5HS6A

Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with estrone
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
257
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
total genus 92
structure length 257
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs6A00
4M89A 5ER6A 3QW2A 1YO6A 3QVSA 2J5KA 5U4QA 3IKVA 3KV3O 1DFHA 1V0JA 5U1PA 4BNWA 3R0IA 3DB2A 3PQDA 4OGWA 4RF2A 2PH5A 2XF8A 3AUSA 1R4MB 4PLTA 3NDIA 2JCYA 4MJLA 2GSDA 4UEKA 1WDKA 3OEYA 1E6UA 3RFTA 3ZV5A 3NRCA 2VUSA 3DBHB 4MKZA 3JCZA 3EK2A 4O5OA 2JHGA 2FPPA 2QZ9A 5TC4A 1CDOA 4IJWA 3DMTC 4CUZA 3IKTA 4JJFA 5CEEA 4YQYA 4PVCA 4KUEA 4WEQA 5KIAA 3LT0A 2OFPA 4RGBA 2DTEA 4PRKA 3KETA 2VN8A 2EEZA 1HDRA 2BELA 2D5CA 4AJKA 4ILKA 2EW8A 3I9LA 3B20A 4A10A 4DBZA 1PX0A 4CLOA 1KVSA 1ONPA 4UUNA 3KUXA 4DGSA 1RPNA 1MA0A 1UP6A 2F00A 3OIDA 4FFLA 4CQMB 3DZHA 1X0VA 3HZZA 2ZJ0A 3RUFA 2RHCA 5BSEA 1V6AA 1V9LA 1RWBA 3E9MA 4HNGA 2DBRA 1E3IA 8LDHA 1LTHR 4YJGB 5KVQA 5TGDA 3OETA 4CM8A 2NTVA 3OICA 4J0EA 2GO1A 3KSUA 1BSVA 4UVIA 5BNFA 3GZNB 3P5SA 5F21A 5AVOA 4DLBA 1E1MA 1PJ3A 1QKIA 3EUWA 3ICPA 5CEJA 4AJ1A 4ITUA 2QRLA 4MVJD 1YBAA 1U3UA 4LCJA 3BMCB 5KJ6A 3RJ5A 4S3MA 3PHLA 2Y93A 1U8XX 3F1KA 3IS3A 4R3WA 2PKRA 3BZUA 3GDOA 5BR7A 4KWHA 1LLQA 4N5LA 4XWYA 1NQAO 4FDAA 2HK9A 1P45A 1X1EA 2DC1A 3BMOA 4I5GA 4BNIA 3TQHA 4RVDA 1C0LA 1PJTA 1X14A 2FY8A 2JFGA 3M1LA 4ZD6A 3I5MA 5EERA 3RASA 1TXGA 3WMXA 4XRGA 3ZU4A 5I7FA 1DSSG 2O7SA 3FPCA 2AQ8A 2B4QA 2EF1A 1N5DA 4URFA 4MIOA 4IM7A 1DJNA 4QO8A 3JQBC 4I1IA 2GN4A 3RI3A 3H9JA 4ALLA 3OFSA 2NU8A 4NG5A 3I23A 2X5KO 2Z95A 1SMKA 3JQAB 4YQZA 4IJVA 1NVTA 4NBWA 4PLCA 4DYVA 4E4YA 1LSOA 2IE0A 3ZZNA 2HQ1A 4Y6PA 4ZN6A 1A72A 3M6IA 1NVGA 3S8MA 4CLEA 1JDJA 2WYVA 4OSOA 3U3XA 4E5MA 3W4IA 4CUKA 1Y7TA 4I9NA 3ZI0A 1A71A 5DCWA 4BO7A 2Y05A 4IJKA 3ORFA 4FFNA 5G4LA 1PGNA 3ONDA 4ALIA 5KWEA 2Q1UA 4E13A 3WIDA 2BKAA 5DT9A 4Q3NA 1GUFA 3K96A 1YOVB 4XYLA 3WX0A 3OIFA 2HK8A 4HXYA 1HZZA 3MTJA 2D5AA 5A04A 4YJFB 1EBFA 4MP8A 1U2DA 4QFDA 3M2TA 3C3XA 1H9BA 3GK3A 4IINA 5F1PA 4GGPA 2B5VA 5A9SA 1CF2O 3GNTA 1P1HA 2HMSA 1K6IA 2WMDA 4YJHA 5CDUA 5I9NA 1JVBA 4JCOA 1VI2A 2WEKA 1XKQA 1BVRA 3GEGA 1AUPA 3CKYA 4CV1A 4B7UA 4C4OA 1F8FA 4WNCA 3RUCA 4E3ZA 1T2DA 1Y8QA 2Y66A 3C8MA 5JLAA 4RQTA 2YV2A 1QV7A 3M1AA 3VPGA 2ZJ1A 3KBOA 2W2KB 4Y67A 3JYLA 1PJCA 3LLVA 2AMFA 3QV1A 4TRJA 5F1OA 4BNTA 1E1NA 3A14A 4QUKA 1KVTA 3BXXA 3D3WA 4BNMA 1YL5A 2BGLA 1SAYA 4ESOA 4FD3A 2ZCVA 3D5QA 3CIFA 2JAHA 3V1YA 3PYMA 4L4SA 5CEFA 3HDJA 5CG1A 2O3RA 3WBBA 4PN3A 1X15A 4B3JA 3ZV3A 1IPFA 4TRRA 5CPFA 3PI7A 3H9GA 4UVEA 4AFNA 1WAMA 4HFRA 4YRAA 2WTBA 1T25A 3D5TA 3FBTA 3FNGA 1YB1A 1KEPA 2P9EA 3JYNA 3PYXA 2NTNA 3ZWNA 5AXDA 2P9GA 2G82A 1K6JA 1OI7A 1FF9A 2A94A 2GNAA 3CE6A 3AOEA 4NFYA 1GR0A 2Q2VA 4R16A 4PLVA 3L9WA 3UICA 5KKCA 5THKA 4II3A 3WFIA 1ZEJA 1UZNA 4MVJI 2HCTA 2FPGA 1NQOA 1GPJA 3O03A 1KEVA 3PQEA 1E7YA 5CDTA 5AYVA 2HRZA 2X1HA 4I5FA 3RBXA 3QLJA 5DCUA 1CQJA 4C7KA 4CR7A 3T4XA 1X0XA 1P74A 1ZKMA 4E30A 2V6FA 5JS6A 1D7OA 4WGGA 1M6WA 2EKPA 3IUSA 4L73A 3VH3A 4NH4A 1GU7A 5CDSA 4KTTE 5CPBA 2B83A 1SB9A 3OQBA 2H9IA 4HFMA 4OAQA 4OH1A 2HMVA 4R9SA 4XGKA 3RWBA 1Z6ZA 1YJ8A 4DYDA 5IDXA 4YT5A 5ENDA 4MIYA 4A5OA 3I3OA 3LK7A 2DUWA 3L6DA 1HDCA 1ZSYA 3VPXA 4BMSA 5A06A 3GDGA 4BMNA 4YRBA 2BMAA 3RCBA 1GV0A 1HDZA 5JPIA 1PWXA 2BRUA 2FRDA 3EVNA 4LGVA 1QRRA 3JYQA 5EQFA 3VKUA 2CZCA 5A1TA 1ADBA 3NAQA 2FR8A 1LBEA 2WSBA 3JQBA 5A9RA 1J5PA 5TT0A 3ZNPA 4CMGA 2D3TA 5IG2A 4YBZA 4M87A 5A4DA 4DMMA 4GMGA 2V6GA 1R12A 1E6EA 4XJSA 2ZIZA 3NJ8A 3KVOA 4L4RA 1B8PA 2DPHA 2J6IA 3DAFA 4TVBA 4NFHA 3SLGA 2J3HA 3ETGA 2OOSA 3ADOA 1CJCA 3DMTA 1DC6A 3GGOA 4FC7A 1M6HA 4XKJA 2DU8A 1EQUA 1IE3A 1UR5A 3T7CA 1OOEA 3EMKA 1K5HA 3GUYA 4D42A 1E7WA 4DC0A 4N5MA 3EGOA 5ITWA 1GDHA 4LMPA 4R1SA 5DOVA 3ZU3A 5T6BA 4B4OA 2YDXA 2JCXA 2E82A 2X4GA 3L4BC 1L1FA 2PWZA 1B2LA 1LA2A 4EJMA 5H81A 3QJ5A 3LT2A 2QHXA 3HDQA 3PQFA 1HLDA 4I9HA 4JBHA 5EMHA 4G81A 1E0DA 2C5AA 4EI2A 5GMOA 1ENYA 4ROSA 2ZB8A 2EKLA 5I9LA 2NUAA 2NSDA 4MVJM 2HK7A 2C59A 3H4VA 2VCYA 3OMLA 2Q1SA 4HADA 1WDLA 4NZ9A 3IC5A 5JBIA 1Y5MA 5FI3A 4YYZA 1WW8A 3AFMA 2FSVA 4YTEA 4B7XA 2VHWA 4CLOB 4IIVA 4TRNA 5I8ZA 4B8WA 4J9VA 3ZWPA 3B70A 1UP7A 4JP3A 5G0UA 1EVJA 5F5LA 4CQMA 1P77A 5B4VA 2I65A 3JD1A 5BQFA 4FW8A 3ASUA 4ND1A 3WNVA 2O3TA 3K92A 2EJWA 4LVCA 3PK0A 3TL2A 1IOLA 1ZO8A 2Q2WA 4EUFA 1F17A 3ZWWA 4IDDA 1VJ0A 2I5PO 2JL1A 1DRVA 1CIVA 2AQHA 4IDCA 1LDBA 5EQDA 5CDGA 1M67A 3D4PA 4OM8A 4E5NA 2ZTMA 5DP2A 4PZEA 1ZMTA 3GGPA 4A26A 1O95A 4ZRNA 1HKUA 2Q3EA 3L6EA 3OJLA 3QWIA 1P1JA 1EDZA 3VPHA 2NNLD 1UXGA 3ULKA 1UXKA 4TQGA 3ONEA 1LLCA 4TKLA 3E82A 1P0CA 3FNEA 5F1KA 3NV9A 4BNYA 4JX8A 2VTEA 3GH3A 2CVOA 1A4UA 1GYQA 4PLZA 3KZVA 1E3SA 5JW6A 4PLPA 4WLUA 3BMOB 1PZFA 2DTDA 2FHSA 3PVZA 4XA8A 1JWAB 2VRCD 4WCDA 2LDBA 1DIGA 1YKFA 5ER9A 3TWOA 3KO8A 1K6XA 4FOOA 3IUPA 4NJMB 2O23A 2BHLA 1F0YA 4RPGA 1T1RA 4RO0A 5JC8A 5A03A 4Z9YA 3PDJA 2CF5A 1EEHA 5T64A 1LSUA 3WLEA 3U09A 3PP8A 4D0RA 1B7GO 2AG8A 2NWQA 1CETA 2Q1TA 5EINA 4JN6B 5FF9A 1PZGA 3JQ7A 1F06A 1UZMA 4O63O 4FJ1A 1NX6A 1VJ1A 3RVDA 5GY7A 4F6LA 1J6UA 