5HSGA

Crystal structure of an abc transporter solute binding protein from klebsiella pneumoniae (kpn_01730, target efi-511059), apo open structure
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
285
structure length
284
Chain Sequence
GPTYALVQINQQALFFNLMNKGAQDAAKASGKDLVIFNSNDNPVAQNDAIENYIQQGVKGILVAAIDVNGIMPAVKEAAAANIPVIAIDAVLPAGPQAAQVGVDNIEGGRIIGQYFVDYVQKEMGGQARLGIVGALNSAIQNQRQKGFEETLKSNPKITIAVVDGQNVQDKAMTAAENLITGNPDLTAIYATGEPALLGAIAAVENQGRQKDIKVFGWDLTAKAISGIDGGYVTAVLQQDPEKMGAEALNALNSITSGKTVPKTILVPATVVTKANVDSYRPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an ABC transporter Solute Binding Protein from Klebsiella pneumoniae (KPN_01730, target EFI-511059), APO open structure
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Transport protein
molecule keywords Putative ABC transporter, nucleotide binding/ATPase protein
total genus 105
structure length 284
sequence length 285
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hsgA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hsgA01
2FLWA 4QYMA 1SXGA 2HJ9A 3ROTA 1ZESA 4EYGA 1JL3A 5HKOA 2WJWA 3BBLA 4MRMB 4Z4HA 5KQLA 1R8JA 2FSPA 4N47A 3O2QB 3L6UA 1DZ3A 2FVYA 2RDMA 2LP4Y 3O1IC 4QICA 2LIVA 1JFTA 1Z2DA 4MRMA 4Z4CA 3HO1A 4OLAA 4WUTA 3CRNA 3O1JC 2JVKA 1DBPA 3MF4A 3C3MA 4MQEB 3Q9SA 1NATA 3K4HA 1YK0A 1QQAA 5JNTA 2PUCA 3QELA 4NCBA 3G85A 4XXHA 5EWMB 2QXYA 4Z4FA 5FBHA 4G0ZA 4MQFA 5KQPA 5JNSA 5BRJA 3I42A 2E4UA 3SAJA 3NHZA 3E3MA 2A9RA 3FGZA 4YP9A 2V0NA 3SNKA 1EFAA 2FEPA 4JASB 5FWYB 2M98A 3JPYA 3M6MD 4MQEA 4RK1A 1ZVVA 3JPWA 5CNMA 1ZGGA 3T38A 2ID7A 4MLCA 2MYNA 2FMKA 2CWDA 2OQRA 4EVRA 5FWYA 4LE0A 3QX9A 3GV0A 2FXIA 3JS5A 4RK0A 1USGA 4RXTA 1KMIY 3OM1A 2YHAA 3N0RA 3H6HA 