5A 3MMZA 1W46A 4R84A 4TS1A 1SIWA 3H87A 4KQWA 2FFHA 1T3HA 1C8LA 5BN3B 3IULA 4WOPA 3H5IA 2RCNA 5FBKA 3ZY5A 4WCVA 2H16A 2ZZNA 1QFZA 2AOTB 3GCWA 2EFHB 1D2HA 2FQXA 2ZQYA 1DJQA 2HOQA 3C8MA 3JR7A 5F64A 1CZLA 1RACA 1T34A 1IOLA 3DT6A 4PIPA 1Q57A 3DAYA 4ID9A 4PYMA 1HFEL 4D0SA 1SWWA 3JD3A 2IUSA 2NOAA 4OHKA 3MJEA 1YTUA 1WPRA 2AIRA 2GDJA 2CZQA 2JGDB 3EIXA 4YDSA 3ANSA 4B47A 3MUFA 4M1YA 4MEJA 4RBNA 2PTGA 2YOHA 2O8NA 3KJZA 3OM9A 4ESOA 3W6OA 5HIMA 2AS0A 2J5QA 2R5FA 1HK7A 1EZ1A 3W06A 4UNSA 1WR8A 3M6FA 5FOQA 2AF4C 4NNOA 4AN4A 2BE9A 5C1DA 3H75A 3FPHA 1UXIA 3LLSA 2XCLA 1VMKA 3IAFA 1NQOA 1J56A 3NJRA 2AL7A 2HH9A 3PFIA 1GGFA 4U2KA 5IBCA 3QKIA 4RMNA 4ENRA 1Y1RA 3EBPA 2ZJ1A 3HB5X 4JLUA 5DN9A 1YDWA 1UAGA 1YU6A 3CUYA 4DY6A 5A1TA 5JMWA 1OU0A 3ZEAA 1OAAA 2UKDA 2WZQA 4CV3A 1T9KA 3EY9A 3DWFA 4YR7A 3TGWA 3QFHA 4MYDA 1Q15A 4RIHA 1JBQA 1U8AA 2Q2NA 4GNRA 1R88A 4NIMA 4YK7A 1XMIA 4TYMA 5E6SB 2XD4A 5IYZF 4H7IA 4DCCA 5JNRA 2BFEA 5F98A 2R1UA 3Q7SA 4QNRA 4OL0A 3C6YA 4ZQHA 3ZW9A 8ADHA 4ZQEA 5A6SB 3C2QA 1QK4A 2GMWA 2C78A 4NE7A 4OJNA 1WSAA 1I4TD 3VOAA 1QHFA 1N8NA 4ZYZA 4UU8A 5KJ6A 2O59A 1GGJA 1MX3A 3EVZA 2ZI4A 3GYGA 1J5PA 1DVRA 1Y1QA 4ISCA 1PFWA 2E9SA 4K87A 1DCKA 1USVA 3D0RA 1MJNA 2CMGA 2ZUSA 3DE6X 3EGCA 4XX0A 5ALXA 4R0VA 3RRZA 3FYUA 2ZM5A 4B43A 1X1RA 3OOEA 5TX7A 4FZ5A 2Z9DA 4PC1A 3WLIA 4B6OA 2IJGX 2WV9A 4R1SA 2AK2A 2LBPA 2ON6A 3IQFA 1PWEA 5DWDA 5TT0A 1NY6A 1J23A 4V1CA 2HMVA 1F0NA 2ZIEA 4RZ3A 3V2IA 2P1DA 5D3ZA 3KKPA 4QWWA 2XDAA 1MW9X 1GTZA 3GROA 5DBIA 5DB4A 3BD8A 2FZGA 2IPXA 1CY8A 2QN1A 3I64A 1H1LB 3D7LA 3E8SA 3LPCA 3QMWA 2ZIFA 3BSSA 1CQXA 3MWJA 1BVRA 3Q12A 4FGWA 2XB4A 4MVJD 4UM9D 1R4MB 2PFGA 2Z8ZA 3DGEC 4HDRB 4QPCA 4EKDA 4X7BA 1LA2A 4YT5A 4IVRA 1E2EA 1QONA 2C2WA 3RK1A 1JAHA 1TT7A 3D6JA 4N1AA 1B43A 3Q6NA 4FC7A 2ZRLA 1HURA 1KJWA 1AXEA 4H1HA 4UM5A 1SOWA 2HNBA 4N8EA 3VAAA 3PT9A 4TVKA 4GL4A 1LW6E 