2CDAA 3TZKA 1U8FO 4DIOA 4IIUA 5DOZA 3UN1A 5JDCA 3TZHA 4LK3A 4PLYA 2DBZA 3IQDB 4Y9DA 1H6BA 2HAEA 2PZMA 3GOHA 4NFSA 5B4TA 2SCUA 4QSMA 4YB8A 1YOVA 4J3FA 3GFBA 1ZK0A 2B0JA 3NTOA 5HS6A 2VQ3A 3UH1A 3Q3CA 4BO1A 4YT4A 1XIVA 4G65A 1IPEA 1ISFA 4O0LA 4ND5A 2J3JA 3KHUA 4DUPA 1ONNA 1ZJZA 4JXKA 3K9QO 2PA3A 1A7AA 1N1GA 3BMQA 2GD1O 3E03A 4QXMA 4X54A 4W7HA 1I2CA 3F4LA 4RL6A 4FR5A 3WMWA 3SLKA 3WGQA 4BKPA 3CMCO 1SO8A 3DZBA 3KEOA 1EVIA 3DBRA 3V1TC 1A9YA 5EPOA 3KYDA 2VHVA 4ALMA 4R5MA 3DOJA 1RM5A 4H3VA 1YS4A 1PEDA 3SC4A 3ROPA 3ZW9A 1YQGA 1O0SA 4AJHA 1BWSA 3N7UA 3PXXA 3VDQA 1OMOA 2EJVA 1H9AA 2NV6A 4MVJE 4BNNA 4CLRA 3TL3A 3FTNA 3ZV4A 3GGGA 4CV3A 1R4MA 1YXMA 4DXHA 1X7DA 3GFGA 4J4BA 4JP2A 4CM9A 3GVXA 2PR2A 3GAFA 3W8EA 1C0IA 3TRIA 2DAPA 3JQGB 1SOWA 4RVFA 5TRTA 4B7CA 4WCFC 3PIIA 1Y5RA 3KLPX 2YQ4A 2V7PA 3ZWAA 3IMFA 1BHSA 3E9NA 3ZHXA 1C0PA 1ADCA 2P5YA 2E37A 3I9KA 3BHJA 5KKAA 4XYGA 2X9NA 1SNYA 1EFLA 1ZJYA 2R2GA 3HG7A 1G1AA 2PH3A 3DONA 2R00C 1DLJA 1TT5A 3QWFA 2G76A 2I76A 3FNFA 3WOHA 4BV9A 4MKRA 4IXWA 3RC7A 2EWMA 1PZEA 4KP7A 4MP3A 1T2EA 4R69A 4RZIA 1KY5A 3BIOA 3PGXA 4GKVA 2ZATA 5F5NA 1ZSNA 4AL4A 4CQLB 3VPSA 4GVXA 1BW9B 1ULSA 1C14A 1QLHA 2WD7B 3UKOA 1D1TA 1QYCA 4NBTA 2NM0A 5U9CA 3PDUA 3WYCA 3O38A 4GVLA 3AY6A 2E4AA 3DL2A 1DC3A 5A3JA 2VYVA 3DWFA 1PL7A 3QWAA 2X9GA 1RM0A 1LC0A 3DAPA 3QQPA 1I32A 5MDHA 1UDAA 1Q7CA 2IODA 2ZKLA 4P38A 3VH1A 2JAPA 4ONEA 1UXJA 1JKFA 2IZ0A 1Y9EA 4CR8A 3S2GA 3QVTA 4OOFA 2X0RA 4KMSA 1O6ZA 4BO8A 1FJHA 4ND4A 4FJ0A 4PIVA 4DQVA 3S2FA 3BMCA 4M49A 4R1NA 2FPIA 3V2UA 4D44A 2AE1A 1I3LA 1PU2A 4BVAA 1XQ6A 3C1AA 1H2HA 3ZHYA 5K6AA 4RDIA 3UGKA 3OH8A 3U4IA 3WBFA 1HYEA 1ZK2A 3OEWA 1E3LA 4B3HA 3E5MA 3TOXA 4BO9A 1E5LA 2O3UA 1OZAA 5L40A 2IYPA 3BAZA 3VH2A 4XX0A 5G2OA 1UXIA 2CNBA 4RLHA 3X2EA 1SZJG 3EDMA 1JKIA 4JLWA 3ZW8A 2BLLA 1NPYA 4WPGA 1YL6A 2BI8A 4D3DA 4WNIA 4Z6KA 4PZDA 2P4QA 3AU9A 3I6IA 4L74A 4FS3A 4A0SA 4W4TA 4JK3A 2RCYA 9LDTA 3Q2KA 2QRJA 1HE4A 1ZK3A 1E6WA 1C1XA 5I8WA 4BGIA 2PY6A 1LDMA 3ETEA 4IZHA 1R4NB 4J7UA 4GKBA 1XLTA 2V6MA 5DULA 4RPKA 2JD2A 3GR6A 4JJGA 4L0QA 3B6ZA 2JJYA 5IFLA 1ISGA 2D2IA 3ZV6A 2P2SA 1GQYA 4YAJA 1BDBA 1WMBA 2X0NA 3U4CA 3R3JA 2DKNA 1AGNA 4KQWA 3JQDA 3WIEA 1PQPA 2QX7A 1T2AA 4CMAA 1HRDA 1VL0A 3RC1A 1Z73A 1E7MA 1KYQA 1LLUA 1N8KA 4WOKA 2B5WA 4M8SA 4NU5A 4YJFA 1XWFA 2DVMA 4YJDA 3G1UA 2YFQA 3D1LA 5TT1A 1NNUA 1PQWA 2CUKA 4NBVA 1X13A 4E33A 1AHHA 3ABIA 4Q3AA 4OKNA 5C5IA 4BNHA 3SEFA 2EERA 4EZBA 4UVGA 2X9VA 1NHWA 2DFDA 3CSDA 4GLOA 1R37A 5KJ1A 5I7EA 2C2YA 1DHRA 4KOAA 1FDWA 4IDAA 4N54A 4LMRA 3W4KA 1WNTA 3INTA 1DIAA 4BV8A 3AM3A 2JCVA 2OZPA 1RJWA 4ZQGA 1N9GA 5K9ZA 5JAIA 1XELA 4DQUA 3QWHA 1PS9A 4B79A 1W4ZA 1XYGA 4J1SA 4JBGA 3U5TA 1KVRA 3BHIA 2EW2A 5G4KB 1XHLA 1DPGA 4UVDA 3INRA 1QYWA 3F1LA 4OKIA 3INGA 1EUCA 2BD0A 3G79A 3KM0A 6LDHA 2W8ZA 3A28A 2I3GA 4Z0TA 3I9OA 1R66A 4YT2A 3PLNA 2UUOA 2QG4A 1GCUA 1E77A 4FB5A 1O5IA 3H5NA 3MOIA 1SC6A 2Q45A 5A05A 1E7SA 4MVJH 5TX7A 2ZTLA 3WGHA 4Z0PA 1OBFO 4CM1A 1XEAA 5KOIA 4IS3A 4NIMA 4D46A 1U5AA 1PR3A 1VE9A 3WTBA 1D1SA 2VZ0A 4G5HA 1GV1A 3DFZA 3G49A 4J2HA 2FP4A 1T4DA 1Y8RA 2YV3A 3KRTA 2CDBA 4R1UA 5JO9A 3VKVA 3DEYX 3HHPA 3AUTA 3V2GA 5JCJA 1KOLA 2C07A 1ENPA 2ZB4A 3D3EA 2TMGA 3WQQA 1U2GA 4Q3DA 4Y98A 5DBFA 3FTPA 4N18A 5KNLA 1NXQA 2DM6A 3GN2A 2X8LA 3NT4A 1LRKA 4RQUA 4E6PA 4FCCA 1V3TA 3KB6A 2ZCUA 1VPDA 5JY1A 1DFGA 1EE2A 1NAIA 2IXAA 4ALNA 4EJ6A 2CFCA 2X0JA 2P9CA 4DMLA 1H93A 4J1NA 1R0SA 4BO4A 5IDWA 2PK3A 1SOVA 4RVUA 3HE3A 2RHRA 2W2LD 2Y1FA 1RKXA 4D45A 3Q6IA 4L8VA 4RVHA 2HJSA 1VLLA 3PIDA 5G0SA 3ROQA 3WDSA 4TMFA 5JNLA 3PRJA 1JA9A 1CWUA 2O48X 3HB5X 2I66A 3LYLA 4D0SA 2WJPA 1QG6A 5KCZA 2RBEA 3E1KA 3D0OA 3K31A 2PKQO 3DZFA 3P2OA 2V6BA 1MLDA 3VZRA 4AVYA 2X5OA 4BKQA 3AI1A 1F14A 1I24A 1JVSA 5IDQA 2EV9A 5MGBA 4IS2A 1HDYA 2J3KA 4BQRA 2GRAA 4O1MA 3JTMA 3ZWVA 4FN4A 2VNSA 2CVZA 1BRMA 2QW8A 3WNQA 2GUGA 1JU9A 1ZEMA 3OJEA 4MKXA 3FRJA 3ZWMA 4CLRB 1PIWA 3KEQA 2HU2A 3WGZA 1DIRA 3P7MA 4RV9A 2AEMA 4GPD1 3V1UA 1NWCA 3TOZA 2XXBA 5JAZA 5DBIA 3EC7A 4J6FA 4Z0HO 4BO0A 3GEMA 2DTXA 1ZUD1 2R6JA 3Q11A 1N2SA 5T67A 3WFJA 5FEUA 4WCFA 3UXYA 4XDZA 1VJTA 1NFQA 2Q50A 2C54A 2Y1EA 3KOUA 1JQBA 4P22A 2VWGA 4LVUA 3RUAA 4RZHA 1P1IA 1ZIDA 5GZ3A 4CM4B 1WDMA 3DBLB 4KDEA 2C29D 4R5HA 3MCVA 5L7WA 4TKMA 1IUKA 1F8GA 3O8QB 1P3DA 1TI7A 1TT5B 4K6FA 4IZIA 2JD1A 2PKQP 4RPLA 4NK4A 3UF0A 5A3VA 1SB8A 1M75A 2VT2A 2GERA 3JD2A 4IQ0A 2GLXA 1W73A 1EE9A 2G1UA 3WYBA 4PG7A 4WUVA 1MB4A 4B8ZA 3PWZA 2WYWA 4CM7A 2ZB3A 2O3SA 4CMIA 3PGJA 1MFPA 3QE3A 1MG0A 4L4XA 1IHYA 4WLNA 1K2WA 2GDZA 3DQPA 5I7SA 2A92A 4NHEA 2OHXA 4DIBA 4H15A 3IDSA 1E7QA 4BNFA 1PS0A 3JD4A 4CV2A 1PJ4A 3UCEA 4CLHA 4IGEA 2WYUA 4IUYA 4HV4A 3GHYA 1PSDA 1AN9A 2ET6A 1U3TA 5FYDA 3ITDA 1N92A 3EHEA 4FBGA 3W6ZA 4CODB 5IJZA 1GD1O 1IULA 2FMUA 3PHGA 3EW7A 4MDHA 4ALJA 2PNFA 4J7XA 4YPOA 4J7CA 3FR8A 3RFVA 1A7KA 4OL9A 3X2FA 1R15A 3VC7A 2H63A 4JROA 3GUCA 4NPCA 3GVCA 3SBOA 7MDHA 3COSA 4MIEA 4M86A 3HNPA 4M55A 2I3AA 4CUJA 2NVWA 3S2IA 1H5QA 5L9AA 4QTZA 4PLFA 5HBRA 2VRBA 3PJFA 3HB4X 3HDYA 2NADA 1X1TA 3NT2A 2IYOA 5JMPA 3H9QA 4W7IA 