3QLUC 1APBA 4LX8A 1P2FA 1PHRA 1U04A 3DBIA 2J48A 4PICA 1D4ZA 3HJFA 3Q7TA 4Z4EA 3QK7A 2NZVG 3KYJB 3LTEA 4P98A 3RVRA 4DQDA 4RK4A 1PNRA 2PUAA 3N53A 4KNYA 1P6UA 3H5VA 4JB2A 2NUBA 4S04A 4GNRA 3OQOA 3IDOA 4KFCA 3TMYA 3OLVA 2WMYA 1C4WA 2IPAB 1J56A 4XARA 4F3TA 2ID9A 1MVOA 4LDZA 2FQYA 4N76A 3KLOA 5KC8A 2PE5A 3SM9A 1QKKA 4MS3B 4JOQA 4CBVA 3RVOA 5IEJA 2E4VA 2I6FA 1CHNA 2JVIA 5DLEA 1NXTA 8ABPA 2L2QA 1ZITA 4KPYA 4YWHA 1ZGZA 3O75A 1RZRD 5TPWA 3EDCA 2A9QA 4PEVA 2L18A 1JFSA 3VNAA 2IPMA 2TMYA 4NCAA 4G0PA 3JVDA 5JNVA 4Q6WA 5B3JA 3RVMA 3DLBA 1NXVA 2FQXA 3GA5A 3OMWA 4RU1A 4TMYA 4IMJB 5GOTA 1BDJA 2WWVD 3O2SB 2OENG 3A0RB 4N03A 3NNDA 5EWLA 5IEBA 5BQ3A 5PNTA 2L17A 5C5CA 4RV5A 4EYQA 4MS4B 5JS2A 1FSPA 2B4AA 4EVSA 3BRQA 3F6CA 2NT4A 3F7NA 3K9CA 5CNKA 4PYRA 4Z4GA 4GPAA 4YCSA 3R0JA 1PUXA 3LUGA 2PLNA 3CLKA 2PUFA 2N9UA 4MR8B 1NXWA 2PUDA 4P1ZA 2MYUA 1JLKA 1NTRA 1PEAA 1TJYA 3GBPA 3JTEA 5E3JA 2CHEA 2JCGA 3OLWA 2PUGA 1F4VA 4Z0NA 1NXPA 3GYBA 1CEYA 3HK2A 1VKRA 3MIZA 1TLFA 2FN8A 4FE7A 3I45A 4WT7A 4QPJC 4YO7A 1Z13A 2FEKA 3A0UA 5IUNC 1ZAYA 1USKA 2FKAA 2PUEA 2QW1A 4RY9A 3EQZA 1E6KA 4WXMA 3GT7A 3QX8A 3CKMA 1XWWA 3D8UA 4MQFB 2LBPA 1JYEA 4MR9B 1S8NA 1MB0A 1NXOA 3HS3A 5EWJA 4L85A 5JNUA 2FEWB 3L49A 4O1HA 4XAQA 1JYFA 1Z25A 1LJLA 5HM6A 3KS9A 2JVJA 2PL1A 2FW0A 2O20A 2PKXA 3HCWA 4DN6A 2HQRA 3BREA 1ISRA 1EWKA 4YLEA 2F8SA 4WXEA 2GI4A 3G1WA 4LE2A 4NV3A 3QEMA 3ROFA 1A04A 3CFYA 3GRCA 1F51E 1NXSA 4ML3A 3LUDA 4ZPJA 3H1EA 1ZH4A 3H5WA 5CHYA 4F11A 1QO0D 1GCAA 4W5RA 1QNLA 1Z16A 1JH9A 3FMVA 1CYEA 1USIA 2E4YA 1E6LA 2RJNA 3UUGA 1DCMA 1VRVA 2FMIA 4MR9A 3NNNA 2P4UA 1LJUA 2Q5CA 4O1IA 4XASA 2VUIB 4YRZA 3C3KA 2FTKE 4G0OA 3TO5A 3GL9A 5KWSA 5DGCA 2WY2D 2W42A 1YS7A 3C97A 2M1ZA 4G0QA 4ZJPA 