2EQBA 2AUMA 2G8LA 3BC1A 3DVRX 4DUPA 5IVHA 3D1JA 1M8FA 4UKDA 4RZIA 2QOEA 5H80A 1IUKA 3RS9A 3L4JA 4BIMA 4MQ5A 1P2VA 2VBIA 4NMXB 5IJ0B 1UBGA 5L45A 2OZKA 3EXIA 1DJMA 2C4MA 3N86A 2E48A 3OIDA 3FRJA 4HQ0A 3K35A 4FE7A 3ECCA 5FFFA 3CBQA 3SVTA 1V6CA 3NKVA 2BTEA 4PZYA 1VL0A 2EHJA 3HYSA 2Q2OA 3N0TA 4N9WA 5BR4A 3K1AB 3Q8MA 4P84A 3ZHCA 5IXJA 1SXIA 3D3QA 5L3SB 1RYZA 3DGFC 4LYAA 5LQDA 3K9FC 2AJCA 1PJ2A 4Z99A 1ZOSA 2HF2A 4A91A 4NCHA 1SKBA 3UFXA 4E30A 1G21E 4DPLA 2O0KA 2V6JA 4DY4A 2O8DA 1G5TA 3SYMA 2ZTHA 4C1NA 4V0LA 1VJTA 4G85A 4QKQA 3K9HA 5A4KA 3B3AA 2CVPA 2HRZA 3EQ7A 1MJHA 1OA0A 2R6CA 3AM5A 4S1TA 4ZOLB 4EB8A 2WAOA 1DRJA 3OI7A 5AUPB 4QATA 1IHOA 4HHEA 1KDVA 2PS3A 1M2KA 3C6XA 3IP3A 2RHJA 4GICA 2JF0A 3TNDA 3KOUA 1NJ8A 2WDPA 2QR5A 2C0QA 3PNOA 2HU2A 3ORYA 4UBOA 1VMDA 1F2VA 1Q74A 2DPHA 2P65A 3ADBA 1NBMD 2C9MA 5FOSA 4J0GA 2BOVA 1PLKA 3A6KA 1E2HA 4HQKA 4NARA 3TDMA 4CHGA 4P3PA 3AOGA 3U56A 5KYUA 1RZRA 2GZ3A 1F8UA 4AMYA 1LY1A 3FGPA 3H11A 1TJNA 3E81A 2UV8A 3GZ4A 1KMHB 3QNMA 7MDHA 4J2HA 4C88A 3AY3A 4H7FA 3WLKX 5EZQA 3ZK7A 3TQSA 1LLDA 3BICA 3DE4X 1PR2A 3N2LA 4MUAA 4WKGA 3R9XA 3PT5A 3BJZA 1OU4A 3BXHA 2BCEA 2GESA 3MTJA 4GGOA 5JMTA 3CG0A 3HB7A 2JG3A 2WYOA 4FNAA 3QA3E 5ITSA 2MU1A 1T35A 2MYTA 3OA0A 4EPYA 1B8VA 2EATA 4KFRA 2BM8A 4DJEC 3WSVA 1ODSA 2RGWA 1X39A 1KEUA 3F9IA 5A62A 1FQWA 3ONEA 4Q4JB 3M6MD 3Q8XB 3UQZA 4WNAA 4AMBA 5BW6B 3EF0A 1UFOA 3NMUF 2Q5LA 4Q3KA 1GY8A 3OWOA 4RADA 3IPLA 3VPSA 4E94A 4LZZA 1DWUA 3B89A 5FV7A 2NSYA 4JIMA 1BHQ1 4I5GA 1W75A 2EWWA 3LWBA 3T7DA 1VCMA 4TUYF 4WOJA 1J24A 5HE8A 1K92A 4YI3A 1SC4A 3RHFA 4GGPA 4ZVPA 2SCUB 3DJFA 2BGTA 1PEYA 2X1VA 4UAGA 1XO1A 2ZT6A 2QU7A 2VT7A 4V1CB 5IUNC 2PAFA 2ZRAA 2F59A 1ESEA 3G79A 1UPTA 3FH0A 4CMCA 3FDFA 1NQAO 4F60A 1W0JD 1RPAA 1SCAA 2QJWA 4MRSA 5CD1A 2YIJA 5HKKA 3WDLA 1PGOA 2Q2VA 3HCRA 3OT4A 4OF4A 1SU7A 4HDCA 3DWEX 4ZAWA 3TVDA 3UYKA 9GPBA 