2VUUA 1LX6A 4MPDA 1GZ6A 3QY9A 5AOVA 3EZLA 1T24A 2X0IA 1Y9AA 4KDFA 3LC2O 5T8KA 4C7JA 2Q1WA 3QVOA 4XB2A 3JQ7B 3UW3A 5L7TA 2EP7A 3QVWA 1YGYA 3MJVA 3RIHA 5L4SA 2FOIA 1FDSA 3FNHA 1BG6A 1HYHA 3L77A 1J49A 1XSEA 5BSGA 4UAGA 3QVXA 2J5RA 2GZ3A 1NWHA 3OA2A 1I33A 3S2EA 4HWKA 3PJGA 4Y6SA 4YVFA 5EJ2A 3B1KA 1ARZA 1TB4A 4PGFA 2IZZA 2PLAA 4BNKA 1C1DB 1EVZA 3ANLA 3JQFA 4BGEA 1HTBA 2PTGA 2VTDA 2AE2A 1YQXA 4PG4A 3SC6A 5A5EA 3K30A 4YT8A 3HJAA 2EP5A 2HSDA 4N5NA 3WJAA 3GQVA 3ZCXA 1P1FA 5COAA 2FZEA 5IF3A 3ENKA 1GZ3A 2ZTUA 1B0AA 3K2EA 4TZKA 3JQCA 2EIHA 2NQTA 2FN7A 4GX2A 2OGUA 5DNAA 5JDIC 2NVBA 1HDGO 2RIRA 2O2SA 3SX2A 3AFNA 4DVJA 3CTMA 5ENVA 4E32A 1UXHA 4WLFA 1EMDA 4CV0A 2B4RO 2HMUA 1H6DA 2WDZA 1I0ZA 1K89A 1B8VA 4HNHA 1U3VA 5GZ1A 1BGVA 1AXEA 3I52A 5L4NA 1N9GB 3RAJA 3KYCA 4XD2A 3T7EA 4ZICA 4NK5A 5K6AC 3QIVA 3UOGA 3VHRA 2O7QA 1E92A 4BB5A 3ZWBA 3F47A 1AXGA 3JQ9C 3LT4A 3JQAA 1WMAA 4E0BA 2C5EA 4ZHSA 3OQ6A 3FWNA 4BUCA 5L53A 1DAOA 4XYMA 4K9DA 4U6SA 5CAEA 1Q2XA 5ES3A 4E31A 4AJPA 4JIGA 2EGGA 1YDEA 2W2LA 1HF3A 3R3SA 1T4BA 1MFZA 2Y1CA 2X58A 2QIOA 3DBVO 4MP6A 2IDZA 3KTDA 1U3WA 1HE2A 1WWKA 4UREA 3B1JA 5HWSA 5ITVA 5IN5A 3VAZA 5A02A 2GPTA 5BNTA 2O3JA 3GC6A 3BHMA 4GWGA 3VZPA 1X7HA 1XGKA 4ZRMA 4LSWA 2DQ4A 3L0DA 4OXNA 2YV1A 1L7DA 3RC2A 2AXQA 3BTUA 3NJ4A 5JYDA 3PPIA 2O4UX 4E12A 3W1VA 1TLTA 3OF2A 3WB9A 1DJQA 3OP4A 2EHDA 4BNZA 2DFVA 4RF4A 5JCJD 3UHAA 4YJHB 3LC7O 1HEUA 1VKNA 3VZQA 5JAQA 1P44A 4I5EA 4R4JA 3NT5A 3OJOA 3VTFA 4A03A 4E2YA 3PHJA 1ONOA 3DXFA 2YW9A 2BFPA 2VYND 1B26A 3IAHA 4HX5A 4WLEA 2W2KA 3EY4A 3LT1A 3ZWCA 3FR7A 4ZJUA 1NPDA 4YAGA 3FI9A 1BTOA 1LXCA 2A9FA 4R9RA 4Z3DA 3CZRA 2VZ8A 3O4RA 3D3WB 1RYEA 1QYVA 4LRTB 1Q1NA 1ZK4A 1J4AA 3LZ6A 4OOEA 3JQ6A 3F4BA 4EEXA 3H7AA 3OSUA 3S1LA 3RKRA 3F9IA 4P4NA 1E3WA 1NYTA 1Q0QA 1IZ0A 1GZ4A 2B4TO 3DTYA 3T4EA 1XQ1A 4J9UE 1KERA 2DPGA 1WP4A 4ALKA 4D7AA 4BNVA 3L6OO 2JFHA 1H2BA 4ND3A 1VL8A 4NBUA 4CMCA 4DTIA 2HJRA 1E7RA 2VYNA 3PFFA 4XR4A 3I4FA 2VOEA 1ZH8A 2NVUA 3AI2A 4IPTA 4RF5A 1GYRA 3GNQA 1Q7GA 9LDBA 5DZSA 4GMFA 2GZ2A 4PLHA 2PGLA 4OO3A 2VHXA 5KVCA 3DBHA 2Z1NA 1H94A 3IP1A 3QWBA 4II2A 1C0KA 3WGGA 5TJHA 4IDFA 3UCXA 3PTZA 3GDFA 2WE8A 4XZ3A 3H5RA 3IL2A 2GF2A 1DRUA 3TPCA 4MVJA 1IZ9A 4I8XA 1LUAA 1H6CA 2Q4BA 4L9RA 2JHFA 3V8BA 4IDBA 1NFRA 5TLSA 1KEUA 4QEDA 5HM8A 1ZVMA 1E1LA 2OP1A 2D59A 2CY0A 1OC2A 4J2OA 1ULUA 4Z9FA 3IP3A 4XRRA 2W98A 3MJ4A 4Z9XA 3ZNOA 1X7GA 2FWMX 1ZBQA 4AJ4A 4J1QA 2LDXA 1U4OA 1MC5A 1DDOA 4BIIA 1ZCJA 1GY8A 4BGVA 4YAKA 3I83A 3DZGA 4HKTA 3AUUA 2OO5A 1NQTA 1Z7EA 2NTJA 3CINA 1DC5A 4A7PA 4E21A 3UCFA 1WZEA 4B3IA 3JQAD 3WYEA 1NPTO 3D7LA 3H8VA 1KS9A 1YDWA 4GWKA 4YJGA 5IDYA 1TA4A 1S6YA 4OXYA 4CM8B 4K1LA 3BTOA 3FD8A 1U4SA 4U8GA 3L07A 3PHHA 3EVTA 4GX5A 5AQ1A 4AJJA 5C7OO 5A5FA 2NU9A 3ZH2A 2A4KA 1Z7BA 1CYDA 1QV6A 3WLFA 1P31A 1PJQA 2WE7A 3ANMA 1E5QA 3B1FA 3VTZA 3WJ7A 4XEHA 4DPLA 4PCVA 2EGHA 1GL3A 1WPQA 3JD0A 4M1QA 1DRWA 2ZYGA 3GPDG 3QA9A 3RJ9A 1Q7BA 4W6ZA 5LDGA 4Z3KA 4QFCA 1B3RA 4HFNA 1G0NA 4J1TA 4BKUA 1LLDA 4PLGA 2GN8A 4FGWA 4XR9A 2F1KA 2Y1OA 2O3QA 1B16A 1UDCA 4I5DA 3TJRA 3RUDA 1OAAA 3RROA 1QSGA 1GTMA 2VWPA 2OMEA 1ZFNA 3ZU5A 4EYEA 2OBNA 3AOGA 4TWRA 3GVIA 2ZQZA 2X86A 3U0BA 1YB5A 3NYWA 3ZHZA 3C1OA 4UUPA 2YZ7A 4QECA 1HDOA 1HWYA 1D4FA 3K6JA 5CHEA 1P0FA 1SPXA 4I9UA 3L9XA 3C7AA 4NI5A 3RUIA 3CMMA 4TRMA 3OECA 1PGJA 3D64A 2R00A 1EDOA 1GQ2A 1SEPA 1XA0A 4U0JA 4CQMD 3G17A 2C7VA 2PD6A 3JQ8B 5C3MA 1MGOA 2Y67A 3C7CB 3E18A 3EZYA 4F3YA 4FJ2A 1FDVA 3HDHA 4RJTA 3V5NA 1DFIA 2UDPA 2ZK7A 3IOYA 3GA0A 3DZKA 3K73O 1YWGO 1VKOA 2B37A 5CFZA 5LC1A 1EK6A 2NACA 3D4NA 2ZQYA 4NNJA 3RUEA 3MWDB 4W9NA 4A73A 2C2XA 3I6QA 4F45A 3OHSX 1NVMB 1BXGA 1YONA 3A06A 1HETA 3GEDA 4XQCA 3RBVA 2C0CA 3I1JA 1R6DA 4ZQHA 1LSJA 5KJFA 1ADGA 2C7GA 2I99A 3EYWA 4GLLA 5F3RA 4CJXA 5CP8A 5JXWA 4PVDA 2HMTA 1M2WA 7ADHA 2CF6A 1YL7A 4O59O 4F46A 4CMEC 4OHUA 1XG5A 5I9MA 2G5CA 4RLSA 4UEJA 4IBOA 3GN1A 3TN7A 2EXXA 3LF1A 1HL3A 4B4UA 1L7EA 3LQFA 4RPJA 1K3TA 3HADA 2GZ1A 3HQ4O 1TVEA 4LISA 3DO5A 4E2ZA 1QMGA 1Y1PA 3CPSA 4NBRA 1GEGA 1PGPA 5B4UA 4LSMA 4OYRA 3FHLA 1VM6A 4EDFA 4J16A 2B36A 4PG5A 5GZ6A 1UJMA 4B4WA 2YFHA 2ZB7A 3P19A 1EUDA 2YUTA 2Y0CA 5I7VA 5JY6A 1I3MA 3STHA 2VHZA 4BHTA 3JV7A 3ANNA 3BA1A 4RVGA 5JMWA 3MJEA 1KVQA 4R68A 3O26A 2PGDA 1ID1A 3A1NA 4UEOA 1UUFA 4A27A 2O50A 2H6EA 3U4DA 3ZWOA 3H2SA 4XQEA 2BF7A 1PJBA 2XOXA 4GBJA 3UAGA 1I10A 1CEQA 5L7YA 1GUYA 1LNQA 3ICCA 3ROMA 4U7WA 4AJEA 1DIBA 3MTGA 3AK4A 2UV8A 3JQFC 3GAZA 1ZSVA 3AU8A 3JYPA 3Q2IA 5FWNA 4FFRA 4BL5A 2JKVA 4YWJA 4RF3A 1Y81A 2D1YA 1UDBA 1NP3A 4YRDA 4RPHA 2Q99A 1LU9A 2JD0A 5KJEA 1PS8A 4FQ8A 1JW9B 3GMSA 4XIYA 5T57A 4PZCA 4GH5A 5LDHA 1PWZA 2H1SA 3BTSA 3I9NA 3F46A 3NGLA 2P4HX 5L3ZA 3WQRA 4WASA 3NGXA 5IXSA 4KTVE 5L95A 1JAYA 5TJ9A 1T26A 2VRCA 1I5RA 3K5PA 4D43A 3RUHA 3OJFA 2BH9A 2VHYA 3WXBA 4WKGA 4NU6A 4MVJF 1YE3A 4HUJA 3VH4A 1XU7A 3GNSA 1HT0A 1U9JA 1ZW1A 1UZLA 3FSRA 1WXDA 2X23A 1Z45A 3MJCA 4XQ9A 3JYOA 2HRBA 4KUGA 4BO6A 2E6UX 2XXJA 4DIFA 2Y1GA 4R51A 5JFOA 3ASVA 2OUIA 4D79A 3H3FA 4HBGA 5CDYA 3JQGA 4YA6A 1TT7A 3RKUA 3CH6A 1D3AA 4BGUA 5A9TA 1OFGA 