1ZY2A 3LFTA 5IUKC 1DRKA 1RPJA 3H5TA 4F12A 3HV2A 5HSGA 4M88A 2IYNA 3HUUA 5DKFA 5TPZD 3M9WA 3OO1A 1BAPA 1RXEA 2NZUG 3IP5A 3O2JA 4IF4A 3LUAA 5TPWB 5C5EA 3MMNA 4IGAA 2JBAA 1K68A 3FDFA 2WRZA 4ZYLA 1UDRA 3HDGA 4D6YA 2AYZA 1ABEA 3M9XA 2QV0A 2MSWA 1Z15A 1AB5A 2JRLA 5IULC 2GWRA 3KJXA 4EYKA 1YK1A 3KSMA 1W25A 2R4QA 4H60A 1GUBA 1SRRA 4OLBA 1DC7A 3KCNA 1JX6A 2ZWMA 1A0OA 1ZN2A 4MGEA 4LRQA 4HNQA 4RXUA 1D5WA 3H5OA 3UK0A 5IC5A 1JWLA 1URPA 4KK4A 1KRXA 3Q15C 2PMCA 3CNBA 3ILYA 3QELB 3IP7A 2LUOA 2RJOA 4W5NA 3OLXA 5TQ2A 4RY0A 1TMYA 1XHFA 2XDYA 3HUTA 3N8IA 1XHEA 4FB4A 1DRJA 1PNTA 3LUHA 3UKJA 6CHYA 4E7PA 4Z99A 5DCLA 4KK3A 3DZDA 4G97A 2FQWA 1DBQA 1Z2EA 2MSLA 4N0PA 3OQMA 5FWXB 3LUFA 2PL9A 1RNLA 1YMUA 3CZ5A 1E2BA 4LE1A 4KZKA 4F8JA 5T3YA 3RVPA 4Q6BA 6ABPA 1EWTA 4HNSA 4RKRA 5EWJB 4H3HB 4KQ9A 1BVHA 1ZDMA 3IP6A 1AB6A 4NQRA 3URMA 4DADA 4W5TA 1D2AA 3JVIA 1WETA 3OMXA 3SY8A 1GLGA 4E7OA 1FFGA 3Q41A 2R48A 4MS3A 1NY5A 3A10A 2VK2A 4WZZA 5TQ0A 3T95A 3HVRA 3KG2A 4RZSA 1L5ZA 1A2OA 1QP7A 3BILA 2VYCA 1YTUA 1M2EA 2F8TA 4G86A 2IDMA 1EWVA 2QVGA 4IRXA 4YGXB 3QLVA 2KYRA 4OG2A 3QLVC 3CHYA 3N75A 1W9HA 2E4ZA 1RZRA 2PJUA 2A9PA 4KMRA 3HEBA 1DC8A 2IPLA 2QU7A 1QP0A 4KRFA 1EAYA 1P8AA 2P9HA 1E6MA 4RK6A 3LKVA 3H6GA 5TQ2B 3NBMA 1U8TA 1H9CA 4KREA 5IBQA 1QMPA 2FMFA 4MS4A 3OO0A 3RH0A 1OXBB 2L19A 5FWXA 3H1GA 1GUDA 3FFWA 3GWGA 2E4WA 2HQOA 1Z26A 4Y9TA 5F64A 5ED4A 4MS1B 1JDNA 4IMIB 3OLZA 5B3JC 4RK7A 2MYPA 1M5TA 2FN9A 2QSJA 1LBHA 1ZH2A 2QVCA 4MS1A 4QYWA 4OATA 2RGYA 4TN5A 4XFKA 3TD9A 4EYOA 1BDHA 3CU5A 5JNRA 2VUHB 3GBVA 3NNSA 5GQSA 1B00A 3CG4A 3SQNA 2JBAB 2LPMA 1NXXA 4MLDA 1JDPA 1MB3A 3CZCA 4RK5A 1TVMA 4EY3A 3F6PA 3HXMA 3HSYA 5KQGA 1YIOA 2X7XA 4S05A 4OBBA 4YR7A 1BDIA 3OM0A 2MSKA 3MA0A 4UHJA 