5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
1E92A 1JU9A 2VCYA 1LRJA 4R01A 4DLAA 1V0JA 4WLOA 4YQZA 3TN7A 3DOCA 4D44A 4GSLA 2X0IA 2EIHA 3TF5A 4YJDA 3KYBA 1WDLA 4Q3DA 3GQVA 4OHUA 3VPHA 1XCBA 3IUPA 3JD2A 3S2GA 3ZV3A 3EVNA 3GMSA 1PIWA 4RPJA 3JQBC 2VYVA 4B79A 2EERA 4NJOA 4GVLA 1YB4A 2UUPA 2VUUA 3H9JA 4IM7A 2CF6A 1ZXLA 3INRA 4DIBA 1B0AA 3T7CA 3UCEA 4CUKA 3FTPA 4X54A 5H83A 3WMXA 1GYPA 3UCXA 3I52A 5ES3A 3F1KA 2HMUA 3GPIA 4L4XA 2R00A 1HYGA 4Z0PA 3ZWAA 4E33A 3ROMA 1HZJA 1RJWA 3S8MA 5JCJA 4J2HA 3OA2A 1EFKA 3TJRA 3AM4A 1PSDA 5TT1A 3MOIA 4NH4A 1DXYA 1VJTA 4AFNA 5A9SA 5F21A 2V65A 1MX3A 3R3SA 2FOIA 4XJSA 2XAAA 5C7OO 4L9RA 3EZYA 3DBLB 1HKUA 1LSOA 3GEMA 2GLXA 3P2YA 1PL7A 1GUFA 1CETA 3EAGA 3C1AA 2JCVA 1DEHA 4DPKA 4CMBA 5L3ZA 3LLVA 4G2NA 1C1XA 4NBUA 3WTBA 4NU6A 3JQGA 1KERA 1EDZA 4OKIA 4Z9YA 3BMCB 5B4VA 2AEJA 4UEJA 1VC2A 3FD8A 1EVIA 3WICA 1DBVO 3I4CA 1SB9A 3PYLA 4NFSA 1JAXA 3P2OA 4BKUA 3VKVA 2H63A 3QSGA 4NMHA 1P0CA 4JBIA 5TC4A 3PWZA 2VHXA 1U3WA 4U0JA 4WGGA 4J1NA 4FFPA 3SC4A 4IY1A 1Y9AA 3Q2IA 4G81A 5G4LA 4J1QA 4ZQGA 7MDHA 4MVJM 4XIJA 3QVTA 2BKAA 3MJEA 4XB2A 1ADBA 2JHGA 3I9OA 3JQFA 3AW9A 3RUEA 3GEGA 1CRWG 3ENKA 5AXBA 1NWHA 1S7CA 1W8DA 2W2LA 2GN4A 4GI2A 1BVUA 1F8GA 4CJXA 3OHSX 1FDUA 1IZ9A 3ZHZA 1U8FO 4IMPA 3GDGA 4IS3A 3HUDA 3M1LA 1PZHA 1EVJA 2PZLA 2OGUA 1KYQA 4IDEA 1RKXA 4RCVA 1LA2A 3UUWA 4LK3A 4BO0A 1IY8A 4ZN6A 2G5CA 3DZBA 3I9JA 1I2ZA 1E7RA 3BMQB 3TRIA 3VKUA 1YB5A 3CXRA 1BRMA 4NNJA 4GQAA 4BKOA 3F5SA 1D4FA 3I83A 3RUFA 3FBTA 2FSVA 4GWKA 4TRRA 4GKVA 2FPPA 4B3IA 2ZB7A 4R69A 3OEYA 3CE6A 1W73A 1F0YA 3H9UA 1PJLA 1X1TA 3D64A 2PWZA 3OJ0A 4XGKA 2DLDA 3GGGA 4E5KA 1UR5A 4ONEA 5JMWA 4CL8A 1ZBQA 1U3UA 3TZ6A 5IZCA 1NP3A 4JNKA 4UVHA 4YJHA 1JDJA 1GUZA 3GRKA 3GN1A 2WSBA 1AN9A 2DBVO 3GG2A 4YT4A 3VTFA 3OMLA 1G0NA 4J9UE 5GZ3A 2P9GA 4II2A 3L4SO 5C3MA 3L9XA 1HT0A 2ZB3A 3D5TA 4KDEA 3ZDFA 1CWUA 3WS7A 3BAZA 1KY4A 3L6DA 4WLNA 1IPEA 1QR6A 4YT5A 1HDXA 4E32A 2VWQA 1ONOA 3LC7O 4ZD6A 3ZHXA 4CUZA 1N2SA 2OXIA 1W0CA 3NT2A 5G0SA 3UCFA 1HXHA 3PHHA 3AK4A 1SNYA 2YUTA 2R00C 4YQYA 1R4MB 5ILGA 3ZW8A 1ZCJA 4XYBA 1PJ3A 4FGSA 2Q4BA 1JAYA 5TJ9A 5FEUA 4BMVA 4YRBA 4Q39A 4PLVA 3TSCA 4XWYA 5JYDA 2DTEA 4XGIA 1YDWA 1DRVA 3WSVA 3EHEA 1SAYA 4CLHA 2IZ0A 4NZ9A 1XSEA 1NHWA 2RH8A 3WWZA 4LVUA 3RU9A 2DTXA 5EL0A 4GBJA 4J6FA 1X7GA 2VOEA 3JV7A 3KETA 4CMHA 4J2OA 1RM4A 3ULKA 1GV1A 1GZ6A 4B8WA 1U8XX 5TT0A 1HETA 2P4QA 3WX0A 2EP5A 3VZSA 5H82A 1Y81A 2CDBA 1KIFA 2DBQA 3DMTA 1V3VA 3S2IA 3ON5A 1N5DA 4CQMB 2X23A 3ZV4A 5A3JA 4HFNA 3FTNA 2VQ3A 3RAJA 4CQLA 1RWBA 3IKVA 3PYXA 3QVXA 1WNTA 4I5GA 1G1AA 3PJFA 3VDRA 2JCYA 2OORA 5G0VA 5JO9A 4XIYA 1T2DA 3WG9A 4DQUA 4RPLA 1PGQA 5AXCA 1HDGO 2IYOA 2XPCA 3TQHA 4BNMA 3JYNA 3CIFA 4UUPA 5K6AC 2AE1A 3QWBA 1BXGB 1A9ZA 2DPGA 3IP1A 3QHAA 3JCZA 1HE3A 3PFFA 2PY6A 2FPIA 3U49A 2GN9A 4BIIA 3JQ7A 2HKIA 3CH6A 3LT2A 1UZMA 4YAJA 5KJFA 3PVZA 2TMDA 2DPHA 2X5KO 1AE1A 2HRBA 3E9NA 3QV1A 3PTZA 5IDYA 3HADA 4BO8A 3S55A 4MVJI 5T8KC 4NG5A 4CMCA 4F6LA 1KEPA 1LC3A 4JXKA 4MIYA 4YJGB 1P33A 5DULA 3ZNPA 3OJFA 1QP8A 3HDYA 3LC1O 4WLEA 2ZYGA 4DGSA 2WYVA 2Y67A 2AA3A 4J90A 5CDUA 2NLOA 1U9JA 2GRAA 4MKZA 3WGOA 3DQPA 4CLEA 4U0KA 2HMVA 4BNKA 2I6TA 3IDSA 1R0LA 2X4GA 4CQMD 4GX2A 5IZCC 1I2BA 3NYWA 2RIRA 4IJWA 4QECA 2D5CA 3JQ9C 3GVXA 4YWJA 1X7HA 4NDNE 2AQKA 3B1JA 3RVDA 5JC1A 1ZJYA 5DBFA 3KSUA 3RC2A 1LJ8A 4NBTA 1NQAO 4PLCA 4YR9A 1GQ2A 3BMQA 4IIUA 3GDFA 3IL2A 4DA9A 2HSDA 3ZV5A 2JL1A 4HNHA 4R1SA 4CM4B 3TPCA 1LSSA 4M55A 2YJZA 2HK7A 1ZK3A 4BO9A 4XRGA 2G1UA 4Q3EA 2CZCA 3W8EA 5KJ6A 2UAGA 2E49A 1ZIDA 4UVEA 2I67A 4YCAA 4ZGWA 2EW2A 2PZJA 3DTTA 2EXXA 3ANMA 3IJPA 5EESA 2HLPA 4Q9NA 4XDYA 4R1TA 1CDOA 1E0DA 1Z7EA 1KETA 1UXGA 3F6YA 2CVZA 1EE9A 3VVBA 3RUAA 1EFLA 4WPGA 2O3SA 1X0VA 2E37A 1PGOA 4LGVA 5CG2A 1R12A 3NTRA 5IFLA 5FF9A 1S6YA 3GVCA 2EV9A 3I9NA 1U5AA 1SMKA 3FSRA 5JAQA 3D3WA 5MDHA 1JQBA 1DJQA 1ADCA 2ZTLA 2JFGA 4N18A 2NVWA 3AY3A 2HMTA 2WYWA 3DBHB 4O59O 1YRLA 1P1HA 1DPGA 1VKNA 1N7HA 4YT2A 4RZIA 3PWSA 4XYLA 3I5MA 1E6UA 3E82A 4WOKA 1ENPA 5I8ZA 3ABIA 4KMSA 3AI1A 4LISA 3OM9A 4CM9A 2YYYA 2QYTA 3KOUA 4E0BA 2FN7A 3X2EA 1KVRA 3W1VA 5A9RA 4I9UA 1NAIA 5BNTA 4OH1A 3V5NA 1G0OA 2VUTA 2VZ9A 3WDSA 4XQGA 2Q1TA 1JKFA 3ZU5A 1U3VA 1JA9A 2A35A 1KY5A 1P1RA 3TZKA 3VPGA 3I3OA 4XB1A 1N7GA 3H9GA 5ER9A 4W7IA 3H6KA 2GN6A 4YPOA 2GNAA 5CDGA 1YBAA 2GD1O 4QT0A 3F5QA 3GNSA 5TIIA 1ARZA 4QXMA 1Y6JA 4CV1A 3NUGA 1LSJA 1O6ZA 2G82A 4DIFA 3RU7A 4AJKA 2BFMA 4HP8A 5AXDA 1XLTA 1L1FA 3BYZA 1B8UA 5L4LA 4JBHA 5L51A 1V3UA 3RIHA 1YL6A 1PEDA 4MINA 5DP2A 3A4VA 2C0CA 1NX6A 1QRRA 1LDEA 2HCTA 4BO6A 2YFQA 4TWRA 5I9LA 4OJNA 3TFOA 5EERA 2P91A 3MCVA 3PXXA 2C2YA 4E5NA 2I76A 1O94A 2VN8A 1WPQA 3VPXA 2GO1A 1J5PA 3BTSA 2DU8A 4ND1A 1XQ6A 5A04A 4PG6A 4WNCA 3WLFA 1CEQA 5MGBA 3PP8A 1VRWA 4FIZA 4BNZA 3MJSA 4DVJA 2P2SA 2CNBA 4KUGA 3GG9A 3LQFA 2TMGA 1C1DA 4YJFB 3ETGA 1U4SA 2ZTUA 4BNTA 4RF2A 4ZVVA 5CFZA 1SEVA 1TLTA 5T8KA 1VKOA 3NV9A 5EIOA 3GF4A 4YA6A 2C7VA 3SC6A 1P1KA 4CMJA 1NPTO 3ZU2A 2YV1A 4FBGA 1GR0A 4G5HA 1JTVA 4HADA 3LSYA 4Y8VA 1PJTA 