2I67A 3F3SA 1I3NA 1CERA 2EG9A 3E8XA 2DBVO 4IGFA 4YAIA 1GCOA 3FN4A 1ISMA 4J91A 2E48A 4NR0A 2OORA 4IQGA 5DN9A 5ILGA 1ISJA 1DIHA 1I2BA 4WLOA 4PLWA 4FC6A 5DF1A 4ZQFA 2GN6A 1A9ZA 4MVJG 3ZGYA 2NVUB 3OA0A 5BT9A 3HFSA 3PJEA 4P8RA 3H3JA 4KZPA 1H0KA 4XDYA 4DLAA 1U28A 4RDHA 5ICMA 4Q9NA 4JBIA 2JFFA 4WECA 3LDHA 4OXKA 4Y8VA 4CQLA 1PQUA 1IB6A 3GG9A 1P9LA 1B15A 1EBUA 1BXZA 5G0TA 4CLXA 1PGQA 1ML3A 1U7TA 3QRWA 4L75A 3HFGA 1A5ZA 1UH5A 5CG2A 1I3KA 1NM5A 4EUHA 4W99A 3JD3A 2VNAA 4DRYA 4ZA2A 3RU9A 2QYSA 1KY4A 2C20A 1PTJA 2WWRA 4ND2A 3GMDA 3GZ4A 2FR1A 3LLSA 5HTOA 1E3EA 2Q4EA 1Z75A 3TSCA 3TF5A 4MINA 2D4AA 4CMHA 1QYDA 3WSWA 3PZRA 1NBOA 4E5KA 2RAFA 1PL8A 3PLRA 2YQ5A 2G17A 3ENNA 1HDXA 4AJIA 1MV8A 5ICSA 5TQVA 5KVVA 2IEBA 2CDCA 4BQPA 4XIJA 1ADFA 4LN1A 4XQGA 1ORRA 4AJLA 1QP8A 5FFFA 1AE1A 1O8CA 5IXYA 5JYEA 4R3NA 3W6UA 3WGYA 3AW9A 4JGBA 3KSDO 2YJZA 1D8AA 4NDNE 4EITA 3ZHBA 1GEEA 1T1SA 3DHNA 3VVBA 4WE3A 4ZQEA 1MXHA 1YB4A 3GPIA 3M2PA 3AOEC 3AY3A 5T8KC 3BMNB 1O89A 4XYEA 3KYBA 4DPKA 3E6AA 2Q2QA 2YYYA 3QHAA 2J8ZA 1VL6A 2CMDA 2WD8A 1XDWA 1HSZA 4CM9D 4YCAA 3RBZA 2HMWA 5HS4A 2YY7A 4H16A 2B35A 5COBA 3IIEA 3HN2A 3F5SA 3N58A 3DFUA 3WGIA 2O2YA 3A4VA 3G1TA 3PJDA 4FOSA 3GHHA 1VSVA 4IMPA 5JAMA 1O9BA 1T2FA 4NJMA 2I6TA 2HUNA 3OIGA 4LRSB 4EBFA 1NHGA 5JC1A 5HRUA 4ZU3A 2Y1DA 1ZK1A 4BNJA 1DOHA 1MX3A 1IL0A 1BXKA 1NQ5A 3W4JA 3IJPA 4INAA 4YR9A 1EVYA 3RFXA 3W8FA 1QORA 4D41A 2AQKA 1V8BA 4Q3CA 5G0WA 1R0KA 3F5QA 3UUWA 1NR1A 4E2WA 2FSSA 2RH8A 1O94A 5C7IO 3UFXA 3JQ8A 4Q39A 3DOCA 4NMHA 3DBRB 3K2BA 3CZMA 4AJOA 1ZNQO 3ZN2A 4HFJA 3E48A 1LI4A 4TROA 4WK6A 5HA5A 1ZXLA 1KETA 3SXPA 3LSYA 2PZJA 1F12A 4OQYA 2X5JO 2W4QA 1T2CA 5IZCC 2BGKA 3GRKA 3GZNA 3MJTA 4QO7A 5B37A 4BKOA 1M66A 4GAEA 4GGOA 5AXBA 2BFMA 3DHEA 1ZMOA 4W9NC 1UAYA 4IMRA 1GUZA 3DOOA 3H5AA 3MJSA 3N74A 4ID9A 4HY3A 3L4BA 1H6AA 5G4KA 1HE3A 2PGJA 5IZ4A 5KVSA 4CMBA 5KTKA 3BMQB 1N7HA 4AJNA 1RM4A 5AXAA 4TSKA 2VT3A 2G0TA 2TMDA 1EQ2A 1B14A 1JKJA 2WM3A 4DWVA 4XGIA 1QLJA 4OSPA 3C7DB 1LQTA 5JDCC 1CQIA 1HXHA 1JLLA 3WQSB 1W0CA 3KYDB 3SJ7A 3GVHA 3HUDA 4JJIA 3AY7A 5H82A 3NUGA 1U1IA 2A35A 2OXIA 4YACA 1I01A 4CMJA 4BS9A 1NAHA 1BMDA 1YRLA 4R1TA 4Q3EA 5DCYA 4DQXA 4U0KA 3EAGA 4TZTA 4DL9A 1YBVA 2UUPA 4BNGA 3Q0EA 1GPDG 4PG8A 4K26A 3DR3A 3NKLA 4LCEA 1BW9A 3JQ9A 3ETDA 1NR7A 3E9QA 3BTVA 3ADPA 3H6KA 1HSOA 1GADO 2YHIB 3S55A 1DB3A 5COQA 4WEOA 4XYBA 3NDRA 1ENOA 2Y68A 1HE5A 2D0IA 4P4LA 3PZBA 5C7LO 4XCVA 5EIOA 3PWKA 1Y6JA 2VYVD 4BO2A 5B12A 4WLVA 3U9LA 2YHUA 4OMUA 4IDGA 2XPCA 1FDUA 1PJSA 3FF4A 2VWQA 3PFWO 4W82A 2DT5A 3HSKA 3CEAA 1VC2A 2E49A 5EL0A 4D3SA 3VOSA 2H5LA 2WD7A 3OBBA 5T5QA 3V2HA 2W90A 1NTOA 1NFFA 3TZ6A 3ONFA 1QYXA 4H7PA 1YH3A 3RQSA 2Y0DA 5L45A 2PD3A 2AA3A 1ISHA 1V3UA 1NASA 4E2XA 4FPXA 2Z1MA 4G2NA 3CXRA 3JSAA 4OQZA 4CM3A 1Y8QB 4J90A 2Q49A 1YJQA 1A27A 1FMCA 5DDIP 1Z82A 1ISIA 2CD9A 2FR0A 4BOYA 4GX1A 2UVDA 1YBMA 3ITKA 1DEHA 2IEDA 4FGSA 1B3BA 3WWYA 3DZJA 4CM6A 5H83A 1IYZA 1LDNA 3P2YA 3TZQA 4MO2A 5JDIA 4ZQBA 3ZWYA 4A2CA 4BMVA 1MP0A 2GR9A 1E3JA 1Z74A 3AM5A 1KIFA 1XU9A 4ZVVA 1R4NA 3SJUA 1LRJA 3TZCA 1FDTA 5IAAA 5B1YA 1PZHA 2GYYA 3LC1O 3VPFA 3GT0A 3U62A 4NQZA 3NEPX 1S7CA 3WTCA 1DXYA 1LC3A 3DTTA 3Q9UA 4J4HA 3LU1A 2Z5LA 4CMEA 3ON5A 2I9PA 4FFMA 1DO8A 3WS7A 4OJNA 4MVJP 2ILTA 3ZNQA 2QQ5A 3G0OA 2B69A 1MC4A 2HKIA 1LDGA 3DMYA 3VVCA 5KJCA 2HO5A 1SEVA 1IHXA 2DBQA 1WLYA 3WSVA 4IJUA 2ZYAA 1C1XB 5L51A 4QT0A 2AQIA 1TEHA 1QR6A 1N1EA 2HDHA 2X7HA 3NTRA 2FZWA 3FCOA 3LF2A 3FWZA 2J5QA 3CUKA 4J43A 2PZLA 1I36A 3RU7A 4WOJA 1BVUA 4FFPA 1EZ4A 1Q0LA 3WG9A 2OBYA 2BFAA 3OQ1A 1LQUA 2ZTVA 4R54A 3L4SO 3ZU2A 4TVOA 4F6CA 3JQEA 1Q0HA 1ZZEA 4DBVO 2GGSA 2DUUA 1KC1A 5JSFA 1BXGB 1KC3A 4QQRA 3DBLA 4PRLA 2EKQA 1SCUA 3C85A 2Y0EA 5L4LA 3VZSA 3NDJA 2VZ9A 4GQAA 1P1RA 4U5QA 3DZIA 1U7HA 4GI2A 1K0UA 1GYPA 1EUZA 1KEWA 4EGFA 3PEFA 3WICA 2X22A 3AWDA 4N7RA 1PJLA 2QRKA 3TDKA 1GAEO 3C24A 3U49A 4D3FA 3PWSA 1G6KA 3TFOA 4K6CA 2GCGA 4OIMA 1VRWA 1V3VA 4O6VA 2UAGA 4CMIB 1PL6A 3E5RA 3GY0A 2AHRA 2HLPA 4AICA 2AW5A 2PD4A 3DDNA 4J0FA 4IDEA 4K28A 2P68A 3AUAA 2CVQA 4EW6A 1YVEI 5K0ZA 1C3VA 1WZIA 4JNKA 5LCXA 1DC4A 2P91A 3KLMX 1LEHA 2POQX 3PYLA 6ADHA 1PGOA 4KUHA 3GLQA 5DP1A 1N7GA 1RYDA 1GFSA 1XR3A 3BMNA 4J4TA 5DBGA 3QP9A 3HWRA 1BDMA 3D4OA 2X6TA 4GSKA 5ADHA 2NLOA 5J23A 1FK8A 4KWIA 5BSHA 2GASA 4UUOA 2ZYDA 4DC1A 3SVTA 1OC4A 4EEZA 1R0LA 1DHTA 1M76A 3H9UA 4CPDA 5AXCA 3W8DA 1DAPA 4R41A 1YQDA 5IZCA 2BI7A 1DLIA 4LW8A 3ZNNA 3NTQA 4BO5A 2NU6A 1RM3A 5EN4A 1W6UA 4DREA 2VWHA 2BGMA 4MOWA 5FI5A 1Y8RB 1CRWG 2V65A 3UVEA 3WR5A 3FBGA 1E1KA 5G0VA 3DC2A 4L76A 1P33A 5A9SB 2VUTA 5EESA 5TS3A 1J0XO 3H9EO 3GRPA 4GSLA 4YAEA 1QXSA 2P5UA 5TF4A 1I2ZA 4GX0A 1LSSA 3I9JA 3WGOA 2YDYA 5THQA 2VOJA 4YEDA 3DAGA 1U5CA 4XGNA 1R16A 4RCVA 3AI3A 1UAGA 4BO3A 3TFQA 1PJ2A 1EFKA 3AJRA 5JCXA 4BKRA 4KQXA 1G0OA 4PFJA 3I9MA 4IQ8A 4EUEA 3U4HA 1EK5A 2QZZA 3MZ0A 4UUMA 4CL8A 4UVHA 3G3EA 4CL3A 4BNLA 1P1KA 4WJZA 2XAAA 4YDRA 4XB1A 5TIIA 2AEFA 3MOGA 3Q1LA 4BNXA 3KYCB 2IRWA 1C1DA 2DLDA 5JO0A 1UP4A 3MWEB 4GL4A 3RD5A 4E5PA 1V35A 3NX4A 3KSZO 4B4VA 4S1VA 2QYTA 4FFOA 1MG5A 