1JBEA 1MAVA 1Z12A 3QEMB 3EGCA 3VNBA 4W5OA 5IX8A 1LK0A 4EVQA 2H3HA 1D1PA 3H5IA 3LMKA 4NICA 5I4CA 4RS3A 1ZHHA 3LKBA 3LUJA 4UHKA 4ETNA 3OQNA 1HEYA 1U2QA 4HYEA 4KVFA 1C0EA 1I3CA 3C3WA 3O21A 3O74A 4RWEA 5KI6A 1JF8A 3DLHA 5TQJA 3B2NA 4ZMSA 5D2CA 5HQJA 5TQ0B 2IOYA 4G0XA 3Q7SA 4RDCA 4W5QA 4MR8A 1ISSA 4XLTA 5TE9A 5T7BA 4TLLB 4TLMB 4Z4IA 5TPZA 2NT3A 3I09A 2IKSA 1FQWA 1DJMA 1RXIA 3E61A 4LZLA 2DRIA 5KC9A 3RVJA 4ETIA 1SXIA 3RVSA 3IPAA 1EHCA 2MYTA 2WJAA 4B09A 1P6QA 2JK1A 2H0AA 3TB6A 2PAFA 4EUKA 1Z17A 1KRWA 1YS6A 3H5LA 4D74A 3LUCA 5IUJC 1JHZA 2IPNA 3HZHA 3KLNA 1SXHA 4F06A 4LDAA 1QO0A 2PUBA 5BR1A 2HPHA 3H1FA 1SD5A 4IILA 3A3KA 1BA2A 4WWHA 1DG9A 5EWLB 1DCFA 1QPZA 3OLYA 2R25B 4N0QA 3QLTA 2ZAYA 1K66A 2FMHA 3F73A 3KKEA 4RXMA 9ABPA 2GKGA 2JB9A 1TM2A 1YMVA 3T6KA 3LOPA 5JNWA 4OTZA 3C6QA 4JAVC 4N41A 7ABPA 1ABFA 3DGFC 3FFTA 2R47A 2HQBA 3KHTA 3N0WA 2QR3A 5JS1A 3EQ2A 3S99A 3T8YA 3MQ4A 5CNJA 4FE4A 3N0XA 1VLZA 1OXKB 1PEYA 3IP9A 3MYYA 3CTPA 4G0YA 4MAAA 4D6XA 2BGGA 4H3KB 3EAFA 3FFXA 2CHFA 2QZJA 4Z9BA 4Q7EA 1GCGA 3CG0A 5CNIA 1D1QA 4RSMA 3EULA 2FLKA 4MPTA 3IPCA 2B1JA 2HSGA 5KQMA 1FFWA 1DBWA 1T34A 4Z9AA 3EJWA 3HDVA 4PZ0A 3W9SA 4YS6A 2YHBA 5BRAA 1U0SY 3D02A 3N6VA 4MYRA 4L4UA 4ETMA 1DP4A 1Z18A 3DGEC 2AYXA 4HNRA 4MR7B 2GX6A 1LBIA 3MM4A 4EGSA 2A9OA 4G0MA 4PE5B 1M2FA 3Q7RA 3RVQA 3JY6A 4MR7A 1L5YA 1YVUA 3KTOA 3O1HB 4ZMRA 1MIHA 2WB4A 4RY8A 3KYIB 3SG0A 4JB0A 1IIBA 1FFSA 1Y1LA 3LUKA 4O5AA 2GBPA 4JP1A 3QEKA 3RVNA 1JFVA 3TX6A 1DCKA 3P9YA 3HM9A 2E4XA 4KQCA 1M5UA 4JA2A 1QQBA 3QLUA 2CD7A 1VPWA 3I5AA 3ILHA 3EODA 5DTEA 3H75A 1QP4A 3CS3A 3NHMA 5EWMA 5ABPA 4RKQA 3RVLA 3RVKA 1U2PA 4YV7A 5FBKA 3RQIA 1KGSA 4KV7A 3BRSA
chains in the Genus database with same CATH superfamily