3WLTA 5FLXA 4OSOA 3CUEF 2BDEA 4IUDS 1F20A 4DYHA 5CCXA 3OHMA 3GLTA 5TARA 3Q7EA 1P1IA 2NNLD 4U6SA 4TVBA 2IPAB 4XGIA 4B17A 2ZJ6A 3GFRA 1T8UA 1JAXA 2FQYA 2O3RA 5EMJA 5FA5A 1UBRS 3Q4GA 4YDQA 3FGNA 3UBTA 2FWBA 1KI4A 5LOVA 4EY5A 4CT5A 1KYZA 3BWMA 4RLSA 3AG5A 4ZJPA 1M2HA 4PHHA 1J9GA 4EI7A 5B1YA 4EGQA 3TE6A 3KAKA 5E0OA 5DI9A 2XCQA 3WMXA 4OHCA 1NVFA 1Z2CA 2PT7A 3CWZA 2HWKA 1NMYA 4FJ1A 2JAHA 2DBRA 2H1VA 2EJTA 1GCOA 1YDHA 2JLRA 2Y1KA 5DK4A 2R47A 2WICA 3DAPA 3ZX4A 5FULA 5IBPA 4E6EA 2IDMA 2O2YA 3VO8A 2JH8A 3C87A 3O4GA 3MSCA 5MFPA 4HMQA 4QUDA 4FGSA 3QHPA 4I55F 3EEBA 5C1PA 3R9WA 2QIOA 3PK0A 2GUGA 3TH5A 3ZI7A 1XU9A 4YV1A 4Q4LA 5U9CA 4RTKA 4LSGA 1EFHA 3PUJA 1M8KA 1U28A 4P83A 3B53X 3PGJA 1OIWA 2FMXA 4TLDA 1L4KA 5JCJA 2ACKA 1D7OA 1T3SA 1Z13A 5BUCA 1YMQA 1SQFA 2IUYA 1I3LA 2R66A 3PTZA 3RC7A 1CZOA 3ZDEA 1TQHA 4LRXA 5CW1A 2AFVA 5GM1A 1DC3A 2DH5A 1I24A 1SA0B 2XVXA 5D51S 3WKDA 3ZYCA 4BZXA 3EXG1 2YTZA 5AJTA 3G0IA 3E18A 1T13A 5KTPA 2YUTA 1TTTA 4B8YA 3IR6A 2BFFB 5J4LA 2BGLA 2QQGA 3R23A 2PYIA 3ZDFA 1IXYA 1P2TA 2OV2A 1DX9A 1M1NB 2GBGA 1JFVA 3BSWA 1N1MA 1WVIA 3O2JA 1P7PA 3UM9A 4U6QA 3WHPA 2H59A 4CCSA 2QPTA 3OPYA 2VJYA 3NV9A 1BFUA 3RRBA 3V1YA 4WD3A 4KQ1A 1RLMA 4TYNA 3DBOB 4BVLA 1P4HA 5JADA 1V4BA 1SKQA 2G83A 2OZPA 1WHSA 3PFGA 4L15A 1FFGA 1FRFS 5HS6A 3HPQA 3NXSA 1PW7A 1INLA 4C6RA 2CNDA 3L43A 2QVZX 3HNOA 3MJRA 4PHFA 1CY1A 1ORHA 2P0YA 1N1EA 2RKWA 2ZBQA 3SYLA 4Z8XA 1WUYA 4RYDA 4QASA 1YS1X 3TZCA 1WSDA 3A9UA 1GU7A 5EMKA 1NL3A 3ZJYA 3ZVRA 4EJ0A 1J42A 1K9SA 2ST1A 3EQ2A 5EXTA 3T4PA 1RRVA 3IHWA 2EJUA 1XDUA 4MP8A 1EDDA 1EEXB 1G8SA 3WLAA 1C4KA 2NUAA 3BSYA 4RYLA 1RADA 3X1YA 3PVZA 1LBHA 2FSFA 3HO6A 1NBMA 1RNLA 2XCTB 8GPBA 1T9GR 4RKQA 4A4DA 4HCJA 4KYUA 3N05A 1L5HB 3N8DA 3VGJA 3OD1A 5AKIA 3WL5A 4EHDA 1NBIA 3DAGA 1FNNA 3DT8A 2E18A 2WYHA 4HB3A 1X80B 2IS1A 3SEFA 5CG2A 1XD8A 2AW3A 4ZPJA 1EQ2A 4NZ9A 2QX8A 