2CSUA 2AEJA 2D8AA 3F6YA 4WCFB 3WGTA 1MUUA 4QX6A 3IJRA 3Q9NA 4XJTA 3QSGA 4BNUA 3KXDA 1FXSA 4Q3BA 4R01A 4BB6A 4M54A 5JE8A 4CM4A 5C37A 1SBYA 2NQ8A 4DPMA 3O8QA 5IN4A 2O4CA 1LJ8A 4RORA 2RH4A 4AJ2A 3H2ZA 4DLLA 3GVPA 2PZKA 1W8DA 2AG5A 2C82A 3I4CA 3ZWXA 4EJ0A 1ZXBA 1AHIA 2IXBA 2BFOA 1IY8A 3AM4A 1HLPA 1MXFA 4FIZA 3HN7A 1XCBA 1KBZA 3RSHA 3OJ0A 1LRLA 1LDEA 4Y6RA 4CR6A 4RVSA 5TNXA 1JAXA 1ENZA 1I30A 3ROKA 1HZJA 2YHIA 4CM5A 4ZGWA 3LVFO 4NJOA 4J49A 4P4GA 1JTVA 1HYGA 3PHIA 4AG3A 3TNLA 2Y99A 4HP8A 4CMKA 3OM9A 4IY1A 3A9WA 4UULA 3H65A 1WVGA 2Q46A 4E5YA 2OP0A 1VSUA 3GG2A 3R6DA 5ILOA 1B8UA 1DBVO 8ADHA 1JWBB 2UYYA 4U6QA 2PV7A 4CLDA 3K8ZA 1KVUA 4DA9A 3O9ZA 4JQCA 3R1IA 3RC9A 4PG6A 1PR9A 5TSDA 2NU7A 3C1TA 1GQQA 3MEQA 3DHYA 3FPLA 3ST7A 4I08A 5BNIA 1E3WB 3GF4A 2OL4A 4IXTA 3ZDFA 1JN0A 4YXFA 2IZ1A 5BSFA 3WWZA 2J3IA 2GN9A 2PFGA 1LDYA 1A4IA 1I8TA 3VDRA 4FSHA 3BYZA
chains in the Genus database with same CATH superfamily
1RBYA 3MNFA 1PG2A 3WWPA 1MVNA 3M34A 1VB3A 1KAGA 3RVLA 3GJ8A 3MGKA 2QM0A 1UEJA 1OILA 2ODWA 3IKVA 2X8BA 1DFHA 1WXHA 4BWYA 3AB8A 5U1PA 1NW4A 2W8BA 4Y7CA 3AJEA 3TPZA 2PH5A 2PL9A 1NM5C 4O4JF 5CT9A 4EKNB 3LKBA 3KXPA 1R4MB 2JCYA 4MJLA 1R8SA 5DRTA 3OEYA 4LYDA 4U39A 3RFTA 3JARB 3BE8A 3NRCA 2VUSA 1E9SA 3GRVA 1EFPB 4AZ3B 1Q1QA 5IBCA 2KS6A 4X6YA 5ARBA 1WB4A 1U80A 5P21A 3R7SA 2DY0A 3ILYA 4KPGA 4FINA 3DMTC 4HAOA 4CKCB 4JP8A 3JWIA 4AYXA 4DHEA 1GTZA 1D7AA 1YK1A 4I55F 5JBQA 5CEEA 3PD0A 4XPIA 3A9UA 4YQYA 1BS2A 1PZMA 1P3JA 1QHGA 5AOBA 3P9QA 4EAQA 2DR0A 3F73A 1MJGM 1GGKA 3UJ8A 2OFPA 4MARA 2EX4A 4PRKA 5EMMA 1YMUA 2GWHA 2VP0A 3FDJA 2VN8A 1IQ0A 2AGVA 2D1QA 1U7DA 2EEZA 1DBPA 4JJEA 5M29A 3U3RA 4AJKA 4EHIA 3EB9A 1P4AA 5PNTA 4C9BA 1AJEA 5IJ9A 2ILVA 3MCAA 4FSXA 2XHEA 1XPRA 4JP5A 1MR3F 3AW8A 4UNPA 3UWOA 4B31A 4CF5A 4UUNA 3KUXA 2Z9BA 1BQ4A 1UP6A 2F00A 3CUTA 2OQIA 2X7XA 3E84A 3G6KA 3DZHA 3BZWA 3BJRA 3A6HA 4JT9A 4A0FA 2RHCA 5BSEA 3P4XA 1V6AA 1NZJA 1RWBA 2Y9MB 4MUYA 2DBRA 3JZFA 1VJCA 2QSUA 4JI4B 3AF1A 1JEYB 3UC5A 1N0VC 4NFLA 5E6RB 3TD9A 4OFXA 2C9ZA 1DEXA 3OCJA 4MJ3A 5HKOA 4GM1A 3SHFA 1CUEA 3OETA 2NTVA 2PPVA 4YXWD 1QUEA 1GSAA 4RIGA 2P27A 3JWEA 4NMMA 2FWPA 2P41A 2DKOA 1GIAA 2P90A 4PAOA 4RK5A 3WRXA 2MYNA 4UVIA 3GZNB 4W1RA 1XPOA 2CXXA 1OUMA 5BRNA 1RXIA 1IM8A 1XAHA 2IIBA 4O8ZA 1ZN7A 1K8XB 2EEPA 3ECAA 4X3CA 4XB6B 3BMCB 3O4JA 3TNYA 2PMWB 4C7OB 4CKBA 3DDUA 2Y93A 2YZNA 1USGA 2CMHA 1UBEA 2FDRA 5F1YA 4U2EA 3BL5A 5TDHA 4S1OA 3PUYA 1G7TA 1F2UB 4HN4B 3CLVA 3VSAA 1UC4B 4FDAA 3CNOA 3ICWA 1P45A 1X1EA 2DC1A 2OLKA 1Y37A 4HD8A 4I5GA 4PF1A 3TQHA 4M83A 1C0LA 4KK4A 2IHTA 2NZYA 1RPZA 4IH1A 4MQEB 1L7BA 2O8VA 2WF9A 3I1FA 1YCGA 2V0GA 4UMDA 1CE8B 1KZ6A 1H4VB 2JFBA 2RFLA 3RASA 3ZU4A 5I7FA 1DSSG 2AN4A 2EBUA 3FPCA 1DUSA 4O4LF 2B4QA 2Y27A 4URFA 4MIOA 3AIIA 1DJNA 4IM7A 3UT6A 4DV6B 2CLSA 4I1IA 4IDHA 4F4IA 4I2NA 4ALLA 3ESYA 2NU8A 3ZLJA 3SICE 1QF7A 2X5KO 4HR7A 1FYWA 1OGIA 3RIYA 5IHXA 4CU5A 5C80A 1HV8A 1BC5A 2MR5A 1NW5A 1N5OX 2ZS9A 2PEZA 1GSOA 2IC5A 2XMGA 4PLCA 2YJ6A 5FOWA 2JKYA 5DYNA 5F7OA 3S3TA 1NF9A 4ZXFA 1G41A 3M6IA 1I4DD 3S8YA 2QUHA 2P3SA 2AD5A 4LBVA 4M7WA 4TGLA 5C35A 1RHKA 1QQ6A 2XUFA 5KSPA 3KWMA 2LPMA 3ORFA 4ALIA 3ONDA 3OJCA 3O8LA 4MUXA 2HPZA 3QMWA 3BH0A 4FZ3A 2UZ4A 4UEWA 4B3CA 2H7YA 2OD9A 3C97A 1VJ5A 1I4TD 4PICA 3WK5A 1YOVB 3VU0A 1FXUA 4ZT3A 4XYLA 7GPBA 3P2IA 3IB6A 1HZZA 2WG1A 5ED0A 2D5AA 2G40A 5A62A 4RFSB 4FFSA 1GXSA 5AO9A 3SQWA 1TJYA 4MP8A 1U2DA 3M2TA 4UE6A 3ADBA 3GP8A 2IIPA 4AU1A 2BOVA 2REOA 1H9BA 3KE9A 2VDOB 4M53A 4GGPA 1XRMA 1P2FA 3FDZB 4D9JA 2PO7A 2I2XB 3HL4A 5K0GA 1P1HA 4HVLA 2RGNC 2YN4A 2WMDA 1YHYA 4CF6A 2QTVA 2B2CA 1VLMA 2JNWA 3DKIA 4QYTA 5HQTA 1KTIA 1K7SN 2ZRMA 4AY3A 5AKXA 1CNEA 3EGDA 1WETA 1SKMA 4B7UA 4D8VA 2K6GA 3RUCA 4D57A 3ZLBA 1T2DA 5BOVA 2Y66A 3C8MA 4HCJA 3UXEA 1G7RA 1UZAA 1WXEA 3WGJA 1RXEA 4EMTA 1S0UA 1M6VA 3FHCB 1Z0FA 3RC3A 2B98A 4EA9A 5AW1A 1L5MA 1N1DA 2AMFA 1NIJA 3QV1A 4L9AA 4TRJA 4BNTA 1E1NA 4B44A 4MQMA 3B7PA 4P08A 1VSQA 1XEXA 4R9UC 3G9XA 5J2UB 4ZGGA 1M3SA 2ZCVA 3R7AA 1K0FA 3CIFA 2ADFA 1M1YE 5CG1A 1JHRA 3LRPA 4RK7A 2ZJ8A 4CNQA 1ECGA 1X15A 2BE7A 2K2WA 2QN9A 2X5XA 3FZQA 2VQEB 3R76A 1ZA1A 5CPFA 4JUAA 3H9GA 4LXQA 5E3JA 1WAMA 5E7IA 2E21A 1A96A 1GPUA 3MT9A 4TKVA 5H7XA 1T25A 4YRAA 2IOQA 2ZROA 3FNGA 3QI7A 3PYXA 3W90A 1EA5A 1KQOA 1KMCA 3K5WA 3L1UA 1K6JA 3D9QX 3RAGA 4RD1A 3I05A 3AOEA 1GR0A 4LY6A 3L9WA 5EHZA 3EZXA 3EIFA 2P75A 4M99A 1EQAA 3MYRA 1OJLA 5L3SB 2JJ2A 5DHAA 3QUCA 4BQIA 1HDEA 3TSOA 1XRQA 1U0LA 2FPKA 2Y1LA 1L5LA 1Y1LA 2GK7A 4O02B 4B81A 2V1UA 2X1HA 2AEEA 2ZUEA 1C30A 2ZXUA 4KRGA 2YIJA 3DE7X 1NDQA 2ES4A 4KN5A 2ZZMA 1NMYA 4PYKA 2PANA 2JGLA 1P74A 2FZCA 1YR9A 1ZKMA 2AVNA 2CGEA 3KPVA 3KZ1E 1ETHA 4TYMA 5H0IA 1QG2A 5H02A 4E30A 4RLFA 5C8YB 1KAOA 1N4AA 1X7ZA 2EKPA 2CB9A 3BXGA 4N0DA 3GCDA 5EXXA 4NH4A 1TKCA 1A9PA 1WHTB 1ZNZA 2CLHB 2GFQA 4O4JB 5CDSA 2B30A 4BMCA 4HS9A 2QZPA 4HFMA 4DR1B 2R62A 5DGIA 4Z0NA 5AW4A 5FBHA 4PZYA 5EKTA 1ANKA 3IMCA 4M37A 2A7XA 1A4XA 5CT6A 4YT5A 4HEJA 3SM9A 2DUWA 3CNQS 5IVDA 5AW8A 4DIDA 3IQWA 3V4RA 3NHLA 3GDGA 1E9RA 1H85A 4HLNA 3ZKWA 4RKEA 4C7BA 