3VYVA 3C4VA 3MJVA 2GESA 3VKWA 5ITWA 2ONCA 1CY8A 5CM9C 4RULA 2XVAA 1S01A 3DE5X 3KZNA 3LBFA 1GARA 3CLSC 4IDAA 4ZYZA 2PT7A 1P4HA 2XTJA 4YMLA 3VU1A 1QBKC 3GD7A 3ZK7A 2NYAA 3GO4A 3VR6D 2QRUA 2IDJA 2XOKA 4EHLA 1J20A 3HNOA 1Y7IA 5EUCA 5C5IA 2IEGA 4M8IA 2ISCA 4E08A 4IJQA 4TUYF 3F67A 2XVMA 3LBNA 3Q9SA 4ER0A 5JNTA 1Z2OX 3CPHA 3QELA 3KO8A 2PVCA 3V4SA 5JSHA 5I6DA 1FXWF 2QVYX 6YASA 2PT6A 1XTBA 1PJBA 5SY4A 1ZRMA 2HV9A 3O73A 1Y3DE 4IUBS 4KMMA 5JS8A 1MW9X 4DR2B 3WGKA 1X3SA 2EJVA 4BQFA 3L8GA 1ZVVA 3RVKA 4EJ2A 3H2BA 4BFZA 1ZI6A 2GAAA 3LNTA 2Y6VA 3GCXA 4RD6A 2V8OA 2C20A 2QNRA 1DG3A 2CWDA 2F2TA 1RXSA 3TI9A 3A1UA 5KNLA 1LLDA 3IODA 4RK0A 2WU3A 4YO8A 4DR4B 1I7LA 1A2QA 1UBHS 4CCYB 4I5GA 4J91A 3OZFA 3VC3A 3OM1A 1P1BA 2IIVA 4IJUA 4PYIA 5EUQB 5I3CA 3ZI4A 3T7KA 4WLOA 1T8YA 4BUJA 1FXWA 1CRPA 1QCYA 4CT0A 3BSYA 2VDWB 1USWA 1SG9A 5JLAA 4AJJA 3TG8A 3GP5A 1PD1A 4FW9A 1M67A 4ALJA 4DQDA 1UPTA 4GI1A 2IGTA 4Z5XA 4RF2A 2NQTA 2QUJA 5J9FA 1MVLA 4DT1A 3AP1A 3WL7A 3OE1A 1YJBA 5EE5B 4KNYA 3G0DA 2GLTA 3A2LA 3DMHA 1Q1NA 1EFKA 2NADA 4JLKA 4KFUA 2B94A 3A9SA 4FLEA 4TN1A 1KVRA 4J0EA 2WTNA 3EDRA 4RLHA 1J56A 2BFAA 1PP4A 2P9BA 4J1TA 3SEZA 1F12A 1MVOA 3CLRC 5D6OA 1JJAA 3M1YA 4MJ7A 5J4VA 5KNCH 2DKNA 3N1UA 5U9CA 1US8A 4O8ZA 2JW5A 3RVOA 1HNWB 4MJ3A 2QY6A 3DAHA 1AK9A 2CHUA 3D7NA 1KH2A 4YDRA 3ZCVA 2BI8A 3PXAA 4DR3B 4IXNA 1LFDB 1RYFA 2FHPA 2X7HA 3FFBA 2H1HA 4MUBA 4NCNA 4H0CA 4O2AB 3PYLA 3RHFA 3UJ8A 1AQYA 1NN1A 1CS0B 5IAJA 4GS5A 2QG9A 3V97A 3VNAA 3GAMA 3KZOA 4YT8A 1JHXA 1WPRA 3UK2A 4AW9A 4AJ2A 1NVVR 4MWTA 2AFRA 2ERXA 1JZQA 1KY4A 1ZGCA 3OZXA 4P54A 4Y8VA 3PXXA 1RLTA 4YRPA 3RFXA 5KYTA 1R5NA 3OY2A 3P96A 3U1VA 4EIWA 1AV6A 3N2KB 1A77A 3GJ8A 3K5HA 3NBUA 2AK2A 3PEFA 4OXXA 1XK7A 2MCFA 3EVGA 