4P4LA 5HS6A 4YDRA 1MXFA 4OAQA 3JYQA 3E5RA 3HE3A 2H5LA 5G2OA 2FR1A 1T1SA 2VYND 3BTVA 3ENNA 1XGKA 1SOWA 4D79A 3W6UA 1OC4A 1ZK4A 2EEZA 1H6BA 2A9FA 3FI9A 1P74A 1ML3A 3KYDA 4N5MA 5H81A 1E6WA 4GH5A 4EITA 1PGJA 4IJUA 2WWRA 2O7QA 3A9WA 1C0PA 1DRWA 3ONEA 4CR8A 2VNSA 1H93A 4FFRA 4IZIA 2PD6A 3C7CB 4O63O 4PLYA 3GMDA 5A05A 5AQ1A 4QO8A 1NXQA 2B37A 3I9LA 3PHIA 3U4IA 4W82A 5DP1A 1N92A 2NNLD 5B12A 4CLOB 3KB6A 4JP3A 3TNLA 2IYPA 3NJ4A 2BFAA 3GUYA 1UDAA 4CMIB 4XR9A 3W4IA 4BKPA 3JQ6A 3FRJA 2Q49A 3AOEA 3F4LA 4IXTA 3DAFA 3WBBA 3GA0A 5THKA 5T6BA 4MKRA 4EEXA 1VL8A 4E5PA 3FPCA 3K30A 3KVOA 2CF5A 4PG5A 5JDCA 1HE4A 5KKAA 4RLSA 1ZFNA 4CUJA 2NQ8A 2Y1GA 5L53A 1Q0HA 3A1NA 1E5QA 1N9GA 3F1LA 3HDJA 3RC9A 3E9QA 2OOSA 5ICSA 1QV7A 3RFTA 1FMCA 4C4OA 3AUSA 3PZBA 4FSHA 3WQQA 4RVSA 1I0ZA 4RV9A 4JP2A 3UAGA 5IJZA 1PU2A 2GCGA 2JAPA 5I9MA 3V2GA 2O23A 4YT8A 1XIVA 3JQ7B 1Y1PA 5DDIP 5ADHA 4JX8A 1E77A 4B7CA 3CUKA 4RDHA 2EKLA 3M1AA 5KVCA 1XELA 1I5RA 1VL0A 2NTNA 1T2FA 3OETA 4M86A 2PK3A 3I9KA 3OFSA 3WGYA 2X9GA 1GPDG 2ZK7A 3I6QA 5L7YA 3RCBA 4BS9A 4BGUA 1LSUA 2JAHA 8LDHA 4QFDA 1KVQA 3MWDB 1PS0A 2G17A 2JJYA 4E2YA 1P3DA 3QQPA 4RJTA 5JSFA 1DIRA 1XR3A 2QW8A 5JDIC 4RGBA 1DJNA 5T57A 2IODA 2ZQZA 4IDFA 4CPDA 4D41A 4BNXA 3B20A 3GZNB 3IUSA 3A06A 4A0SA 4TVOA 3FF4A 4XZ3A 3HDHA 4PZDA 5BSHA 2JFHA 1UZNA 1KVSA 2NV6A 2HUNA 4I9NA 3MWEB 1MFPA 2W2KA 3AJRA 4OSPA 4W4TA 2D1YA 5FFFA 2XOXA 3DHEA 3LYLA 5CPFA 5B1YA 3WOHA 4FDAA 2Y1EA 3FBGA 5KJCA 3K31A 3KM0A 4UEKA 3GDOA 4A10A 2ZJ1A 2JD0A 3ADPA 1P77A 4HBGA 2X9VA 3FR7A 4AL4A 4TZKA 3UFXA 1E7QA 2FZEA 2NVBA 1JKIA 4R68A 3VH2A 4DPMA 3T7EA 2E4AA 1C0LA 2RCYA 3DOOA 4NBVA 3GR6A 5JE8A 3WTCA 1DAPA 3WLEA 1U5CA 2RHCA 1GL3A 3HZZA 2E82A 3L77A 3PRJA 4J1TA 5G0UA 2CDCA 1I01A 4C7JA 2Q3EA 4WASA 4XYEA 3ASUA 3MTJA 3VC7A 1EBUA 3QWHA 3GEDA 1Y8RA 4J7UA 2WE8A 1F17A 2OL4A 3GOHA 3DB2A 4BNGA 2VUSA 2R6JA 1ISJA 3CZRA 1YOVB 4HXYA 1ENZA 1MG0A 2DQ4A 1PJBA 3GUCA 3NGLA 4ND2A 1DIHA 3D0OA 4KQXA 1IHXA 3K96A 4PLZA 4RVGA 3PHLA 1PZFA 2PD4A 1FK8A 2W4QA 5THQA 4EBFA 2AHRA 3TOXA 4KP7A 4W7HA 2AEFA 3MJVA 4IQ0A 2Z1NA 3H5AA 4BO3A 5IG2A 1DFIA 5JY6A 3JYPA 4CM7A 4A73A 2YDXA 2O3UA 1AUPA 1B26A 3IMFA 3ZCXA 4DLBA 2SCUA 5IDXA 4XGNA 1AHIA 5TQVA 4CMAA 3WGGA 2H9IA 1BDBA 2R2GA 2CD9A 5G4KA 2V6FA 4IDAA 2VRBA 1E7WA 2BLLA 2GZ2A 5JO0A 1ZH8A 2WYUA 2YHIB 4A2CA 1R66A 3WMWA 3IC5A 4PIVA 4QO7A 5CEFA 3DBHA 2NM0A 3W8DA 2I9PA 2DBZA 1GD1O 3SX2A 3L07A 2O2YA 5COQA 1KEUA 2PR2A 2AQ8A 3V1UA 3D7LA 3ZU4A 5JFOA 1UXKA 1VI2A 2HK9A 4E30A 1XEAA 2E6UX 4NJMA 1I3LA 3O38A 2JHFA 5DOZA 4D3SA 1ZK0A 3JQGB 5L40A 5IXSA 3JTMA 4IS2A 4ESOA 5L9AA 3O03A 3WGHA 3EK2A 9LDBA 1QSGA 3ONDA 1K6IA 1NBOA 4R51A 4BOYA 4OL9A 4MVJE 5IXYA 4WCFC 2VNAA 3G3EA 3E8XA 1T2AA 1B3BA 1EE2A 2C5EA 4PVDA 1BXZA 3E03A 4IZHA 5COAA 3LK7A 4D42A 1UXIA 4M1QA 4RO0A 1HDOA 1K2WA 1E7SA 3FNFA 2QRKA 1VJ1A 5I8WA 1XHLA 3H8VA 1ZSNA 4R4JA 4ZRNA 3ZHBA 4ALKA 4JN6B 4CM4A 4D43A 5DT9A 5ER6A 1H6AA 3DFZA 4TSKA 2C82A 1YBMA 3HG7A 3QWIA 1B15A 1V8BA 1PZGA 1ZMOA 4XQCA 4ZHSA 1X1EA 4AG3A 3PK0A 4E2XA 2X58A 1JW9B 2CUKA 1I30A 1M6WA 1K6XA 1WW8A 2WD7A 2Y66A 2B0JA 4FC6A 3DC2A 1Q7BA 2HJRA 3UF0A 3FCOA 1QXSA 1PQWA 4BGIA 4J7XA 5TSDA 1N9GB 3WWYA 2G76A 2E48A 1Y5RA 3AOGA 5I7FA 1ONPA 1GZ4A 1U7TA 1LLCA 2VWPA 2I65A 4NPCA 3WB9A 3FWZA 4YRDA 2O48X 1IOLA 2X9NA 1NHGA 1AGNA 2FSSA 2X0JA 4P38A 3UGKA 3UXYA 3FNGA 2NU6A 4J43A 1EK6A 2OUIA 3G79A 1D7OA 2Y0CA 4EYEA 2CVOA 1GAEO 2ZYAA 3OEWA 4EZBA 5JS6A 2CVQA 1PJCA 2QZ9A 3QIVA 2ZB4A 3DBVO 1Q1NA 4F45A 2P9CA 1DFHA 1LDBA 5DCUA 4MP6A 3CMCO 4RF3A 1A5ZA 3N7UA 2VZ8A 5JY1A 3OQ1A 4IDDA 4ZQFA 5GZ6A 5TGDA 1DC5A 3GVPA 3S2FA 1FJHA 1SEPA 1ULUA 3LT1A 3JQ9A 4QSMA 1NFRA 3IP3A 1Z45A 1LTHR 4DREA 2YHIA 3GVIA 3DZGA 4W6ZA 1DLJA 2JD1A 4HFJA 2BI8A 3H9EO 5TS3A 1Y8QA 2Y99A 4U6QA 4Z0TA 3VAZA 1MFZA 2VHZA 4Z9XA 4GL4A 4UVDA 1U7HA 3G1UA 3K5PA 2NADA 3VZRA 1ZUD1 4QQRA 3RQSA 1DFGA 4KZPA 4ND3A 3EZLA 1NQOA 3GH3A 4E13A 1BDMA 1KBZA 1GZ3A 5U1PA 4XQEA 4DBZA 1WZIA 2B83A 1QYVA 3OIFA 4L74A 2Q50A 4Q3BA 1NPYA 2CMDA 5F5LA 4OO3A 2ZB8A 4Z3KA 3PGJA 4OQYA 2VRCD 3F3SA 3DHNA 4XX0A 3CSDA 3DOJA 4XCVA 5TF4A 3UOGA 1CJCA 3I6IA 2X5JO 3KLMX 3P19A 4XYGA 3ST7A 5BSFA 3K2BA 4PLPA 2LDBA 3K2EA 1YJ8A 5DBIA 4ZU3A 4RDIA 1WAMA 1PR3A 2DAPA 1Q7CA 3HB4X 4I08A 5KVSA 1IB6A 1E7MA 2CSUA 2UVDA 4CMEA 1X7DA 3OP4A 1RM3A 2V7PA 3VOSA 4NR0A 3L0DA 1GY8A 4TROA 3JD1A 5AVOA 4J9VA 1LLQA 2I5PO 1PTJA 1R6DA 6ADHA 3KHUA 3OH8A 3GHYA 2FR0A 4HKTA 2BGKA 2PD3A 1I24A 1UAYA 1LLDA 3K73O 4CR7A 3IQDB 1ZK1A 4LW8A 1U4OA 5F1PA 2D2IA 1BMDA 5ICMA 2B4QA 2HRZA 4D45A 1R4MA 3WIEA 4A03A 1H5QA 1TB4A 3NRCA 2NTJA 1GYRA 3KTDA 2DTDA 1WZEA 3NDIA 3DR3A 3GGPA 2QIOA 1VJ0A 1H6DA 3WQRA 1ISFA 5TNXA 1GV0A 2OP0A 5I9NA 3BHJA 3GT0A 5LDGA 3DZJA 3PDUA 5L95A 4H7PA 2D4AA 4RZHA 3ZWVA 1WWKA 2YFHA 1GEEA 3K92A 2BFPA 2PGLA 4MVJG 1O89A 1F12A 2P5UA 5KJEA 3A28A 4MP3A 1O9BA 1YVEI 5C7LO 4Y6RA 5JPIA 1RM5A 1BWSA 5F3RA 2PV7A 3ROQA 4DQVA 4RL6A 1T26A 1V3TA 2PKQO 2EP7A 5C37A 2NVUB 3E1KA 5LC1A 2PZMA 3PIIA 1X15A 4QUKA 3VHRA 2OP1A 4L4RA 1NR1A 3F46A 1BXGA 4E2WA 3ZHYA 1B8VA 1K89A 4U5QA 2VWGA 