4F5YA 4L8FA 4X61A 3RG2A 3RCBA 1J0DA 3NHSA 1UQUA 4LOLA 4JVLA 4B7ZA 1PWXA 2BRUA 2Y1KA 2C57A 3VKUA 2QE6A 3AF6A 1EGHA 2CZCA 4Y9RA 3NAQA 1SXJD 3REFA 1LBEA 5A9RA 1J5PA 1ODCA 3IJ5A 3ZNPA 2C9OA 2UZ1A 3SZOA 1M1ZA 3WY9A 1I1OA 2YWJA 5ILQA 1KMIY 4DMMA 3N0RA 1RYNA 2JZNA 4PNZA 2XUPA 4C4RA 4IF6A 4XJSA 1NUQA 3GFPA 4IKEA 4JEMA 1SQ0A 5EMKA 5KNBD 2XDYA 3GLFA 4FFVA 2H0QA 3IP8A 1BQEA 3PQ8A 2ZGVA 3KFVA 3O3CA 2BSQA 1E94E 4TVBA 4V0OA 3D6UA 3SLGA 1DCFA 2OOSA 4FXPA 5AJZA 4DCUA 4EVQA 5BNWA 5KMGB 2J9FA 3GGOA 4FC7A 3ZQUA 4QT4A 1EEXB 2WVGA 5TMBA 1OLSA 2DU8A 5B1SA 2ZJ3A 3EXIA 4X93A 3JRXA 4ENTA 3UB4A 1IE3A 2HADA 2PNJA 3D02A 4EKIA 3KX2A 4IVRA 1YFLA 2KWIA 3GCGA 3EJ6A 4FZJA 5GTDA 1CUBA 1P60A 1J7JA 4DC0A 5ITWA 3EGOA 2AR7A 3T8YA 3U7FB 3GQBA 4R1SA 3QTLA 4O3FA 3O74A 2HA2A 1TC2A 1XP8A 1CJVC 1Y1SA 3A0UA 3NIWA 4WNYA 1FLAA 4BN4A 1X2BA 2WABA 5HZMA 1L1FA 2PWZA 1TYAE 4UCWA 4QL3A 4B6FA 3GT7A 1BOOA 5H81A 3QJ5A 3NIDB 5BMVA 3LT2A 2QHXA 1T6YA 5CIQA 2R5WA 4TT3D 5J43A 1FP6A 4PYIA 1PVOA 2MYUA 2JHCA 4P6VF 2HR1A 2OKCA 5EMHA 1E0DA 1E2NA 4H1UA 3RE1A 4EHNA 3EDOA 5GMOA 4TKUA 3RBAA 1WCV1 3NNNA 2HSEA 4F2WA 2F1JA 2H5EA 3DL7A 4I9FA 2QRUA 3C3BA 1JBEA 2WJGA 3KJQA 1Z4OA 2H2HA 3WGVA 2ORIA 1D6MA 3CR8A 3J7TA 5JLJA 3AFMA 2Y1WA 1HOXA 1Z5VA 3JVEA 1NG9A 5DRYA 4J9VA 2I78A 3B70A 1JNYA 3HPQA 3VYTB 1YFZA 1FFWA 4M60A 1EVJA 5F5LA 2PWAA 3RV3A 4HMQA 4BVHA 2ECPA 1QQBA 1X70A 4ZYUA 2TS1A 4MUIA 5B4VA 3AFIA 2DWUA 1QP4A 4IH4A 4H1HA 3K92A 4QRIA 1SIUA 4V02A 4DBLC 3CLTD 3RS4A 2XUHA 5GVSA 2UUAB 4HGRA 3KZMA 5KSOA 1QWSA 3L6CA 3NIFB 2G67A 3QG1A 4EMBA 8MHTA 1VJ0A 4QBTA 2AQHA 1BCRA 4G0PA 5FI1B 5K0NA 3CNBA 1LDBA 3N2GA 4BATA 2FG6C 3BDIA 3JRWA 1Y6ZA 2C84A 2ZTMA 1CUYA 1J70A 1XVLA 3DFMA 1KO8A 4PZEA 5DP2A 5EGNA 5BPHA 1SCNE 3GGPA 4A26A 4ZRNA 4X71A 1GG8A 1WXFA 3LHFA 2IP2A 1RRKA 1EDZA 4MYUA 4FSDA 3VPHA 2QNIA 2Q1XA 3ULKA 2GN2A 2C98A 3H5OA 3U2QA 3VOAA 1LLCA 2UVPB 4G1UC 1QYIA 5F1KA 1NVAA 5DM60 2CN1A 4ISCA 4JX8A 4CKBB 1UDWA 4CI0B 1GYQA 1MJFA 1I2DA 4B6QA 1E3SA 3HY3A 4TTSA 1F51E 1E2LA 4IJMA 1N2CA 2JAWA 3ICQB 4YAWA 3TW8B 2C3PA 4V3BA 1URPA 1QH8A 4JITA 1RRGA 3BRCA 4U9IS 3TRHA 1FVFA 1D6NA 1W94A 2C4UA 2DMRA 1RWVA 1WMSA 1YZKA 1XD2A 2DTDA 2PSEA 4KO4S 5CCXA 3UK0A 4LOKA 3G9QA 4XA8A 1GQFA 1H5UA 1DKPA 4NJMB 1VMEA 3J81A 2BHLA 3BCHA 3LX8A 1TO6A 1VKRA 1T1RA 2FKAA 4QUDA 1Q14A 2A0FA 1V7ZA 4OHMA 5A03A 5JC8A 2NUBA 1W36C 1CUXA 1BA2A 4EPRA 5JH7B 5T64A 1RYFA 3WLEA 3U09A 3NAMA 3BFJA 3PP8A 5JQWA 1B1CA 3TLYA 1B7GO 2NWQA 3FRHA 4NENA 2Q1TA 3PQ6A 2B25A 16PKA 3LVRE 4JN6B 1YS7A 4MZDA 3TIGA 1SZCA 4Y1RB 4O63O 1R9JA 4MGHA 3CHYA 4LKOA 1RTTA 3M5WA 1ODKA 4GDMA 1JHMA 3TVTA 3AVTA 3ZTTA 1E4OA 4ER7A 3V42A 4F6LA 1WBJB 4L3VA 2PQ2A 3R5KA 1UDXA 1U8FO 1MAVA 1FMTA 3IO3A 1XXHB 2AZDA 2CNWA 3OFND 4L2IA 3VC3A 5BV0A 1FXWF 3NTUA 3MBIA 2O52A 3IQDB 1P7ZA 4OHCA 1Z4NA 4Y9DA 4F04A 3D59A 2J9GA 3GOHA 4AUEA 5KYWB 1VCNA 2SCUA 4WACA 1VIYA 2IZ5A 4F86A 1YOVA 4J3FA 1RU3A 1OIVA 2QDXA 4HDKA 2NV0A 1ZK0A 2B0JA 3C3CA 1HQKA 5HS6A 1XLWA 4BO1A 2N0SA 1PZXA 3K5HA 3PFHA 1R74A 5C46F 4G63A 4Y2HA 1LWNA 4RE5A 4DKJA 2PZEA 1IPEA 1ISFA 2ZT7A 4I50B 1VA4A 4GEKA 5DSXA 1ZJZA 2PA3A 2H0RA 2GD1O 1PBNA 3BWCA 1ISSA 1Y1TA 3G23A 4YFYA 3W5DA 2ZBVA 3VR2D 5BQOA 1VG0B 4BKPA 4ETIA 3DZBA 3KEOA 1EVIA 3QX3A 1SD5A 1EFRA 1DAMA 5MGNA 3MIIA 4H3VA 1YS4A 4BXOB 4HB4A 4HYEA 1WW3A 4HWOA 2G4CA 3FGOA 4WZBE 1E6MA 3W6OA 1X87A 3NC4A 4G1VA 5CFQA 4BQFA 4XVCA 1NW7A 4RYLA 2CE2X 3IMKA 2YJ5A 2V96A 4ZVQA 3ZV4A 5HR5A 2ZR7A 3GGGA 4CV3A 2DEUA 1YI8A 1BJRE 1FSZA 3A31A 3L6UA 2MCFA 4J4BA 5AICA 4WXRA 5KYVA 5C7YA 3GAFA 2IXGA 3W8EA 3QW4B 3TRIA 4J75A 3G2PA 2WP8J 3AFGA 3JQGB 4FBMA 4FWIB 1QB8A 4JB2A 2OG2A 4G01B 5KYGA 4G0UA 3OX4A 3EQ7A 3MSCA 1RCFA 1Z7WA 2VNHA 2EZ4A 3KR1A 4XSGA 1QIGA 1QRSA 3AESB 3IMFA 5AVQA 1MOZA 3ZHXA 3IE1A 2Q5CA 1XK7A 1P5RA 1ADCA 2X13A 4NDZA 1BHJA 2AUNA 3TLMA 3OU6A 5BWOA 3DNFA 2FSUA 1EFLA 4JB8A 4RX1A 1ULZA 2OCIA 4TVSA 2J5XA 2ZSUA 3O2JA 2ZRGA 5CTAA 4E94A 2J6CA 2R00C 4WKOA 4JC0A 3LO5A 4UE2A 5CYGA 1IVYA 5JASA 1XDGA 5HKKA 5KNCA 2JH8A 4IXWA 2VJYA 1QZZA 4RY2A 1MHTA 3MTIA 1RIIA 4RZIA 4KL8S 3QA3E 1T9ZA 1RLTA 4BEVA 2HSGA 5DGHA 3PGXA 5F5NA 1FNBA 1QBKC 3BXHA 3GLHE 5AI6A 5ALJA 4ADSG 4GM4A 1ULSA 1C14A 3IMEA 2E5LB 4AKIA 1D1TA 2DSNA 1K8ZB 2R44A 1ZD1A 1QYCA 3B51X 3OPYI 4HLUA 3DVSX 2B4KA 3PDUA 2JVIA 2QXUA 4ENRA 3O38A 4NC9A 2C5FA 4N6OA 3R7WB 3VNRA 3BMXA 1PL7A 2F6RA 5HF9A 3FYUB 1RM0A 4KI7A 1I32A 5MDHA 1UDAA 2ZKLA 3OWXA 2JAPA 1JKFA 1Y9EA 4FQ7A 1YQ9A 5SYMA 1ZM4A 3L0SA 2X0RA 1M0TA 3ZGNA 2LKCA 2AZMA 4FJ0A 3OZCA 3TQIA 4INJA 4L4UA 2NUTB 2P8SA 3S2FA 4DQVA 2WG0A 2IBMA 3PPVA 4H7EA 4B4DA 2WA1A 4QAQA 1IN7A 1TTHA 3ZGVA 4JA2A 1ZUHA 1FUYB 3WK9A 5F98A 2NO1A 1H2HA 3HNRA 4MPJA 4WXPA 1O5TA 4RDIA 2GK4A 3MA0A 3N5KA 3LDGA 1GCIA 4KYUA 4CETA 1WA5A 3R3XA 1VCMA 5JI2E 3E5MA 3B5EA 4KVFA 1Q1AA 1Q77A 3TOXA 2JF0A 2R5FA 5ERYA 4NMWA 5HX7A 2O3UA 3GLFB 3OC0A 1B41A 1JPUA 4CT0A 1PT7A 3C3MA 4D99A 1YE8A 4RTKA 3VH2A 4LRXA 5G2OA 3FOZA 4LMAA 4MQ5A 4AN1A 5H1YA 3FGNA 4V2IA 1MTOA 3PUJA 5AW9A 3X2EA 1O54A 1PRYA 3A70A 1JKIA 3PHBE 4LX0A 5JFGA 2J0UB 4DAEA 2XSZA 4QD3A 1SVKA 2VS1A 5KX5A 3DYBA 