3X43A 5J47A 5A04A 3QVWA 4FN4A 3SQLA 1W88A 1NF2A 5JS2A 2P2DA 3CNOA 2B4AA 3HYLA 3W1EA 2ZRBA 2RHCA 1XTZA 3S5JA 4HXGA 4ARSA 4Z3OA 1Z0AA 4UPEA 1EJ2A 3R0JA 5TR9A 1P18A 3COZA 3SOPA 2VRWA 2FVXA 1UWKA 3GT0A 3OEHA 1XA4A 1HWYA 3FDXA 3NGXA 3ZJ4A 3TZBA 3P32A 1T0IA 5CB4F 4PPGA 1F9AA 1VJRA 4Z0NA 3UAGA 3D4IA 3E1SA 1ZMXA 4NDAA 3ZLTA 3C5HA 3MIZA 2WIGA 4LTNA 4EHKA 2BIFA 5C8YA 4QT4A 1ZOOA 4PLGA 3K4PA 2PUEA 1TKAA 4GP7A 2II6A 5ALPA 5JCOC 3KQNA 4BBZA 4WDQA 1GILA 3PGKA 3ZWCA 3TLCA 5D84A 2RH8A 2FUEA 2W4QA 3HCNA 1WG8A 2V7TA 3E9CA 3DOHA 4LGCA 2QRJA 3IDZA 2WHYA 3ED1A 5M04A 5KX5F 3PFBA 3OC6A 4FYXA 3QJGA 1EDOA 1R12A 1HEUA 2FEOA 5FUWA 2A1UA 3HSKA 3IBSA 1D8TA 2FEWB 2HDHA 2VAWA 1KFBB 1XHLA 4C0AC 4PO8A 5HM6A 3R76A 5FV4A 2XJ9A 3QY0A 4M60A 5CFQA 2M6KA 2XYGA 2QGZA 4NZOA 1WHTB 1GIAA 2PKXA 4WNYA 4B3BA 5FOTA 2RBKA 3H0CA 1SVUA 3I3OA 5CEEA 1QC5A 1A5SB 2BTEA 2GZMA 4PXAA 4NNJA 3QXJA 3CFYA 1CRQA 4BE9A 4B6SA 4D9EA 2SHKA 3ANXA 1S2LA 1I4LD 2HBQA 1DBRA 3GH3A 4GOMD 2JIRA 1QHXA 3PC3A 3PPVA 4RKWA 5AVTA 5TMDA 4OFBA 1VPEA 1M6YA 4HK4A 2K2QB 4EG7A 4P92A 4TMZA 3ZXIA 1TQ8A 1XZPA 1JSLA 3PC8A 1CYEA 1OPXA 4IIDA 1ZCBA 3WKBA 4LYDA 5AJTA 4OCZA 2P4UA 3DTVA 2HJGA 3SDZA 4A2WA 2Y99A 4MUGA 1E3WB 1QUEA 4ABYA 4IDCA 3V8MA 4BNGA 3JQ8A 1X1EA 4PINA 5DGCA 1LBEA 3E9RA 4DEVA 2EZTA 4GFDA 1JJBA 1EFDN 5IVKA 1CUUA 4FDMA 2GAJA 1GZ4A 4DQ0A 4D0LB 4PZDA 1HDOA 4XCQA 4A6DA 1UWCA 221PA 3H87A 5I3ZA 3QKSB 3ZDZB 1GAWA 3B6MA 3OT5A 4YDHB 3KOUA 2PH3A 1JW9B 3AVQA 4JI1B 3IDSA 2ZRHA 1TIBA 1YS4A 1RKBA 1QF9A 3GJQA 4HNAB 4E5PA 1MZPA 1AHPA 3LPNA 1T6BY 1VB5A 1GSIA 2MSCB 2B2NA 2UZ0A 1ZPDA 2BFNA 3D4NA 3KD2A 4EF6A 2AT1A 2AWOA 3C4JA 1QDLB 1W30A 1M8JA 1ZQ1A 2OAQ1 3L0CA 3QWIA 1OZ0A 3NXKA 5DU2A 3HYSA 3U0VA 2Y1KA 4NPHA 2PKQO 3KVYA 