1RYDA 3Q0EA 4TKMA 1T2EA 2BELA 2RHRA 3PQEA 4W9NC 1QORA 4EJMA 3GGOA 1EQUA 2PA3A 4PZCA 3WGQA 1C1DB 4YJFA 3Q3CA 2IZ1A 4BO5A 4WNIA 4DQXA 1PS8A 2J5KA 1NNUA 3WGZA 1PX0A 3AI3A 4M49A 1ZSVA 4UAGA 2ZYDA 3WNQA 3F47A 3GHHA 3WQSB 5TLSA 1CF2O 2AEMA 1DC6A 5T67A 4AJ1A 2C29D 3RFVA 1Z74A 4B4OA 1VPDA 3DBRB 1UZLA 3MJTA 1GCUA 4R54A 5CAEA 5COBA 1A4IA 3AM3A 3M2PA 5AOVA 2GDZA 4QEDA 1P0FA 3E48A 3C7AA 3PIDA 4UUNA 5BSGA 3RSHA 1DHTA 4FFNA 2BGMA 3BMNA 1YBVA 3TFQA 4BMSA 1WMBA 1BXKA 3E5MA 1PJ2A 5FYDA 5A3VA 3WGTA 2NWQA 4GSKA 3JSAA 5CEJA 2JD2A 4Y6SA 3QRWA 5C7IO 3ZH2A 1DHRA 2RAFA 5HBRA 5I7SA 3LVFO 5KNLA 4O5OA 2RBEA 1ORRA 1DAOA 5FWNA 4N54A 5B37A 1OC2A 1ZK2A 1TT5A 2QHXA 4RF5A 4S3MA 4WLFA 4BQRA 1UP4A 4WJZA 1NASA 2ZCVA 1ONNA 2GF2A 3SBOA 1XU7A 3OIGA 4K6FA 1XWFA 1BVRA 5K0ZA 1QYXA 4CM6A 1SCUA 2VT2A 4WCDA 1Z75A 2I3GA 1E1LA 4PFJA 2Q4EA 4EGFA 1H6CA 4LSMA 4DYDA 5IAAA 1QYDA 3AM5A 1NQ5A 4IJKA 4OIMA 3EMKA 3HNPA 3C24A 1P9LA 2O2SA 4JGBA 5G0WA 3T4XA 1ZEJA 4BHTA 5KWEA 3B1FA 3KO8A 5CG1A 5KVVA 2DFVA 3PLNA 1HWYA 1DLIA 2FR8A 4B8ZA 1E5LA 1HE5A 4JBGA 4AJJA 3NX4A 4A5OA 3O4RA 4PG8A 2FWMX 3UVEA 1PWZA 4DTIA 3IAHA 2D3TA 4BNNA 1Q2XA 3RUIA 3FR8A 3ZNOA 1WDKA 2W8ZA 3LC2O 4IMRA 1YQDA 4MKXA 4ZJUA 1N1GA 3TL2A 4GMGA 1KC1A 1ZW1A 3P7MA 3NT4A 3VH1A 3MTGA 4WK6A 1LQTA 1LC0A 4MPDA 4TKLA 4BV9A 4L0QA 3SEFA 2AG8A 2YV2A 2A92A 1XYGA 3G49A 4R1UA 5T64A 1MP0A 2PH3A 3JYLA 1NR7A 3RFXA 3AUAA 3Q9UA 2EKQA 4K6CA 1YO6A 4PRKA 3ZZNA 4TMFA 3BXXA 1E3WA 1MC4A 1X13A 3HSKA 1Y8QB 3U0BA 8ADHA 2O4UX 1DIBA 4II3A 5CHEA 3WXBA 2O3JA 1A27A 3ROKA 1R37A 2P9EA 2X1HA 3ASVA 1TVEA 2AMFA 5JMPA 1E1NA 1O0SA 4ROSA 2Z5LA 3OJEA 5G0TA 1JWBB 3GFBA 4WLVA 3ZWWA 5B4TA 3IKTA 1L7EA 5JC8A 1A7KA 3RBVA 1LRLA 1R0KA 3BMCA 2Q2VA 5IDWA 1GQQA 4CLDA 4GX1A 1I33A 3QWAA 1LLUA 4KUHA 3GN2A 3DO5A 2GR9A 2QG4A 4H3VA 3VVCA 1HYHA 2HK8A 2C54A 1HDCA 4A7PA 1HF3A 4PGFA 1E1MA 2IEBA 3DL2A 2W2KB 3INGA 4PVCA 4CV0A 1XG5A 1R4NA 1MXHA 3QE3A 4FGWA 3ZNQA 4GX0A 3E18A 3LLSA 3ZGYA 2O7SA 5JAZA 4CM8B 5JLAA 1LUAA 1F8FA 5KKCA 2O3QA 2AQHA 4G65A 4K9DA 3BHIA 4Z9FA 1GU7A 3DDNA 4R3NA 5LCXA 2ZIZA 3UHAA 2IDZA 4J3FA 4KTTE 2BD0A 4H16A 1J6UA 2VT3A 5TJHA 3I9MA 3W8FA 4YEDA 4WOJA 5DN9A 3D5QA 4WCFA 5BT9A 1BW9B 1R0SA 2CDAA 3NDRA 1MC5A 3OICA 2BGLA 3GPDG 3NTOA 2DFDA 4QFCA 3KYCA 5JDCC 1YKFA 3P5SA 2AXQA 1E3IA 1YONA 3U4CA 2Q1SA 3QW2A 5GZ1A 4DXHA 4DYVA 3C8MA 4B7UA 5U9CA 1QYCA 3QLJA 1UJMA 1YQGA 3LF2A 2EWMA 4KTVE 1KVUA 1B8PA 4CM1A 1N1EA 1NVTA 4BNFA 2Y68A 5ENVA 3G1TA 4D46A 4JJFA 3JD4A 3UH1A 3DBRA 3ETDA 5GMOA 4LMPA 2BI7A 1IUKA 1HDZA 3TWOA 4BMNA 1TXGA 2BMAA 4E6PA 1J0XO 9LDTA 4AICA 3L4BC 4D3FA 2Q46A 4UREA 3G0OA 2C7GA 2YY7A 2GERA 3EW7A 4ZICA 3TZHA 5CDSA 3PHGA 2X0NA 5F1OA 2WD7B 5ITVA 5EPOA 3MOGA 3OSUA 5IN4A 1H0KA 4LSWA 1NM5A 2BFOA 5IDQA 1D8AA 3AUTA 4PLFA 4EJ0A 3HN7A 4OOFA 1HDYA 5A5FA 1YOVA 1CIVA 2X5OA 4OXNA 5HM8A 2JCXA 3D3WB 2FPGA 2PTGA 1CERA 3VTZA 5A06A 1HDRA 2O3RA 2VWHA 3M6IA 1HRDA 1UDBA 1T1RA 3DBLA 3WYBA 2ZQYA 4IPTA 4PG7A 4TRMA 3RUCA 1P1FA 1GYQA 1PS9A 1NFQA 2GASA 3FN4A 3PYMA 4J0EA 2C2XA 1QKIA 1LBEA 1Z7BA 2FP4A 2VOJA 1FDSA 3V2HA 4B7XA 4E4YA 1CQJA 1EZ4A 1RYEA 2Y1OA 1C1XB 5AYVA 3C85A 4RPKA 4TQGA 1ADFA 2LDXA 2P5YA 2X22A 4MVJF 5HWSA 4GMFA 1B3RA 2HMSA 4Q3CA 2PKRA 4YBZA 1MGOA 3HFGA 1C0IA 1LDMA 1ZZEA 3LT0A 5TRTA 3H2SA 3HN2A 4EDFA 3H65A 4GLLA 1O8CA 4BO2A 4BGEA 2J3KA 1HTBA 3WNVA 4CL3A 2EG9A 2WMDA 1RPNA 3L6EA 2H1SA 1QG6A 4MVJH 2B36A 2V6BA 5A9SB 2D0IA 4IDGA 3ZV6A 4UEOA 3GZ4A 1IYZA 3EYWA 3O9ZA 3PWKA 1JN0A 1ULSA 4HX5A 3JQCA 4KOAA 3F9IA 2VYNA 2WM3A 2D8AA 1DB3A 3CZMA 4HV4A 1NPDA 4FFOA 1B14A 2YDYA 4IQ8A 1LRKA 2EGGA 3MJ4A 2FZWA 3PDJA 5KVQA 5FI3A 3KYDB 4FD3A 4F3YA 5BR7A 4RPGA 4MIOA 1NTOA 1F06A 3HQ4O 4GVXA 3OJLA 4CMKA 1YS4A 5I7VA 4YXFA 5DZSA 2J5RA 2Q99A 1I8TA 1OFGA 1LDYA 2Y0DA 3L9WA 3BTOA 3FHLA 3DZFA 4FR5A 1U2GA 5TX7A 3ANNA 5CPBA 1EUCA 3ZU3A 4E3ZA 4DIOA 3E6AA 1OAAA 3ANLA 3BMNB 2BRUA 2FMUA 3MEQA 4ILKA 4U6SA 1DC3A 2YQ5A 1E3LA 2HO5A 1H9AA 2HAEA 1SO8A 2WTBA 1I3KA 1UP6A 5L7WA 3OQBA 4A27A 1P1IA 1HLDA 1OI7A 3QVOA 2J3JA 4MVJD 4D0SA 2GZ3A 2VHWA 1XKQA 1D1SA 2EGHA 4ZQBA 4OQZA 4OM8A 2EW8A 3PFWO 4JK3A 3IJRA 4R9SA 3S1LA 3TDKA 5KCZA 2PGJA 1HZZA 2WEKA 4Y67A 4K26A 3OECA 4MP8A 3RC7A 3ITDA 1KOLA 4PCVA 4K28A 1PR9A 3JQAB 2YV3A 1Z6ZA 4FS3A 3NEPX 1JLLA 1NAHA 4JIGA 1A4UA 2B5WA 2D5AA 5JBIA 2P68A 3PJDA 4LRSB 4U8GA 4I5DA 1SC6A 4WEQA 4A26A 4BNLA 4R9RA 3SXPA 3H5RA 1K0UA 3CTMA 3GY0A 4NI5A 1J4AA 1GUYA 1I10A 1U1IA 3FWNA 1E3JA 1Q7GA 2H6EA 5T5QA 1WMAA 4JCOA 4FFMA 2BHLA 4LCEA 4L75A 1HL3A 2IEDA 5A4DA 5EMHA 3VZPA 3GNQA 2HQ1A 1VSVA 2W98A 2ZCUA 4TVBA 5I7EA 3AUUA 3ITKA 3RKUA 1PL6A 1GQYA 2Q1WA 1PJQA 4ALMA 3PI7A 4CLRB 3STHA 2DT5A 1IHYA 3TZQA 2CFCA 4R41A 4HFRA 1YWGO 3O8QA 3PJEA 3CEAA 2Y93A 3DAPA 1M67A 3VPSA 1HE2A 4BNIA 4YAIA 4UVIA 3AU8A 2IZZA 3GAZA 4MOWA 2IXAA 4URFA 1EDOA 4ND4A 4GKBA 1Q0LA 5HTOA 2Y1DA 3RBZA 3QVSA 1PGNA 5B4UA 3LZ6A 3V1YA 1W6UA 4PG4A 2B4RO 4ALIA 1EVZA 1IULA 1ADGA 1UH5A 1T4DA 4LN1A 1Y5MA 2HJSA 4CV3A 1LDNA 2A94A 2NVUA 2NU9A 2YHUA 1Y7TA 4WECA 4D0RA 1Z73A 4FQ8A 1I3MA 2F00A 1AXEA 4P4GA 2Q45A 1MG5A 4M8SA 