1OTYA 1YL6A 1PR5A 3L8FA 4D3DA 3ND8A 4PZDA 1KFKB 4GNRA 4L74A 4LGCA 3PNKA 2XUQA 4QBGB 4U2DA 3Q5DA 3WNZA 4EY7A 4BQQA 1HE4A 1C9EA 3QUBA 5EWLB 3ZWDA 1M2GA 3RODA 5DB4A 4LS3A 5I8WA 3CRRA 4GQBA 1ZL2A 4BGIA 1HR0B 4BP1A 3PXCX 1C9YA 1Y3HA 1K8RA 3VDMA 2DT8A 5HM6A 1Z4KA 1RXCA 5H4HA 1LNSA 3EPLA 5BRAA 2JD2A 4ICIA 4L0QA 1L5SA 1TUGA 5IFLA 3ZV6A 2P2SA 4OV6B 4BFZA 9ABPA 4ZQCB 3IVGA 3W2EA 3TTXA 1AGNA 2HN9A 2NO5A 1B93A 4GMKA 4OHZA 5D84A 5AUNB 1P2GA 1T2AA 4C0QC 1VL0A 4P3KA 3TG8A 4QM7A 2VQ6A 3FNBA 3RC1A 5CYPA 2AUMA 3R6GA 4WZAE 1L6RA 4MVWA 5JRJA 4MR8B 4WOKA 1LW7A 4JLAA 4M8SA 4YJFA 3GPBA 1I7DA 4RZSA 5GINE 1V25A 2Z6VA 2XB4A 4Q4DA 4YJDA 4RH1A 5IAGA 4QOIA 5IKPA 4FNOA 3GEEA 4QYXA 1PQWA 4NBVA 1DEAA 1X1AA 3VDXA 4E33A 3T5AA 2WJ3A 1AHHA 1SHJA 2BR4A 2C99A 3BC1A 3NVMB 2TMYA 5ALEA 4EZBA 1D03A 3HBFA 1SQGA 3QYAA 3UTCA 4R8LA 2O8FB 2DFDA 4GLOA 1FY2A 1FDOA 5KJ1A 5I7EA 1YDFA 3MRVA 5HKKD 4M9RA 4MS3B 4OGKA 4FM9A 1FDWA 3ZIAA 1GLVA 3GP3A 3OM1A 3L7OA 4TS1A 2OM2A 3W4KA 1Y6GA 2XDQB 4JSYA 4DIMA 4HEA6 1N5KA 3H5LA 2OZPA 5CURA 4ZYWA 1TRHA 3B38A 1JTFA 2XWPA 1N9GA 4M1SA 1QS0A 4TTRA 5EZ5A 1BN6A 1T3GA 4DQUA 1GFIA 1PS9A 2HPHA 2ID9A 2O2XA 4WY8A 1XYGA 1OXTA 2XMQA 3TQQA 4D4GA 4EVIA 4N7BA 1KYVA 4FYJA 2XDWA 3DBOB 1RLOA 4HLDA 1QKKA 2QENA 5LBUA 4D6PA 3ZWCA 3F8WA 4KXNA 2BD0A 4R8VA 4R0MA 5JCZA 2JJQA 4EO7A 3NATA 2GBGA 4DNOA 5J1TB 1I2MA 1W52X 3K0FB 2BHNA 4YAUA 5FLEX 3Q3EA 3STWA 3FMGA 3LQKA 4CN8A 3NHPA 1QVWA 1TGYA 3H2JA 4NZYA 4ZGBA 1X77A 3IH5A 2Z6UA 3PLNA 2AFIE 3M82A 2NO0A 3HM2A 2UUOA 4UZEA 3P2JA 4FB5A 2FKNA 5BY2A 3Q41A 4IVNA 3WV5A 2PJUA 5EUCA 1O5IA 3AVUA 1RQNA 4IOMA 5A05A 2QL6A 1G8GA 4N3BA 5EXPA 5TX7A 4ZDJA 4RHTA 5ESXA 3U17A 1YJBA 2P3LA 4NIMA 1P0PA 4OAOA 4RK6A 1PR3A 1JIQA 2XD4A 1NUAA 3VM6A 3WTBA 1CY7A 1KSHA 3FB1A 1QRAA 3OZDA 5LXTA 3U44B 2RGNA 1CRZA 1GPKA 3A9VA 5JNWA 3JWHA 4R1UA 4YV7A 3DEYX 3EWIA 3HHPA 4CWAA 1KOLA 2OG1A 1EESA 1ENPA 2GNOA 2JIZD 3A1DA 3KAJA 2RD2A 2JGDB 2R7AA 2TMGA 2IZ6A 3D31A 4Q3DA 4R0VA 4WW0A 4YP1A 5ITZA 5GP1A 1V16A 2I54A 4DRXB 1GGFA 3ZDEA 1ELOA 1NXQA 2AI2A 3GN2A 2KPOA 1N3BA 2X8LA 2JRCA 2QJTA 3KEGA 4G4IA 2WM8A 4RQUA 3HDGA 1VI6A 1R7RA 1JECA 3R40A 4FCCA 4YUYA 4Y2YA 2F1HA 4JJKA 1T36B 4B2IA 2RONA 4H7HA 1OROA 1PSWA 1SHUX 1VPDA 2ZB2A 1DFGA 2ZZKA 5FNZA 2IXAA 2CFCA 2FN3A 3WMFA 5JHGB 3KR0A 1G98A 4Q3KA 1XXHA 3HCPA 5B57C 4RGVA 2X7JA 3BIJA 4J1NA 3W0LB 2J3EA 4JZYA 1DKOA 1QCDA 3R24A 5HUQA 4C87A 4BY9E 1JI0A 1B6SA 2BYTA 1Z0DA 2CE7A 2HL6A 1T5IA 2Y1FA 1RKXA 3TJMA 4MW2A 2MIIA 4HGOA 4YPFA 3HYTA 4CQNA 4MYDA 4AMZA 1SKYE 1XD8A 3MWEA 2FG7C 4NARA 5G0SA 5BOSA 1KK2A 1Z83A 2H11A 2J3DA 4TMFA 1XXLA 1CWUA 1UJNA 3N70A 4H1WA 2I66A 1NG1A 2XQIA 3BQ9A 5B4TA 3KCQA 2WJPA 2WHYA 4OA5A 3D0OA 3C48A 3GFQA 3VVLA 3QVGA 2DHQA 2PKQO 3LMKA 1TZMA 2V6BA 3IVAA 1TYZA 1VA5A 4BKQA 2QGFA 1UBSB 2VSOA 2DKFA 1QJ4A 2VXBA 3W34A 3VJKA 2O8BA 1JVSA 2JATA 2PV0A 2HQOA 2EV9A 5CW2A 2J3KA 1US8B 4A0HA 5IEJA 4UHFA 4O1MA 1W1IA 3DAYA 3ZWVA 1B4DA 1U0HC 4FN4A 3U9TA 2G3YA 3RU3A 5B7QA 2UYCA 3GOQA 3E7PA 3SR0A 3HWSA 9GPBA 1EFHA 3OJEA 3FGPA 4JC4A 3CQ9A 3ZWMA 4CLRB 2CT8A 5CLHA 4N47A 1MQSA 1A8PA 3CC8A 3DUFA 4TXNA 5K0EA 4OA8A 4QUJA 2AYYA 2QT1A 1ILWA 1KQGA 3SQXA 4GBMA 1Y5IA 2R1TB 2BEUA 1X38A 3GD5A 1JF8A 3EXHA 4RV9A 2AEMA 5TV2A 4GPD1 5LIRA 3GRYA 2HJHA 2GFHA 1LK7A 3TOZA 3EC7A 4JUCA 4BO0A 5I48A 3GEMA 3RS2A 3R8FA 5FEUA 1ZUD1 5FB3A 1QK5A 3H5TA 2CNNA 4B6SA 1PD1A 1W25A 2K4MA 1HX7A 4GOMD 1VJTA 1P81A 5REQA 3FWHA 2Q50A 2FYTA 4HN2A 4BP9A 2PWYA 3NHMA 4P5DA 4GO1A 5CJJA 3RUAA 3HSSA 1P1IA 2IDKA 1YS1X 3RT1A 2B78A 2NUAB 3FSGD 5M34A 2C29D 3AZOA 2B99A 1M1NB 3HUUA 1EVKA 1MC8A 1N7IA 3EMDA 3EVBA 4IWNA 3C87A 3NBQA 4XVRA 4BFTA 2GM5A 2GCOB 3EE6A 4IZIA 4YUZA 1PR4A 1X1CA 2ZUUA 1NL3A 2JD1A 4RPLA 4IIJF 3NYRA 3WRYA 5IYZB 4HWSA 1C1YA 1M75A 4NOJA 1G16A 3JD2A 3QNWA 4URUR 3DVRX 4IQ0A 4MV7A 1X1SA 2GLXA 3AEYA 1W73A 3H0KA 2FRDC 4K9SA 2IYWA 3HDVA 2P11A 2W6OA 2QY9A 4LJ5A 5SICE 3PWZA 5E1OA 1GRNA 1GKKA 5IUKC 1LFDB 3BWEA 3KVNA 2Y71A 1Y3BE 2W6QA 4HG2A 2KE5A 1CQXA 4IEIA 2GDZA 5AH0A 5I7SA 1QO0A 2ORWA 1FFXB 1YMVA 4H15A 3IDSA 3FYCA 2B7CA 2FI1A 4CV2A 1PJ4A 3UCEA 2JI8A 6GPBA 4IGEA 1PUJA 4HV4A 2R7MA 3ZS8A 1PSDA 3GDWA 4J0JA 1UWVA 2ZJ2A 1KBQA 2W8BB 5FYDA 4B71A 1N92A 2B8EA 1DTEA 2Q3FA 1X42A 2WTNA 5IJZA 1GD1O 5FUBA 2FMUA 1U1DA 3OZIA 5D3MA 4CDGA 1NKTA 3QX7A 5HIMA 4ZPXA 4HDQB 2EGUA 2WQZA 2Q2OA 4W6QA 4GOLD 1BFKA 5SY6A 4YPOA 4ZVPA 2XRFA 4QGHA 3OURA 5CH3A 2HEIA 1KJIA 2FH5B 4UHHA 5C53B 2IP1A 3E8MA 3PXGA 5IC6A 2PRZA 5E2IA 4JROA 3TDMA 1FZTA 3GUCA 3LNCA 3I1IA 5ALDA 2ASVA 4ZMSA 3SBOA 1Q17A 1MBZA 3UV3A 3ORQA 3ZHUA 3BFVA 5JZOA 4HHEA 1U99A 4R2WA 2GHRA 1J42A 3LM8A 1W85A 1L5VA 2A5LA 2I3AA 1E8NA 1F2DA 3S2IA 1H5QA 1XQYA 2B6HA 3CZ5A 4PLFA 4QTZA 5HBRA 4X41A 5KNDH 4JUBA 2AFIA 3HDYA 4D9HA 4OHXA 1ESDA 4OMCA 4W7IA 4CIDA 2VUUA 1TDJA 1Q12A 4CG2A 1R50A 5BRJA 3B1XA 4NYMQ 4CF7A 2Q07A 4GG1A 3QY9A 4C21A 1DKUA 2R87A 3EZLA 1J20A 2H85A 2LUOA 1YE5A 1Z0UA 3NC1C 4GLJA 5EWLA 1BE8A 1NLFA 3E9RA 4KDFA 5ALPA 3REGA 5EZSA 3WIOA 4C7JA 2Q1WA 1YQUA 1JSCA 2IX9A 2V54A 3UW3A 3WYFA 5AM2A 3UFBA 5L7TA 2AFHB 3MS7A 5JCOA 1FTWA 5AI4A 