3OPVA 4URFA 2FP4A 1YT5A 4CTKA 1K5HA 5JY6A 2HRBA 1IZ7A 1UIMA 1J8FA 1RTTA 3ZNOA 5BN5B 3JRNA 3KKNA 4KITB 3MMNA 5KKCA 1IN6A 3RRNA 1HFWA 2KB0A 1V4VA 3FPFA 2VDVE 5HFAA 5IWAB 1BVHA 2VDWA 1QZZA 1LBEA 4FDUA 1LVUA 1YB1A 5HSGA 1OLXA 1DU4A 3EXAA 3OQNA 3JWEA 4X94A 5I9SA 3FCCA 3E9CA 4Q1CA 4K46A 2IHTA 3UXEA 3B9RA 3TECE 3I39X 1T0JB 4RFSA 1KY3A 5GONF 1A96A 1NM5A 2Y1FA 1JSRA 2GTPA 1DV2A 1U2TA 1F0KA 3DHNA 3ZCUA 4UE6A 1MAHA 4I4IA 3TJMA 1I1QB 4F4HA 3K2QA 1PR5A 4AJIA 2C5GA 1H8ED 2VDPB 2AZMA 3P4XA 1GG2A 4RD0A 3RYIA 2BH9A 1TUBA 2XMCA 3FPKA 1ZH0A 4L9WA 1CVRA 4S1OA 1MH1A 3UPTA 5KU1A 1UFRA 1T5OA 3U9LA 4CQJA 1ZH2A 2HRQA 3TOZA 1JEAA 3N58A 5BSUA 3N2GB 4OAPA 2VZ9A 1Z2DA 2Q0HA 3FWKA 3U3DA 1K9VF 3VZDA 3T5AA 1USWA 3A9CA 3GRFA 3HRIA 3QU7A 4MQMA 4EHBA 5EJ5A 3AP2A 5I4IA 4JI2B 3A9SA 3OJEA 2CV2A 1RLUA 2AKAB 4KGDA 5LYJB 2KHZA 3PPVA 4AM8A 5B6JA 3HBAA 4NAHA 3DEZA 1YVDA 3IVGA 1ZD8A 3FWZA 1KQPA 2O52A 3MJVA 3NBFA 3VISA 3LBFA 3ZE6A 4Z9BA 3H4TA 4WVLA 3TRKA 1FDTA 1LC3A 5D5PA 1PYDA 5EVCA 4U4AA 4DEVA 2PMDA 4LWQA 1JPUA 4RLHA 4LSZA 3SEZA 4D96A 4PAOA 1YB5A 2PL5A 2G1AA 4O1HA 1MOQA 2B3DA 3L4BA 4NTZA 4ZZ2A 2BE7A 1BTOA 4ZAXA 3IE1A 4TMKA 1NNUA 2ZB3A 1MRSA 1VKOA 2QVXX 2VPQA 3LF2A 5LDDC 4OQMA 1Y9DA 5AI4A 5FTLA 1HTTA 4ZQBA 1ODIA 3UJ3X 1J2EA 4WUVA 2HQOA 3EAGA 4WCFB 4GZ5A 4P98A 1F3OA 1U8CB 1HDIA 2HNKA 1ZUNB 2P9CA 2VG8A 2I3BA 2QVLA 2WM8A 1KJIA 3DFMA 3FKSD 3H2JA 4DIEA 4L57A 1SHLA 1O57A 3K9BA 4PAWA 4ZEVA 2HK6A 4JJZA 5DNAA 2QMYA 4OGKA 5TE9A 4NR0A 2CLHB 5AJXA 4M1TA 3PTAA 4LA4A 3FMFA 2WKRA 2G72A 5T6MA 1PNQA 1O58A 1Z5PA 5AOBA 2P7HA 4RD3A 1GQSA 3UXHA 2HLHA 3DLAA 3VZPA 4G0WA 1EP2B 1U0TA 2X8JB 2AXEA 1PSDA 3FBGA 3N87A 3NXKA 3ELUA 2FMHA 1L5FA 3AERA 3ETLA 7REQB 3JQ7A 2QDKA 1CF4A 3OLQA 2SECE 4IV5A 5IVDA 2OV3A 4J7XA 5LA6A 2WIAA 4QVKA 2XZOA 5ALWA 2G08A 2O0JA 2O2GA 1N0UA 1TA0A 1NQ5A 2D5IA 1PK8A 2ZYUX 3A1DA 2ZUVA 1JUDA 3EF3A 3K4HA