5FI5A 3TOZA 4PLHA 1D1TA 1UXJA 1QLHA 3U62A 5JCJD 2GPTA 2VTDA 2ET6A 4IDBA 3QP9A 1B7GO 3VH3A 5CEEA 3AY6A 1L7DA 3OF2A 4AJ4A 4EJ6A 2A4KA 5JYEA 1OOEA 2PKQP 3L4BA 3FNEA 4BO7A 1M75A 4XRRA 3NDJA 2ZTVA 1KEWA 4AJLA 1ISMA 2EJWA 4IINA 3PEFA 4DRYA 4FOSA 4B3JA 4RPHA 3RASA 4DC1A 4CQMA 3BA1A 1M76A 1JKJA 4YRAA 4RVUA 3H7AA 4PN3A 1TT7A 4KUEA 5DCYA 2V6GA 4CM3A 3C3XA 3GNTA 1CQIA 4J16A 3Q9NA 3KUXA 4E31A 5IZ4A 3X2FA 2UDPA 1G6KA 2ILTA 5LDHA 3INTA 4CM5A 2YZ7A 4INAA 2OMEA 2POQX 3TL3A 1YJQA 1R15A 5L45A 4BO1A 4N5NA 3ZNNA 1ZKMA 5EQFA 2J3IA 4KWHA 2VHYA 1ZEMA 3H9QA 3D1LA 4NU5A 3VDQA 4OOEA 2V6MA 1BG6A 3B6ZA 1C0KA 1VL6A 3N58A 4QX6A 3EUWA 1JVBA 2QZZA 4E5YA 1VM6A 3BZUA 4HNGA 4R5MA 3WFJA 1SB8A 1ISGA 1OZAA 1WP4A 3QVWA 2DUWA 1VLLA 4PLGA 1LEHA 3HB5X 1IE3A 4YAGA 2DUUA 4JLWA 4I5FA 2BF7A 4OMUA 2JKVA 4NFHA 4L4SA 4XEHA 3WYCA 5A03A 4CR6A 2PFGA 4KDFA 3EVTA 1P31A 4Q3AA 1GFSA 3KLPX 3AWDA 2IRWA 2NU7A 3PPIA 4RQUA 1SZJG 5L4SA 4BO4A 1SPXA 3HFSA 1U28A 4BUCA 3K6JA 4UULA 2Y1FA 1N8KA 2Y0EA 4BKQA 1DDOA 2WDZA 5JCXA 2AG5A 2NU8A 1SOVA 2HDHA 4FCCA 2NSDA 2FY8A 2UV8A 1E3SA 2O4CA 3SVTA 3WFIA 1K5HA 1WLYA 4D7AA 1BGVA 1C14A 4JROA 3EC7A 4N5LA 5JXWA 2CY0A 3WIDA 1A9YA 1DSSG 3ADOA 4H15A 3U4DA 1WVGA 4NK4A 1U2DA 3HWRA 4OXKA 3HHPA 1LNQA 3NJ8A 3Q6IA 2OBNA 2J8ZA 2WJPA 1T24A 3R6DA 3G17A 2O50A 4I9HA 4BNHA 4I5EA 4D3DA 1I3NA 3U09A 5JNLA 2DKNA 1EQ2A 4CM8A 2FHSA 2EJVA 2X0RA 3KSDO 2PZKA 3NKLA 4B3HA 5JAMA 3I4FA 1VSUA 1NYTA 4MVJA 4HFMA 4IIVA 3RJ9A 3IIEA 3JQAA 5CDYA 1YH3A 2VZ0A 1YL7A 1GCOA 4FJ0A 1V9LA 4WCFB 4DLLA 3ZW9A 4P4NA 5ENDA 5F5NA 2Q2WA 4Z0HO 1C3VA 3WBFA 4BNJA 3DZIA 3O26A 1I2CA 4NK5A 3C1TA 3PJGA 1UAGA 2XXJA 4YTEA 1SBYA 4ALJA 3JQFC 2BH9A 3SLGA 4J0FA 3ICPA 4GLOA 1E3WB 2GYYA 3B1KA 2Q1UA 3K9QO 5BQFA 4L8VA 4FC7A 4K1LA 1YL5A 4BNYA 3NAQA 1HSOA 4S1VA 2J5QA 5EJ2A 3DTYA 2NUAA 3GAFA 4MJLA 1O95A 3OIDA 1DIAA 2WD8A 3DMTC 1ZMTA 3COSA 3CINA 3FPLA 3ONFA 3NGXA 3JYOA 3D3EA 3DZKA 2NTVA 4OKNA 4FPXA 4IQGA 1XQ1A 3LF1A 3SJ7A 1TI7A 3KSZO 4PLWA 3ZWYA 3ZN2A 4CLOA 2VRCA 1PQPA 4ID9A 2YQ4A 4N7RA 4M89A 1H2HA 2RH4A 4CLXA 1DC4A 4OSOA 2B69A 3E9MA 1M66A 4LMRA 4CMIA 3OBBA 3KRTA 3U4HA 4J4TA 3PQFA 1IL0A 2ZJ0A 2ZTMA 4AJNA 4AJIA 5HRUA 2W2LD 3JD0A 3U3XA 3S2EA 4JJIA 4L73A 1A72A 2PGDA 4OGWA 4XR4A 4J4BA 3DWFA 3OA0A 5EN4A 3DONA 1PJSA 3RJ5A 3AU9A 1MV8A 5KOIA 3ZWNA 4Z6KA 1DIGA 4L76A 1FDWA 3L6OO 4YVFA 1T25A 4O1MA 2W90A 4GPD1 1QLJA 1H9BA 3PLRA 1PJ4A 4FJ1A 4R1NA 4MO2A 4QTZA 1KC3A 4DPLA 3RROA 3KEOA 3VPFA 1VE9A 1X0XA 4PZEA 3C1OA 4XYMA 1P44A 1ENYA 1NVMB 1LI4A 4WE3A 3U5TA 4E21A 3RUHA 1WDMA 5U4QA 3BIOA 4B4UA 4NFYA 3A14A 1JVSA 2O3TA 2Y1CA 4WEOA 1KEVA 4ZRMA 4J7CA 3JQDA 4XD2A 2J3HA 1X14A 2Z1MA 1ZXBA 5BNIA 3UN1A 1HSZA 1K3TA 1M6HA 1GEGA 3DHYA 4RVDA 1DRUA 4Y9DA 4AVYA 4DWVA 2I66A 1E3EA 4CLRA 3AOEC 3GRPA 4ND5A 1ISIA 2C07A 1IPFA 1CYDA 4IJVA 5AXAA 4CMEC 4DC0A 4AJHA 3WGIA 3H2ZA 1MA0A 3I1JA 4W99A 1NQTA 4YB8A 1Q0QA 1EK5A 1MUUA 2NACA 1EMDA 6LDHA 1B2LA 4RORA 4B4VA 5JW6A 3ZWMA 4R5HA 4BB6A 4NHEA 4KWIA 2QQ5A 1ENOA 3QJ5A 2X86A 4DUPA 3VZQA 2OBYA 1TT5B 2FRDA 4IGEA 2GZ1A 4IGFA 2GSDA 1D3AA 4OYRA 5IN5A 4IUYA 4FOOA 2X8LA 3GVHA 5A02A 2OHXA 4EUFA 5IF3A 1FDTA 2GUGA 4Y98A 3WSWA 3RI3A 5EQDA 5K6AA 1J49A 3JQ8B 5A5EA 3GC6A 3QWFA 2I99A 3NTQA 3ZWXA 3LDHA 4RVFA 3T4EA 2QYSA 1WXDA 1XU9A 3OJOA 4E12A 1H2BA 3MZ0A 3B70A 2AE2A 4WUVA 3BMOA 3D4OA 3LT4A 3BHMA 1UDCA 4F6CA 4BQPA 4BB5A 3O8QB 4DMMA 3GZNA 3LU1A 4Y6PA 1QMGA 2Y05A 1F14A 1PQUA 4IBOA 4MIEA 5DNAA 3ROPA 3UKOA 3AFMA 2XXBA 4U7WA 1TEHA 3CMMA 3RUDA 4J4HA 4F46A 1KVTA 2Q2QA 4J49A 2VTEA 4CV2A 1UXHA 1ZO8A 2ZATA 4NJMB 3JQ8A 1GPJA 3RKRA 3CPSA 3PHJA 4EI2A 5A9TA 2AW5A 1YXMA 3RBXA 2ZKLA 1EUZA 1DO8A 1LQUA 3FNHA 3H4VA 1OMOA 4FJ2A 5DF1A 4ZA2A 4AJOA 2GGSA 4R3WA 4CODB 5HS4A 4TRNA 1I32A 3R1IA 5HA5A 1P45A 4AJ2A 4ALLA 4UUOA 3KV3O 3QA9A 2EHDA 4NQZA 3V1TC 3V8BA 3CKYA 4JJGA 4OXYA 4RQTA 3MJCA 1EVYA 3JQAD 4I8XA 4YAEA 5G4KB 2C5AA 3AY7A 3IS3A 3ZWOA 4HY3A 1QYWA 4HUJA 2IXBA 2QRLA 7ADHA 4AJEA 4M87A 4AJPA 1ISHA 1T4BA 2WE7A 4NBWA 4BVAA 1O5IA 4YJGA 1FF9A 3QY9A 4BNWA 4EUHA 1EUDA 1PGPA 1A7AA 3U9LA 5A1TA 5K9ZA 1RM0A 2QX7A 2B4TO 2DBRA 3JD3A 1W4ZA 3PZRA 2PLAA 1TA4A 4XDZA 4BL5A 3NT5A 2PH5A 1HEUA 4DL9A 1FDVA 1V6AA 5L4NA 4Z3DA 4O0LA 3C7DB 2X7HA 1HYEA 3Q11A 3D4NA 4RLHA 1UP7A 2XF8A 3ETEA 4IXWA 2G0TA 4ALNA 3N74A 4J1SA 1LX6A 5C5IA 3Q2KA 3RWBA 3EDMA 4RF4A 3ORFA 4RVHA 1ID1A 1NVGA 1NFFA 4EUEA 3AI2A 1LU9A 1JWAB 2I3AA 1Y8RB 1YDEA 1BSVA 3JQEA 4M54A 4WLUA 5KJ1A 5KIAA 3AFNA 1EBFA 1E1KA 1GADO 2Z95A 1PZEA 3PGXA 3EGOA 4XJTA 3SLKA 4DBVO 3W4KA 5DCWA 3DMYA 4FW8A 4YAKA 1E6EA 1YQXA 5GY7A 2VYVD 3KEQA 3Q1LA 4ITUA 1ZNQO 4KQWA 1AXGA 4BNUA 1HLPA 4P22A 2P4HX 3HJAA 3RD5A 1QV6A 1P1JA 3GFGA 3W6ZA 1FXSA 1T2CA 4CM9D 1U3TA 4BNVA 2OO5A 2OFPA 1BW9A 1EEHA 5CDTA 5L7TA 2B5VA 5DBGA 3OQ6A 4UUMA 4I1IA 2J6IA 3DXFA 1V35A 3WYEA 5JAIA 2X6TA 4XKJA 4PRLA 4Q3NA 3V2UA 4C7KA 2DVMA 1MB4A 4EW6A 3IOYA 4TRJA 3JQBA 2JFFA 3K8ZA 5J23A 1H94A 4LCJA 4ZQHA 1E7YA 1PL8A 3I23A 3KBOA 2HU2A 4JQCA 4FFLA 5BNFA 1B16A 2IE0A 3DFUA 4NIMA 4CMGA 4ZQEA 1OBFO 2EKPA 3R0IA 3DZHA 3H3JA 2GN8A 4P8RA 2EF1A 