1YGYA 2R60A 5J4YA 5LQRA 1W34A 3UPUA 4ARCA 1GKLA 4KDRA 4L9SA 3RVPA 2O5RA 4EY3A 1KWGA 3TIFA 3VR1A 1XSEA 1ZH4A 4LJRA 2XR1A 2VNIA 3QVXA 1W47A 3LC0A 2GZ3A 1N6IA 1NWHA 2JAQA 1RFLA 3FLEA 3UYLA 1FSPA 5E7MA 2BM1A 5J58A 1JKMA 3QG5A 1XAIA 3M6FA 4FE3A 4YVFA 3PJGA 2CLDX 4AIIA 3ZY6A 1AQNA 1RC8A 1ARZA 4REQA 4PGFA 3KOYA 1THGA 4BNKA 4MR8A 2IS4A 3ZLUA 3PNVA 1GNVA 5GJBA 1KH2A 3EEIA 3T95A 4R8MA 1SKBA 2VTDA 2H9YA 3L4KA 3AUXA 5FIUA 4UAVA 1IHOA 2HSDA 4N5NA 3GQVA 3DL0A 2SNIE 4LXYA 4XLTA 2FXIA 5K8TA 2I4NA 1GZ3A 1JHPA 1B0AA 3K2EA 5K7SA 3EGXB 3JQCA 2NQTA 4JOCA 4GX2A 4C4ZA 4J3NA 1REQA 1HDGO 4LY9A 4REOA 5EE5B 1M83A 2O8FA 1Z17A 2AOUA 4DVJA 4BAGA 1UZUA 1UXHA 1JHAA 4R8SA 2WFAA 4TOIA 3STUA 3CO5A 4G0OA 1H6DA 2Z4TA 1RQRA 4I4NA 4XCXA 5BO5A 5ADVA 4MUGA 1Z4PX 1BGVA 3KDAA 4LE2A 1MPXA 4V1CB 4J0GA 5L4NA 4K9PA 1N9GB 1X80B 3VR4D 4ZICA 3GP5A 4NLLA 1JHXA 1GFWA 3ESAA 4BB5A 5ALIA 3ZWBA 4CKZA 4M8LA 2C88A 3HACA 1UMDB 2ZUSA 2A5GA 3DBIA 3QKRA 4DLWA 1NVXQ 1R6XA 2JFQA 2QLMA 4J16C 4IZ6A 3W9UA 4U1RA 4E0BA 5LUAA 1TFRA 2C5EA 5L53A 2J0SA 1XZMA 4K9DA 1KKMA 3FOEC 1IN5A 3SJBA 2IF2A 5CAEA 3THXA 2XVXA 2EGGA 2CMFA 2X6RA 1AQ6A 2FRVA 3JR7A 5EJFA 2XNHA 1MFZA 2Y1CA 5HIIA 1BHQ1 2X58A 3PGLA 3W78A 3K70C 2IDZA 3GLHB 1U3WA 2QPLA 3KTDA 7REQA 4DV5B 1GZSA 1A2OA 2H07A 2Q41A 3I8XA 4HAVA 1O9GA 4D8YA 3ABOB 3USZA 1RKBA 3KVVA 1TVMA 2F43B 4R98A 1N75A 1O57A 4YUVA 3UJDA 4LNAA 4ETMA 2XA2A 3E22A 3QE9Y 2HW8A 3JVDA 1T8SA 2BM9A 3EZNA 3FA2A 1IMOA 9ATCA 2PSDA 4MUNA 4OH7A 4JQOA 4OQPA 4D1YA 5CA1A 3CW2A 2BISA 2DQ4A 2PLRA 2PRYA 3OZBA 3WLQA 4E03A 1L7DA 2WIDA 2AXQA 1VKHA 3PPIA 2R7KA 3TB6A 4E12A 1U81A 1TYDE 2VXCA 4DBLE 4ZZIA 2Q8PA 3AR3A 1UBTS 1Z26A 1DJQA 2ECQA 2WNIA 3FDZA 4LZOA 4U00A 4AX8A 2VDWB 3DC7A 4Q05A 4B09A 4BNZA 4MITA 5FL3A 4EF6A 4PHGA 3UATA 5JCJD 2W2XA 1AUXA 1ZGJA 4I4IA 3RSQA 2XEDA 2OCBA 3O3NB 3CS3A 2ERCA 2G7ZA 1EK2A 1RPTA 2PRSA 3G2QA 4FMCF 5JAQA 2ZYTX 2EBFX 5CMLA 3VZQA 4A6EA 1I94B 1ZOLA 5IS2A 1IM2A 1W1WA 3AF2A 2RH5A 1M2HA 4EI9A 5D5PA 4E2YA 4KQFA 5JJCA 4MRNA 4HX9A 1FFBA 4RY8A 1B26A 4HGZA 4HX5A 4ND7A 3B2NA 3ZXYA 2W2KA 2Y0PA 2QAGA 1UQRA 1K4YA 3GU3A 4Y2PA 4RXMA 2J48A 1TQ2A 4JJ4A 1OWNA 3FI9A 3MCWA 4RKYA 3S7ZA 4YAGA 1LXCA 4Z3DA 4D96A 3CZRA 3DVQX 1GXSB 3I32A 2VZ8A 3O4RA 5E1BA 4QWMA 4H6XA 2AIRA 5J2UA 1E4EB 2H1CA 3MOSA 4KIFA 2E55A 2FJUA 5LZ8A 3C5CA 3JQ6A 1KZ1A 3EVAA 1YC5A 5GOZA 3SNHA 3S1LA 3RKRA 2UYQA 1OH7A 2NT3A 4P4NA 3HH8A 1NYTA 1ICEA 2V7WA 1YZTA 1ECLA 1C2TA 1VGVA 2YV5A 2FN8A 3WDKA 3KVYA 2RHWA 1Y89A 3T4EA 3AVOA 3IIMA 3HYSA 2P0YA 4J9UE 5F4BA 1CYEA 4CN9A 1FZQA 3HYLA 4TKVB 3QVGB 1GNRA 3DLCA 2JFHA 2RAPA 3WNDA 5F7JA 1RCTE 3NFRA 4NBUA 5JDIA 2VYNA 3VTKA 2BFDB 4ZPJA 5ENZA 3RS5A 3AI2A 4RF5A 1XVIA 3ZDDA 1RLUA 1GYRA 1QIHA 9LDBA 5JEEA 1F6BA 4KBYA 1QX3A 4RHYA 1EFRD 1NSTA 1E1QA 1Y63A 4PLHA 2DLCX 3PEWA 1U2GC 4C76A 4HQFA 2Q5JA 4DHWA 4WESA 4KI0A 5ARDA 2Z1NA 4JHXA 3IP1A 3WGGA 1C0KA 2VJCA 2HGZA 4IDFA 3CJRA 3PTZA 5TJHA 3H2IA 4TLMB 3CLTC 4EW3A 2R751 1NNI1 1GTL1 4GZ3A 1XD9A 3IL2A 1QLWA 1DRUA 2X1LA 4B32A 3FKSA 4YRRA 1TFUA 1IZ9A 1OI2A 1YUMA 4I8XA 4QWWA 4FLMA 4GSYA 4M0PA 1H6CA 2Q4BA 3DWGA 4NZZA 4L9RA 3R09A 4P53A 4YP0A 3OAAD 3HCNA 1L5NA 1IZ8A 5K0FA 3PL1A 5SZJA 1M34A 4I36A 4UTZA 3WBJA 3KR9A 5LZ9A 5TLSA 2I6GA 2XNJA 4QEDA 1XZFA 1YZGA 3SF8B 1P4HA 3D7SA 3BE6A 2PU7A 1J0CA 1GT91 1KFEB 4Z4HA 2IXEA 2XVZA 4XRRA 1FW8A 4ZKDA 1YFJA 1X7GA 3D8UA 2FWMX 3R9IA 2HHCA 2PUVA 4PW0A 4C0LA 1XCPA 1MC5A 1QOZA 1V11B 4HH4A 4O29A 4AAYA 3NH6A 1C30B 4HKTA 3AUUA 3UAXA 1SXJA 2JDIA 2WJIA 2VBIA 3UQYS 1GA1A 4L4YA 1JR2A 5GADl 4M0MA 3T3GA 1WZEA 5TQ0B 2CXHA 3DOIA 4X62B 3H8VA 1QB7A 1KS9A 4EB6B 1MEOA 5CCDA 4JJZA 2RB5A 3DMHA 4QOHA 1Z5PA 3KFLA 3NPMA 2WJYA 4RMNA 4UVDA 5IBQA 4KPYA 1RWNA 3HRKA 3SOPA 2MSCB 3HVUA 4C01A 2W6ID 3PHHA 5H3LA 5DO9A 1CQPA 3BXFA 4AJJA 1MOPA 5AQ1A 2JLUA 5A5FA 1RI4A 2A0WA 2EG5A 2H17A 2A4KA 2PVSA 1L7MA 3MM4A 4L7QA 1QV6A 1C4OA 2PRKA 5FFMA 1SCBA 3B1FA 2WE7A 3U4QB 2PMEA 1U3FA 2QVBA 1ZH0A 3QZUA 2BKVA 1ACJA 1WDTA 2SHKA 1LCIA 4H3KB 1FUIA 3T15A 1JLSA 3MLEA 2EGHA 3LFUA 4PFQA 3PFCA 5JNUA 2ZYGA 3FFWA 3GPDG 3COZA 5LDGA 3QX9A 3C41J 3E9CA 1G0NA 4I3FA 4BKUA 1LLDA 4QZVA 5A0TA 4Q9HA 1PWYE 3QEMB 3UKDA 1PP4A 3L8MA 1JDSA 2JCBA 2EYQA 2Y1OA 4FGWA 5HFJA 4I5DA 5FCDA 2RKWA 1K92A 3RUDA 3RROA 2VWPA 3D5EA 1VJRA 3E9DA 1UFRA 3AJ8A 3PX7A 4NXMB 1TJNA 3AOGA 1VP9A 4MV4A 4LZNA 2GYWA 4TMWA 4P98A 4PGHA 1XRPA 3AHEA 3ZHZA 3N6XA 2VNKA 4AXBA 1JG7A 4UUPA 2H00A 4Z7NB 2YZ7A 4QECA 3C8DA 2BBWA 4EQ6B 2YN0A 2IBSA 4YRSA 3GL9A 1P0FA 2FP4B 1SPXA 2L2QA 2JFUA 3P0IA 2ACEA 4HQKA 4IFTA 1RRVA 4MQUA 3TD6A 4G0QA 5LPNA 1PGJA 2AKEA 3KXLA 4MMZB 3FMFA 4UOEA 3SXUB 4BJ5A 4LZWA 3GQBB 5CFPA 1H2ZA 1DBIA 4IEEA 4BP3A 4BB9A 3GJSA 1YASA 3JQ8B 2BGWA 4IJQA 2VCEA 5B2EA 1GPAA 1LBIA 3HDHA 3ODGA 4RJTA 1U7UA 3UMVA 4LDRA 2NXJA 2E3JA 1K68A 2IPLA 2ZK7A 3IA2A 1XDDA 2CXPA 2P65A 3A37A 1E1YA 3GA0A 3IOYA 4K0RA 4F5EA 3I28A 3GJ5A 1T5TA 4FR2A 2B37A 2OAGA 4W5TA 4ABTA 1Y34E 2FW0A 2ZQYA 4NNJA 3WLSA 4Q7QA 3MWDB 4DA0A 3LCVB 2OLEA 3T1TA 4PS1A 4X84A 2VZEA 3Q3HA 1MNQA 1QFJA 2C2XA 5AESA 2V8BA 1N25A 3BSYA 5LVAA 2QR2A 2R8PA 3QE2A 3PUXA 5KYYA