3UW3A 1GTMA 3F4BA 3EY4A 3PQDA 5EINA 1BHSA 1M2WA 2PNFA 4NBRA 4CQLB 4BKRA 1IZ0A 1LDGA 4UVGA 3D4PA 3W4JA 4LRTB 1ZSYA 3WJ7A 2YW9A 4W9NA 3GLQA 1PWXA 1GDHA 1NWCA 3BMOB 3HDQA 1DOHA 4XA8A 1KS9A 4BGVA 5BSEA 3ZWPA 1LXCA 3H3FA 4LVCA 1YGYA 1I36A 3WJAA 3KYCB 4IDCA 3TZCA 3WR5A 4GAEA 2D59A 4MDHA 3SJUA 4YYZA 4PLTA 4MVJP 4E5MA 4XQ9A 4YACA 4R16A 2C59A 2OZPA 3KZVA 3ZWBA 5JDIA 4GX5A 3VH4A 5ITWA 1R4NB 1ZJZA 5KTKA 2B35A 5DOVA 1Z82A 4FN4A 1Y9EA 3R3JA 2HMWA 4EEZA 1BTOA 4TZTA 5ILOA 3DAGA 3ZI0A 4FB5A 5CP8A 2F1KA 1AHHA 2UUOA 5F1KA 2C20A 4E2ZA 1ZVMA 2QRJA 4GGOA 2NQTA 3GK3A 3KXDA 3DEYX 4WKGA 3RC1A 1YB1A 3ZWCA 2DM6A 3M2TA 1UUFA 2AQIA 1K6JA 2DC1A 2UYYA 3ICCA 4HWKA 4YJHB 3BTUA 4BV8A 1R16A 4DMLA 1MLDA 1XDWA 4GWGA 4J91A 4GGPA 1YE3A 3H5NA 3UICA 1A71A 1XA0A 4O6VA 4B4WA 2VHVA
chains in the Genus database with same CATH superfamily
1W52X 5JISA 4DLAA 4GP6A 1GLNA 1L7OA 5KNBH 3NUQA 1F8XA 1UKAA 3L8CA 3BEOA 1Y80A 2JZOA 1LY1A 1OFHA 2V4UA 3DOCA 3TN7A 4CCYA 4D44A 4Z1OA 2BT4A 2XHZA 4O4IB 3DVLA 2DPLA 4R9VA 3TF5A 3KYBA 1ZOIA 1WDLA 3D8SA 4OHBA 2VK4A 2PT9A 5IAGA 1SHJA 2HH9A 5E3IA 5FV7A 1IK6A 1XCBA 1XTTA 2QJTA 4ZQIA 3ZV3A 3EVNA 3RK1A 5JSQA 2DSNA 2VYVA 1IMJA 4G5OA 2IYFA 3EYAA 3DYVA 3G5TA 3PUHA 1CDEA 5CDFE 3UJHA 4TS9A 3X1YA 5KYWA 1YB4A 2LCIA 5BUSA 4IM7A 1RJ9B 2RGGA 2WKPA 2YUIA 4LDJA 2YWFA 5JYCA 4MWEA 3WMXA 4G5FA 3RRJA 1Z22A 3I52A 1PDWA 2ZSJA 1WY5A 3F1KA 4EX6A 1Y3CE 2C84A 1XZLA 3E23A 4HUQA 4UW9A 3EXIB 1GILA 1HZJA 5H4GA 4BP1A 3E3AA 3OCJA 5DPMA 3EDCA 1PJAA 5BUCA 3URMA 1U5BB 3TJRA 1FU7A 1PSDA 2FPIB 4NZMA 4HAVA 3ZK7A 2Q3LA 1VJTA 5E9WA 3UANA 5J5VA 3VISA 1OXKB 1Y33E 4P9NA 4WL0A 3C3AA 3R3SA 1QK5A 3Q7QA 1RAHA 1VE1A 1X8KA 3EZYA 3FDZA 4WA8A 5CVEA 2ODTX 2V7UA 3RVMA 2AKEA 3EC2A 3VMMA 1YZUA 1KYXA 2H1IA 4HDQB 1JEQB 3ZCQA 5IJ0B 2EJTA 3GP3A 5EE0A 2RSLA 2GKSA 3SP1A 1YKGA 3C1AA 1DEHA 1L7VC 1UPXA 3ZKWB 4CMBA 3NBZC 3S40A 3S1SA 2AV6A 4Q4LA 4NBUA 3AMVA 1NTRA 2E87A 3N8HA 3BM5A 3C3DA 3L92A 3LUCA 4FKMA 4KQFA 1BHJA 2HTEA 2QRZA 3SLRA 2QPLA 2DJIA 1M5UA 1QVAA 2Z9CA 2JATA 3L43A 4IW3B 3TMAA 5B4VA 2AEJA 4F7DA 4D99A 3LDAA 4V0LA 1EVIA 3ET5A 1DBVO 1XMIA 4NFSA 3GGSA 2A5DA 2MMGA 2Q6VA 1CK4A 4PZ9A 4N41A 5TEWA 4A2PA 4D8WA 5JSZB 4TYMA 1DG1G 4JXZA 4FFPA 3EXHA 1Y9AA 4DVGA 3B3GA 4NJEA 5DM4A 1G1MA 3WYGA 3MCUA 1JQ5A 4MVJM 1ZX1A 2HI0A 1A8SA 3CCBA 3NIWA 2FJ0A 3CUUA 1UMDA 3HKEB 4A4DA 2OFWA 1ZISA 3QFCA 3ENKA 1WUJS 1NWHA 1S7CA 1NI3A 4PX9A 4U00A 2OVFA 1H3EA 4OCZA 1CZOA 2WTEA 5H9WA 1P4SA 1ILWA 4GI2A 1P7PA 3QKWA 5HF8A 5KQLA 4MCIA 2CXNA 3W2EA 3NM5A 2HCJB 2P9YA 3JYHA 3FSEA 5DK6A 1A8HA 2UYGA 4FLMA 3MTAA 2VPIA 3M5CA 3HUDA 3M1LA 5T3YA 1PZHA 1Y0BA 3S5UA 3T9DA 3WAGA 2PZLA 1QCZA 2FCRA 1JUDA 3BREA 3DEJA 3SDBA 3R77A 3B3AA 1J22A 2WIBA 4RCVA 1NATA 3AC0A 1IEWA 3WLNA 1KYIA 2EZ9A 4OGKA 3TRHA 5EIEA 3WWOA 3GLFE 5ARBA 1LBHA 1I2ZA 1E7RA 1SCQA 1Z4IA 5FTMA 3T3GA 1XMPA 3MMZA 4O2BB 5DI3B 4ZPJA 4ZEOA 1TUEA 1E2UA 4JASB 2XTJA 4GQAA 3SSMA 1D4FA 4MW7A 1DKMA 2ZJZA 2PS0A 4TKUA 4IDNA 4F2GA 2FSVA 2JK0A 4BC1A 1G60A 1U2TA 4TRRA 3Q15C 4HDSB 4OREX 2FW8A 5J3JA 3M3PA 1U3DA 2PRIA 5AKEA 4J1TC 4C1BA 1O5OA 1VL1A 4R69A 1NIPA 3CE6A 1W73A 3EZGA 5DMHA 3S5JA 3DE1X 3H9UA 1PJLA 3B6EA 3O6VA 2PWZA 1T2VA 3QXXA 4EECA 4YLYA 1WXFA 4XGKA 3L6RA 2IPXA 3B1ZA 2REBA 1MJGM 2VJAA 4Q19A 4X62B 4B46A 4E5KA 1UR5A 3BICA 1FUYB 1ZH6A 4Q3LA 2HA4A 1U3UA 3TZ6A 1EHCA 3U39A 5C0OE 1AQLA 2A5GA 1A0OA 3AJEA 2G4LA 1GUZA 1MH9A 2C00A 4N0PA 4R8MA 5B30A 1BE8A 2RH9B 2JJ1D 5JWRA 5K03A 1FRNA 2IZ6A 2DBVO 4RV4A 3J7AC 1EIWA 1FJ2A 1ST3A 4M0EA 4HPWA 5TGTA 1QFYA 3KZCA 4QJ3A 4PCAA 4IWNA 4YT4A 1J5EB 2O06A 3D8UA 5A6SB 3U37A 2PSEA 1J2UA 3L4SO 4DFDA 4X7BA 2C9DA 5C3MA 3E3NA 1DVRA 1WUTA 1TFRA 1T4GA 2YVUA 2ZB3A 4CHTA 4ENWA 1U0BB 1EUCB 2V7QD 2YBEA 1AS3A 4KDEA 4R2HA 3TIGA 3BAZA 3L6DA 1AJEA 1GL7A 1RPAA 4QUHA 1ONOA 5CFNA 1QPBA 2OXIA 3RS4A 2VAWA 1O03A 2Q4TA 4KO1S 4US1R 2H54A 2XUDA 2JASA 1GFWA 3B9RA 2PKEA 3FCXA 4BKMA 3NXKA 2IUYA 1CEXA 4JWKA 5K01A 1SNYA 5GQSA 1VIMA 1PYGA 4JQSA 5LN1A 4LQCA 3MT9A 4Y3UA 1VL5A 4DCGA 5TJ9A 4X94A 1EFRD 1H0SA 2Q4BA 4CKBB 5ICCA 2H52A 2IP4A 4JLNA 1HE1C 4AY4A 5JYDA 4FVTA 3STTA 2FX5A 5I01A 1H5UA 2BBTA 3V7NA 1P0QA 5BYBA 2PWBA 1CQJB 1JKXA 2PWAA 1G5RA 3D6VA 1ABEA 1G5FA 4OQLA 1XSEA 3CB4A 4MB2A 1NHWA 1KWGA 3K5WA 3NGMA 3Q8XB 3WWZA 4P98A 1E79D 2JGNA 3D3KA 4OI1A 3ILSA 4DDWA 3OIUA 1X7GA 2WILA 1GTZA 4Q48A 2VOEA 5F2NA 2WM8A 1ZLXA 2YRFA 3MRSA 3PQ4A 4LS3A 4MWSA 5KOJA 1E99A 3FPGA 3R8FA 1G4UR 3GJXC 3OI7A 1X3SA 2KW5A 4G8BA 3ULKA 3T3OA 3TJZA 1DCFA 5EIBC 5TT0A 4LJRA 3N3AC 1SA0B 5CB4B 3WX0A 2DBQA 1R74A 1Y48E 2CDBA 3A4TA 4K5QA 1U7UA 5GP1A 3U3MA 3VXKA 1NURA 1OBVA 2DUNA 3ON5A 3OJWA 4BFCA 1ZYUA 1DKPA 4C4YA 2J9YB 5F78A 2OENG 5A3JA 2G70A 4UARA 2WJYA 2W83A 4BE9A 4TMXA 3HTXA 4GRDA 3G2HA 4I5GA 2K5UA 3NBKA 5JO9A 3K1AB 1JI3A 3FHOA 1XTZA 1OVMA 4L51A 3AHHA 4IP0A 4NV3A 4MNTA 5JD3A 3N2NA 4DKJA 1JFLA 1HDGO 3P9QA 1QGUB 3FUCA 2VSFA 1GNVA 3JYNA 3CIFA 2XYRA 4D3XA 3F90A 2QRUA 2EARA 3IP1A 1U9IC 1ND6A 3ZH9B 1C9EA 2QGFA 5DKFA 1GRQA 3PFFA 1O57A 2AFIA 4FLFA 4EVQA 5IUKC 4HUTA 4QPCA 1WQ4A 2FPIA 2EZUA 1I9CA 2WWWA 3G8BA 1SCBA 3KNZA 4LECA 1YDMA 3MMPA 5EFZA 4E7OA 3K0CA 3SS9X 3EPJA 3LT2A 1SH7A 5B1SA 4TYYA 1N0UA 1P8JA 1QH8B 2DPHA 2JBHA 2TMDA 3J7TA 1PJ8A 2GM5A 3HADA 1T91A 3UAZA 4BO8A 3KC2A 3IR6A 4HI0E 4MIYA 2BTQA 5LVAA 3ZNPA 1PW5A 1ZVKA 2G4CA 3HDYA 2HA5A 5E6RB 4DGSA 3FW1A 1IM8A 3L4KA 1ZGZA 4U0KA 1BD4A 2HMVA 4BNKA 1CUWA 2A1TR 4AF6A 1IN1A 2YRXA 1QIGA 2MINA 4KO8A 5DTJA 4C05A 4DA0A 4S05A 4LV6A 1SCUB 1W19A 4NDNE 3CE9A 2WWVD 3FMIA 3L0YA 1QIEA 4YCDA 4M88A 2FZ4A 2QNRA 3QE2A 4WQMA 2V0NA 5DBFA 5JC1A 5EPEA 3SM3A 4F1JA 3BCSA 3KKPA 2FWAA 5LP6F 1QG0A 4XWTA 1QGDA 4YR9A 3OF5A 2QORA 1A4XA 1P17A 1W88A 4QG3A 1QP7A 1GQ2A 3LKVA 3IL2A 4DA9A 3K9CA 3LYHA 2HSDA 1J0DA 2YXPX 3AESB 3N2YA 4P35A 2JL1A 4U7FA 4B17A 4BQIA 5HKKD 1YA6A 2IYEA 2WM2A 2YZGA 5NLLA 3TM4A 1LVHA 2D54A 2YJZA 4MB0A 2BUBA 1WMSA 2JVJA 1KP2A 1KS2A 2G1UA 2OHHA 4UU1A 1WF3A 4YUAA 3ENZA 4UVEA 1P1CA 2C3OA 1JHVA 4YCAA 3T4PA 3LCRA 3SEZA 2NUAB 2P8JA 3A36A 3H4IA 3FHTA 1JHRA 1KXZA 4RELA 4COOA 1W0JA 3TG2A 1IFXA 1CDOA 2RC5A 1F2UB 2C8KA 1E0DA 3CLSD 5LU9A 2DHQA 5DX1A 3G5MA 1EE9A 1ORWA 3VVBA 4ZC1A 4G0NA 4RTKA 4XVUA 1KP3A 1MV5A 4W5NA 3WKCA 4JR0A 3ODPA 3TLGB 5AW2A 1PGOA 1YBFA 1FTYA 5H02A 2QQ0A 3CLKA 4RM3A 2N3ZA 4RPCA 5K0TA 2XRZA 5IFLA 4B83A 5ULLA 4ENSA 2TSYB 2C78A 3I9NA 5E3JA 4NCAA 1DQNA 4E5UA 4RFSB 5HSGA 3OWXA 1AS2A 3FCYA 3ICOA 4Z4EA 2QRVB 3U48A 2OVBA 2JFGA 1PV2A 4H6WA 1OGJA 4KK4A 3AVYA 1C8VB 2PHZA 3GPBA 3B6JA 1EZ1A 5C7IO 2QD1A 2AGVA 2IYUA 2YWJA 3B5EA 1V5GA 3VU0A 2YJTD 2IEIA 3HY3A 1QVWA 2II6A 4CU2A 3CVXA 1RSZA 1E6UA 1JVNA 3E82A 5TIIA 1KE2A 2MYPA 3AI1A 3ZW7A 2JC3A 1V16B 1N2HA 1UKEA 4CM9A 2MSDB 4NCBA 1XLVA 1KVRA 2FB9A 4I9UA 2C7RA 1G8PA 4HAYA 4G1VA 4O4HB 4WESA 3H17A 4OH1A 3LCJA 2XA2A 1G21B 2AH5A 2B1QA 4LRXA 3UC9A 2OSVA 5JH7F 5AK6A 4KFUA 4EPTA 1ZRHA 3UGJA 3AB8A 5DEOA 3FSJX 2VG8A 5T6MA 2A35A 4G8CA 4EG8A 1KY5A 1YZQA 1GGKA 2R11A 1KWKA 1YFLA 2FEPA 4JKYA 2C88A 2EYUA 2JEZA 4KGVA 4H77A 4Y0VA 4RV5A 3VPGA 5ER9A 4W7IA 3ZDZB 2G6BA 4B74A 5I48A 2GN6A 1HGXA 3UY4A 1S2GA 2GNAA 4NMMA 2AJTA 2FWNA 3M6FA 3LL7A 2GD1O 4PTLA 4QT0A 1V95A 4IICA 2IPAB 3SF8B 4F12A 4X85A 2PRJA 4H31A 4ZC8A 2CNWD 3SHOA 3UA3A 3VO8A 1VA4A 2DUJA 3OCYA 3VFDA 1LSJA 3ZIDA 1ECLA 4Z7OB 2A30A 4ZHQF 1GSOA 2ORED 3UMBA 10MHA 1E9FA 4YRPA 5LZ8A 2CNDA 4RAOA 2AVDA 4WK4B 3BYZA 5A0TA 1VYHA 5L4LA 4JBHA 5EEGA 4F60A 1W36C 1HI9A 2HV9A 3W3AD 6ABPA 2RGNC 4N1AA 4DCNA 4MINA 4TTPA 3EARA 5DP2A 5BV8A 1SRRA 2IPLA 4BO6A 1LDEA 1U9IA 2H7XA 1JDSA 1MENA 2HCTA 4TWRA 5IH7A 5JZOA 2FUG6 1M1ZA 3TOVA 5J4LA 4IDQA 4N3AA 5C1OA 3VSEA 3TFOA 3PXXA 3AILA 5BN3A 3A2NA 1KF0A 4YGYA 1J5PA 3SY8A 1VE5A 1JFVA 1XQ6A 1Z0UA 2WFMA 1VRWA 4FIZA 4LYJA 1WKCA 2W2TA 3GG9A 4KW7A 4KZKA 3ILXA 4YJFB 1Z4PX 2ZTUA 3UJ6A 1AHPA 1ZCBA 2EWVA 2H9YA 3RJMA 1CUVA 1FNMA 1UQRA 2WVAA 5CFZA 5T8KA 5I9IA 2UXBB 5EIOA 3LUAA 3BMXA 3QI2A 4MAAA 3EXIA 3H4MA 2C7VA 5JADA 5EZYB 3NEJA 3VHQA 1OVGA 1GR0A 3U56A 2Q7OE 4AZWA 5JATA 2VQDA 4UZSA 3PDWA 2QUHA 5DIZA 1M2FA 4PRZA 1V7QA 2VXBA 5TV2A 4F9EA 4AP5A 3QYAA 1JDPA 5K45A 3BBPA 4RKWA 2GJ9A 1MXFA 1V11A 3OE7D 3OLCX 3PT9A 1I2DA 2QN6A 3MCZA 4NPHA 4OAQA 5J4HA 3ENNA 2J87A 1X6VA 2VYND 2ODWA 3J81k 4HDKB 1BS1A 1KKMA 1ZRNA 3H83A 3ISVA 4NCKA 4QEZA 5IARA 1H6BA 4N5MA 4WXRA 3A70A 3U7JA 1VSBA 2ZTSA 2ZIAA 4PX5A 4D6YA 3CG0A 3KAQA 1EE1A 4FMBB 2C2GA 1C0PA 4B6QA 3FY4A 3VR5D 4RDCA 3OTQA 1EINA 3KHSA 3DD1A 3ONEA 5CK4A 2QM3A 2VNSA 1RBMA 4KR3A 3NAGA 3OZCA 4FFRA 1J9GA 2Y1KA 4GFDA 2BFWA 4Q4DA 1THMA 2QT0A 4HNQA 1U7ZA 4O63O 4BEJA 5AQ1A 3JRXA 3H2HA 1NXQA 5DP1A 2MTBA 3R9IA 5FOTA 1U0HC 4MR7A 4KQMA 3L7AA 4GWLA 5EHZA 4LE1A 5IJXA 1V8OA 2QTCA 3RYFA 1DIOB 4CMIB 3P0IA 1WF6A 3MF4A 3W4IA 3GQBA 4BKPA 3VPDA 4B5KA 2IXDA 3IVGA 4U3JB 1VLJA 1HZZC 7AT1A 5THKA 2ONCA 5T6BA 4CF3A 1GVHA 4DY4A 1XD2B 4C08A 2CNLA 1ZITA 2OC4A 3PKIA 3D43A 4AX4A 4E5PA 4KQ1A 1TNDA 4JD5A 1EH5A 5D1HA 2REQA 2Q7DA 3EEFA 4ND8A 2RJOA 4ZOBA 2JFWA 1TQ2A 4BRSA 3WNCA 4D0NA 5C8VA 3T3EA 4RLSA 4O02B 5MFZA 5JASA 2FZCA 2W6JD 2WAAA 1DG9A 3HDJA 3P4XA 3F1LA 3PENA 1UMCA 1NN3A 1PBNA 3QHPA 3RC9A 4DNQA 3L3BA 5KNCD 3K9FC 3UBMA 2ZDHA 4Z7JA 3H5TA 5LQDA 5FTLA 1I7SB 3QX3A 1SKYB 4BLOA 4C4OA 2ST1A 4QFMA 4FSHA 1U04A 2GEUA 4O08A 4P0PB 1HEYA 1RDFA 2A9QA 3AVQA 2LBPA 4LGMA 4BPRA 4EHBA 2QENA 4FMDF 5CB4F 2GCGA 3IEPA 3I0ZA 1ZH0A 1O54A 3JQ7B 4MEBA 1E77A 3GT7A 1CE8B 2B20A 2B98A 4GLFA 1R10A 4RDHA 4F5WA 4GI5A 3M1AA 1Z2AA 3C70A 1I5RA 2NTNA 1T2FA 3N9IA 1CUYA 1NVVR 1NXOA 1O1YA 4R6XA 3EPPA 1PVVA 2DHEA 4J75A 1UAAA 5AM4A 5LZ9A 3PPYA 5AH0A 1OYOA 1GAJA 3DD5A 1Z6TA 3BIFA 3MWDB 1XQXA 2YINC 2G17A 2WFLA 3PNVA 1C41A 3WO0A 1GNSA 2IUUA 3FZEA 1XR3A 2VK2A 2YZNA 4A2WA 5K7SA 5CVDA 1TECE 2OBMA 1I0LA 3R3VA 2H5EA 3GLHB 3BRSA 3GAMA 4A15A 4HLCA 1EAMA 1UBEA 3C3CA 4IDFA 4L15A 1YQQA 4E5DA 2HB6A 3C6QA 4BBAA 1QF7A 2SHKA 1UBLS 3IE1A 1S01A 5M2QA 4ER5A 2DFLA 3BJMA 2X42A 4DNFA 4XCQA 5AUNB 1RIFA 3HDHA 1R88A 3GP8A 4OU5A 3P9ZA 5BSHA 1AK1A 2R6R1 3FMFA 3DKPA 2QRQA 1Y6QA 1MD9A 4I9NA 3LTNC 4C3UA 4BEVA 3AJRA 1NLYA 1D4AA 5AWFC 1N6PA 3ZBQA 1M54A 3DOEA 4JLOA 1EM8A 4B84A 4EY7A 5KDDA 2XMRA 4TTSA 5CPFA 1HTWA 3FOBA 3R75A 5B1YA 2VP3A 3K5HA 5DGTA 1RCUA 4QGHA 5KJCA 1YAJA 3K31A 2VP0A 2XI4A 2NUPA 3KM0A 2VHUA 1M2JA 4XUGB 1MJ5A 1W87A 3W1EA 1NXXA 1P77A 3DP7A 5JXIA 4S04A 4TTTS 2WWXA 1G9TA 3P94A 4JKIA 2VO1A 1YS1X 1ZNXA 2NVBA 1UBOS 3QKRB 3UWDA 3THYB 1VA5A 4HS9A 1PD1A 3DTVD 3T7EA 4EPYA 2VDWA 4NBVA 3GR6A 5JE8A 4PICA 4MLCA 5C32A 1DAPA 1MIOB 2R3SA 2GI4A 5EJ8A 5FWXA 2RHCA 3C4VA 1XYVA 3L06A 2E82A 3K9LA 3L77A 4IHQA 4C30A 1KZHA 2CDCA 2QM8A 4MPTA 4IOKA 4RHEA 1W581 4C7JA 3K4QA 5B3AA 2AS0A 4U8HA 5GADl 4ZGGA 2WG1A 4RTPA 4B1FA 2V98A 3EVFA 3FNQA 3CPHA 3VC7A 4LBZA 5LOVF 1AQNA 3B60A 3QWHA 4MYRA 4QDOA 3GEDA 1XRLA 4P84A 4DE5A 3ESAA 3RS7A 1ATZA 3ITEA 2RGAA 4BNGA 4RNDB 4HXYA 1VSTA 4MK4A 3ZBPA 4GL2A 3M70A 2Z2ZA 1PJBA 2BUCA 3L8HA 1Z83A 2ATEA 1Z0AA 2GQ0A 1PK9A 4P3PA 3KQTA 2XSZD 3BRQA 3E9YA 2LWIA 4B6RA 2C7PA 3R0ZA 3ZKWA 3I9FA 3NVAA 1W30A 1W5AA 2H4YA 4MR9A 2AHRA 2YNMC 3FGNA 3TKYA 1Q1AA 3DB1A 1TO6A 2WZBA 4KP7A 2VNKA 1J7JA 2AEFA 3MJVA 1Z08A 4IQ0A 1EVQA 4F4IA 4PSKA 1NT4A 1D9XA 5JY6A 3L1KA 5REQA 4NYJQ 2YDXA 2ZYTX 3HUUA 5AI8A 4RA9B 4YP7A 2JA1A 3NEYA 3IMFA 3W3ZB 2FX2A 4EG0A 2FSFA 1U6KA 2SCUA 3D6MA 5TQVA 4JELA 5C8YA 5G4KA 4KL8S 2C3YA 5G40A 5GIOE 2V6FA 2VEOA 4JDPA 5LA6B 2GZ2A 2O1XA 4J0DA 4C01A 1WR8A 5JAUA 1CZRA 3ETJA 2G7ZA 4W63A 3WMWA 2OLEA 1KDVA 3H9BA 4Q02A 4QO7A 4MYSA 3ETHA 3X1JA 4AXBA 4DR3B 2GCEA 4QAQA 2A5JA 1N5KA 4RFVA 3VYUB 3CSSA 1L4MA 3MGBA 1Q3KA 3D7LA 3LHSA 3FKJA 3TE7A 4GI3A 1VI2A 4Q01A 2MIIA 2E6UX 4LXYA 2VDKB 4NJMA 4G5GA 2HUPA 3O38A 1XX6A 3KL2A 1G66A 4HSEA 4BLSA 3JQGB 5L40A 4A0HA 4S2EA 4EMSA 4NAHA 1JPUA 4L4ZA 5FPPA 2ZSDA 1CVIA 3EK2A 4P31A 3ONDA 4R51A 1TQDA 1XAHA 5FHQA 2Q28A 4FGUA 4LIPD 3SVZA 3REGA 5IXYA 3AHFA 4WCFC 1QCCA 1VCIA 2O7NA 4BAZA 2XYVA 1GARA 1X7YA 4Y2JA 1RI3A 2BZGA 2Y3IA 4FNGA 1M7BA 4HDMA 4IH1A 1BXZA 1V37A 2BFEB 4LZNA 1FFGA 1GN8A 1EFTA 2F1JA 4RO0A 1HDOA 4OHXA 3SOPA 2PUWA 3ZX5A 4C9BA 1E7SA 5D8DA 2QRKA 1V1RA 5I8WA 1DINA 1TCVA 2YTZA 1SCAA 1WQ1R 3QXSA 4DJAA 4E1VA 2BSAA 3D2CA 2IHZA 5IKEA 4QTXA 5DT9A 2OAEA 2CLFB 5IAKA 1L5LA 3NWPA 5TS2A 4YMUA 4EYGA 4I1RA 2DG2A 3PC8C 3U7EB 5JNUA 4R8RA 3W3AH 1FP6A 1X1EA 2GYUA 3PUWA 2GHQA 4E2XA 3GRZA 2CUKA 1CPYA 1M6WA 2RGCA 4W5WA 4F3KA 2QMEA 3IAM1 1BDJA 2ZT7A 5LQJA 5B3JA 3DC2A 2V4MA 1YTLA 4B73A 1QBGA 1IUNA 3V33A 4M3NA 4WMLA 1Y3AA 4LFBB 2O1EA 4ZO4A 1N9GB 5TSDA 1C2YA 2QXYA 5LM3A 2C0QA 3C5CA 1Y5RA 2B2XA 4LNHA 2ZUCA 1JR6A 3LWNA 2BFCA 3E27A 2D13A 3W8RA 5MGNA 1RZRA 1JLRA 2V97A 2VWPA 4NPCA 3WB9A 2EJUA 3FWZA 1V71A 2WJIA 6REQB 4QRIA 4HX2A 3UM9A 4KXMA 2J6BA 3LSTA 4G24A 3CS3A 4IGIA 4P38A 3UGKA 3TAHA 1WCIA 4U3JA 4JB8A 3R74A 3L1UA 3C3YA 2XGGA 2Y0CA 2WTAA 1GAEO 2GSWA 2WWTA 3C8DA 4EZBA 2PN1A 2QTVA 3LA8A 4MWTA 4YAOA 2XKKA 4AYWA 1PJCA 3FZYA 1Y6FA 3JW8A 3CQ9A 2P9CA 1DFHA 1UFRA 2F90A 2O9JA 5DHPA 4BIMA 2Y4OA 1NSFA 2JH8A 3CMCO 4MV1A 3DHVA 1Q1EA 3SYLA 2CL5A 5CB8A 3KHTA 1C3JA 4NV0A 3N7TA 3MJFA 3EODA 1DC5A 1BH6A 2JGDB 3GEBA 1W48A 3GVPA 1RCFA 1QDEA 3NHBA 1GA4A 4QSMA 1NFRA 3IDZA 1BE0A 1Z45A 1LTHR 2JFVA 2YHIA 2PEYA 3PXCX 1GL9B 1E1RD 3GVIA 4X1OA 1SHZA 2O8VA 5TS3A 4HFJA 1E61A 3H8JA 4RZUA 2Y99A 5GVRA 1ZN8A 521PA 2X0EA 5H7XA 2G83A 2KHZA 1MFZA 4MRPA 4QU0A 3ND9A 4V0OA 4YFVA 5AHKA 4Z9XA 1U7HA 4UTNA 1ZUD1 3RQSA 1DFGA 4HWGA 4ND3A 3GH3A 2Q7XA 1S0UA 4ER7A 4F3NA 4NAUA 1GZ3A 3D3JA 1VSQA 1XZCA 3S3TA 3G2JA 3ERCA 2I4OA 2B83A 3DE2X 3D6TB 3NXSA 2QQFA 4PHHA 2Q50A 4URUR 1ACJA 3QX8A 1BKDR 2YHSA 4MW1A 5F5LA 1G8GA 3LX8A 1CZNA 2ZB8A 4H18A 3T5DA 5IBCA 5IUJC 2WJZB 1PR5A 3CSDA 2BKUA 3DOJA 4XCVA 4JDUA 4B2YA 9MHTA 1IWOA 2X5JO 3KLMX 2JIOA 3NM6B 4XYGA 3TLBA 4YXWD 1EWVA 1N34B 2NSJA 3HPRA 3IQXA 1YRYE 3ZGOA 1IATA 1K92A 1VG0B 2Y2UA 5DBIA 2EBFX 4QNMA 4RDIA 5KVSA 1T1EA 3HB4X 4I08A 4FMDB 1CUAA 4PZYA 4RETA 2C94A 1QH0A 4XDHA 4K88A 2HOQA 2QY6A 1P1BA 4OM7A 1N2ZA 1TZBA 1WSWA 2AI1A 3IBSA 2JLSA 4ZCLA 4HVLA 4P3XA 2QGZA 1GXSA 2V7PA 2IIVA 3L0DA 1RHQA 3JD1A 4J9VA 1LLQA 2XBUA 4TWJA 5FNZA 3P9RA 3PR2B 1PTJA 2FW9A 2FF5A 4LX8A 3L18A 6ADHA 4JI6B 3KHUA 4TS3A 3CJRA 4OBEA 2X4DA 3RIXA 3FYUB 2BGKA 1L7PA 3HRHA 3K32A 4UBOA 5FNVF 3I58A 1ZMXA 1YNOA 2VPZA 4GDMA 4E14A 4MI1A 3W5DA 1W76A 3IQDB 3X3HA 5TPWB 5JSYA 2C96A 1U4OA 2J0UB 1OXSC 4D45A 5DCLA 4A03A 3NRCA 1ZIYA 1GYRA 1I0IA 3AEUA 3D0KA 4Q7JB 4E46A 3R3XA 3CISA 1CC1S 3GGPA 4P7KA 3SX0A 4MEJA 2O2HA 3WQRA 1ISFA 5TNXA 1U2EA 3QX9A 5IFKA 1L2TA 2GFHA 5DYGA 5LXTF 2XYGA 4WZAB 5G1NA 3L0ZA 3LCMA 1NI4B 3CRVA 3LYAA 1DQZA 5CH5A 3ZLUA 1PV4A 3OUTA 4JBWA 3KDAA 1S8OA 4HX9A 5CFPA 5F1YA 3R9WA 2W6OA 4RZHA 1TA0A 1QVRA 1GEEA 2YFHA 4OHKA 1SCJA 5EJ4A 3K92A 3WMEA 4AZVA 2PGLA 2RCNA 4FEEA 3SQMA 2WF6A 4E51A 4LYGA 2GAJA 5EXDA 5GJCA 2NU6B 4F2WA 2CMGA 3FDFA 5JRDS 4E5SA 3ND5A 4QM7A 1KPIA 1CS4C 2HQSA 1DWPA 3D2LA 2HWUA 1WOYA 4DDHA 2AC4A 4MQBA 1YB7A 2RHLA 5ARDA 2GEVA 2GBLC 3ROQA 4EHIA 3FJOA 2Z2XA 5HJ7A 5FWAA 4LKRA 5ALDA 2EP7A 1G7TA 5C37A 3GUHA 2NVUB 5FUBA 2V58A 5D3QA 4NYMQ 3TLYA 3Q6NA 4X20B 1W4RA 4I4CA 2OP1A 4TKZA 4MUKA 4NX2A 2WQ6A 1IG0A 4N5HX 1X3LA 1AKMA 4OD0A 3F2IA 3JX9A 3R44A 4EABA 1RYDA 3Q0EA 3UJ9A 4K0RA 2D8MA 3BDAA 3DTNA 3PQEA 4JBNA 4W9NC 3DT9A 1SVOA 5CGZA 1Z5NA 2VF8A 1JBKA 3GGOA 2IYSA 4NCNA 1SXIA 3T3HA 4CIYA 1C1DB 3G5AA 4WBNA 3RV3A 2IZ1A 3PL5A 2PQMA 2RC6A 1G8HA 3AT1A 3EFBA 1PS8A 4KDRA 4MDYA 2J5KA 3VR3A 3U81A 3F9CA 4E4TA 3U13A 3RLFA 3OZXA 3F47A 4M9SA 3UXMA 2PEZA 1FJGB 1V25A 3WQSB 2ODEA 2IEGA 1DC6A 1FFBA 5JNVA 4MPJA 4AJ1A 3EIFA 3KZOA 2X1MA 4E6EA 3KQNA 5HYVA 3G2NA 4U5XA 1VPDA 3CU5A 2E0IA 4Z99A 4KLNA 3RHTA 4XUEA 1M2EA 4ZI7A 1GCUA 2BDEA 4LV5B 3IQFA 1LTKA 1Q91A 4KH0A 5CA1F 5GGXA 3M33A 3ICQB 2RH5A 1XF9A 3LP5A 2JFPA 4QEDA 3O1LA 4QNRA 4DABA 3FGZA 4A8TA 2GA8A 3MRXA 2GDJA 3RSHA 1NY6A 4NL4H 2FQYA 4DLRA 1G41A 2J3LA 1WP9A 3EBPA 4A8JB 4BMSA 2HT6A 1WMBA 1BXKA 4D96A 1PJ2A 1AQIA 1P73A 4PIPA 5E1BA 3RFUA 5M29A 3ENQA 5GONB 4C88A 5EIAA 1FCJA 2QRNA 5HQ3A 3LVFO 4TZ6A 3H86A 3N0VA 4JUFA 4RZXA 2O05A 4ZPXA 1RWVA 2PO5A 3CX3A 4CW7A 5CDHA 1T5TA 2M9MA 3E3OA 3GO4A 1TT5A 2QHXA 3OY7A 4WLFA 3KV1A 3NRBA 4MRAA 1ULAA 1Z2NX 4WJZA 3Q8WA 4KN5A 3RVOA 1EWRA 3OLWA 3A1UA 1MEJA 1AH2A 3OIGA 1BVRA 3WL5A 1XNRB 1E2FA 1PSWA 1QYXA 3ORQA 4IFEA 4MRVA 4H1TA 3GLFB 1YNSA 3DEFA 4G0YA 4WCDA 1AZLA 4OJMX 1NOJA 4F4UA 4EGFA 1SU8A 2AFVA 5IAAA 4DQLA 3D6NB 1F2DA 3TRFA 3WZMA 2P0EA 1AUXA 2IBMA 4L7QA 2AOVA 3U3DA 4BUZA 5KHLB 1TCAA 4HZUB 2CHQA 3HKBB 4OHFA 4RGYA 1ZGAA 3WISA 3LQRA 5KWEA 4G8DA 4RJIA 3W5BA 3EFHA 3B1FA 3KO8A 5CG1A 3L5OA 3PLNA 5HZKA 1HWYA 1L5ZA 4B8ZA 3FUVA 4HRAA 4ABYA 3NBFA 4KR6A 5LA6A 1NQUA 3UVEA 1U2QA 3IAHA 4BNNA 3HKCB 1NRIA 3SHTA 4MKIA 1X1CA 1XZHA 4HWTA 4X6XA 3HP4A 2W8ZA 5DNVA 5AKXA 2K2WA 3T1OA 3I8XA 4MKXA 1J25A 2VK8A 1N1GA 1Z0IA 1KC1A 3I12A 1F1BA 1DWQA 3P7MA 1G59A 1LC0A 4TKLA 4FT4A 1EXDA 2IPOA 1VKHA 1DCMA 1ZGCA 3CBGA 3MFQA 5CX1B 4UM9B 3ELYA 2A92A 2XITA 1WSDA 3G49A 1FP4B 1IEVA 3MSXA 3NYQA 3VO2A 3W34A 1KO5A 3E5HA 3NC0C 3PUYA 1C4XA 4H2DA 4Y0NA 3VQTA 1PEKE 4EF6A 4RA6A 3HA3A 1U8ZA 1GPYA 3H3XA 1U0TA 4CI9A 1DX4A 4DLKA 2G1KA 1DBQA 3ZXSA 2YHAA 1KH3A 1YO6A 2VPTA 1QGZA 1EK1A 1VCOA 1X13A 2BM1A 2XMGA 3NC1C 2G8LA 3IURA 3QEMB 3U0BA 3AUFA 3L8MA 2H4FA 2O4UX 5D01A 4V0KA 1BU5A 4LSGA 2O3JA 2XHEA 3VR2D 1PT5A 2X1HA 4NS1A 1BX1A 4LKOA 2WHPA 3SZMA 2OORC 1NUHA 3FVQA 5ALXA 3I76A 3KPVA 2EX1A 2HRRA 3AUJB 1M8JA 1G6Q1 3ODGA 4QGFA 4WLVA 1MQSA 2EFYA 4RBNA 4KVAA 3ZWWA 1XZMA 2W4MA 4GOJA 1WZ2A 3G7UA 1CS0B 4P32A 1AM4D 3OCVA 4WKNA 3LP8A 3TUJC 1CUBA 1A7KA 2XJ4A 3RBVA 2HPAA 1R0KA 3M9XA 1VFPA 3TE6A 5IDWA 1GQQA 1WULS 2OCIA 3K71B 3DFMA 1TIBA 4FNMA 3QWAA 1LLUA 4B2PA 1Y4UA 4F91B 1JEEA 1GCGA 1LPOA 1NF2A 1G9SA 2HADA 4K9RA 2QG4A 1Z2PX 5L3SA 1VPVA 3LWBA 4HB4A 4GBMA 1P7ZA 4PSUA 2BI4A 2Y8EA 3PFHA 5B5SA 4A8PA 4D9EA 1HDCA 5DHRA 4EY3A 1H0HA 3W5SA 2IEBA 1NVDA 2VKQA 5E8RA 2VKTA 3BE6A 5F3WB 4CKWA 5LQMA 1ZU4A 3I6BA 1RP1A 3GLVA 3ANXA 4GZ5A 4HL6A 5A4FS 4O2RA 4FGWA 1ULHA 3LLSA 3G1WA 1ZCAA 3U4QA 5JAZA 5B7QA 4G0OA 2UVQA 1J1UA 1A9OA 1N5OX 1DT3A 1WCYA 4RMJA 1P0MA 1CF9A 1GU7A 3DDNA 4R3NA 1JIVA 1L7QA 1O58A 3ZHVA 1Y1TA 2IH2A 3QPBA 4F21A 3OTGA 2VJCA 3EUAA 2J33A 2RJNA 2VT3A 1Y3BE 3N3BC 4FX2A 2FPWA 3R5HA 4QDKA 3W8FA 2AXNA 4I14A 1QQBA 1L8LA 2G1AA 3SZGA 2D1FA 1E1QD 2H51A 1BW9B 2HXYA 3BWXA 4ZIRA 4NXNB 4NOMA 2I2XB 4IIJF 3QTLA 3RS8A 1G8YA 1N1MA 3GRVA 5PNTA 4E1BA 1O7JA 3A1DA 4OU4A 5JDCC 2H48A 2IY7A 3H19A 5PGMA 5SYAA 2XB6A 5CTJA 1I1OA 1Q22A 4IOLA 1YFKA 2P1RA 1OIXA 3EXAA 4RMNA 5GZ1A 2PUEA 1AK9A 1EBBA 4DR4B 2HFJA 2YOGA 3C8MA 3G13A 2QTGA 5C2JB 5CD1A 5FBHA 3HYSA 5TPZD 4TMWA 1O3YA 1YQGA 2WIDA 4OBWA 4RMIA 1WKBA 1J9ZA 2EWMA 1B8PA 3NONA 4X91A 5K99A 2C4MA 4PQFA 4S1OA 5EYPA 1NVTA 1CJVC 2CFRA 1OBCA 2VJKA 3P9IA 1O0BA 3CUVA 3G1TA 1Z9BA 3M6MD 4D46A 1N2EA 2W22A 3QH4A 2FPXA 4S1WA 4YX9A 4MV0A 3OKPA 5GMOA 2GBLA 2BI7A 2OCAA 3B52X 3HLKA 2VAXA 1K0FA 4BMNA 3PU6A 4MA0A 4O3MA 1ZA2A 4KAXA 5BWMA 3SR0A 1KSHA 1QS0A 5BQOA 4UREA 3U3OA 2IEZA 3K0EA 4FYJA 1I7PA 3MTBA 2GERA 3R9XA 2MYNA 2IYAA 4RDXA 2NZWA 4TUYA 4GMHA 4IH9A 4FBLA 1IBSA 1UQUA 5F1OA 5LPNA 2Z4SA 2ECFA 3DULA 5EPOA 3SXJA 2P9QA 1H0KA 3WJ1A 5IT4A 1E2BA 1L5HB 5CIQA 2I6QA 4C0WA 5BWLA 4EJ0A 4DOMA 4BFSA 5DHUA 1JJ7A 4DUGD 2XX3A 4WW0A 5A5FA 3AQ4A 1YOVA 2YJGA 4QPJC 3VHLB 2VP9A 3PG5A 3B9QA 3OFND 1IUPA 2JCXA 2PZAA 1JHDA 1KJZA 4UCQA 1FS5A 2XUHA 4H27A 5DNEA 1CERA 2FE4A 3ZHTA 1NVWQ 1Z6PA 2O3RA 3T5MA 1GKLA 1XCJA 4DZTA 2VJYA 5FEMA 2I2CA 1DZIA 5EG5A 2GNOA 1OH8A 4IPTA 4PG7A 2Z8YM 1PS9A 4UXHA 4WZAE 2FXIA 3N0WA 3O90A 1NFQA 1P9WA 1XJCA 3FN4A 3G9XA 4B45A 1QKIA 4L5AA 5AJVB 4IHJA 2BEUB 2QLLA 1EZ4A 2AJCA 1O96B 1C1XB 4MW5A 2WKWA 5AYVA 4B4DA 3JAKA 5EJIA 2V1XA 3C85A 3NHJA 1KZ7B 3HBLA 1P5JA 2HIAA 2P5YA 3Q5EA 2X22A 4TQGA 4MVJF 2EJCA 5IU6A 4Q3CA 3FPHA 3ZZTA 2XGOA 5I9SA 4Z51A 1Y9ZA 2LIPA 2WT8A 1C0IA 9GPBA 1MC8A 2CHVA 1XQVA 1DBIA 4NS4A 4K81B 4R2LA 4EDFA 1QZUA 3FDIA 4UC0A 5FWYB 1V4NA 2FI1A 5I4CA 2H1HA 3QE0A 3ID6C 3UJDA 4BGEA 3IKJA 5FOXA 1OX4B 5A7FA 3NNDA 3OE5A 4MWDA 2EG9A 4BNDB 3LW8A 2BR3A 4BZPA 1NUSA 3L6EA 1MQAA 1NRXA 1JJFA 1QG6A 1Z17A 2ACWA 3AV3A 2Z5VA 3T61A 1L4EA 3UMGA 1IG3A 2CVPA 1RW4A 3T3NA 3ITNA 1JN0A 1KEZA 2OAP1 5EA2A 1BOFA 3PC4A 5J40A 1HDIA 2CMFA 4DJ5X 1IQUA 2CLMB 5DHQA 4Z7QB 7GPBA 3DCYA 4IQ8A 1KH2A 3KUDA 3AJ9A 2EGGA 2X4LA 3PUZA 4M6WB