3F6SA 3MB5A 2GWRA 3WJ7A 2KPOA 4QTUB 4YRQA 3RPEA 4ZYUA 2ZI5A 1L5GB 3L7NA 1M0EA 4UNSA 1XU9A 3HCBA 4R6WA 1ODSA 2ORYA 4KXNA 3SVTA 1JNYA 1A1VA 2Z9CA 1GYRA 3AWDA 2AGVA 4O4HF 1HSZA 3KPYA 5CYOA 3EOZA 3WGQA 1NPYA 1IULA 2BFCA 1KSJA 3OBBA 4IINA 3ZUGA 4FFBA 3JQEA 3OY7A 4DILA 1EUZA 2IHYA 4CLRA 3UOWA 2BHRA 4TX1A 2OFWA 3MD0A 4CMBA 3UAOA 4CM1A 1TGVA 1UBRS 2N1MA 2BGLA 4F4JA 1K0FA 1V43A 1KEEB 4WV3A 2Y27A 4GZ6A 1M72A 2J32A 2VNKA 4ZU3A 1RQLA 4II2A 3SEAA 1HTBA 1MQAA 2V74B 4X5OA 3TM4A 3Q0TA 1L7VC 3HKDB 5GWXA 3WMXA 5LP6F 3CZ5A 3TQIA 1BRTA 4QO7A 5JCJD 5L4SA 5T3YA 5LLDA 2AKAB 1CQIB 1AK1A 1SVSA 2GETA 1XVLA 1KYQA 2PL5A 3GT4A 4G5SA 3WQHA 5FWNA 1PFWA 1NVUQ 2R7LA 4DLTA 2QTZA 1V11B 2Y1OA 2Y3IA 4MZXA 5E6SA 2D7CA 2Q1SA 2YJ6A 1RPNA 1YJ5A 3KXPA 4FINA 3D6TB 4RJJA 4U7GA 5F35A 5HGJA 2BELA 4YAOA 4Q7KA 1QTQA 1G7SA 1SU8A 4ZT6A 5F1YA 1WWKA 4PGFA 3JASA 3O8QA 1PUJA 2O0HA 1UH5A 1O1YA 5EFOA 1JWAB 3DPUA 4AIRA 2O3RA 1QIEA 2CBZA 2PO7A 1M2KA 1X87A 1XROA 3QEJA 1NN3A 2Q28A 2ZB4A 5CJJA 3QU4A 4DLBA 5I9IA 4R3NA 1U02A 1QYIA 1EX1A 3UW1A 1N33B 4G86A 2P1RA 4P0TA 4NECA 2QVGA 2SCUA 5JVDA 4EHIA 5LFAA 5J2UA 3GCWA 1TZJA 3N9IA 2XNDD 3P2EA 1NJSA 5ALKA 5EI5A 3VZSA 2VLBA 3N75A 3RUPA 1OILA 4ZVSA 3BT7A 2E4ZA 5EMKA 4KLZA 2JLVA 3NV9A 5I8PA 2NYRA 3RIYA 1V9CA 1QB7A 1QP0A 1YDMA 2NUAA 1KO5A 5F5XA 1SIWA 1NR5A 5BQOA 5G1NA 2CHVA 3TXYA 3VXKA 1HA3A 3W8RA 1UK7A 4EPYA 1CR6A 1UFQA 3RFUA 4P7BA 2GPBA 3Q2OA 4DDVA 1OU0A 1Z5WA 3BMCB 5IC6A 1NW7A 4PWYA 4B6PA 5HK9A 5LWHA 1J2TA 2WE8A 4BO3A 2NNWB 1VA5A 3WKAA 3D9QX 3OJOA 1NJ6A 3F0TA 2HSWA 3BQMB 2WJIA 3PGMA 2ZSHA 3CT6A 1E1DA 4ED9A 3R3YA 2C0QA 4RK7A 4N5HX 1M5TA 3LCVB 4EBBA 2FN9A 1U0OC 2QVCA 4N7MA 1G6HA 5LYYA 1DQRA 1LDEA 1RYNA 3B7GA 1BDHA 4PO3X 1ST2A 2NUPA 3CU5A 4BMPB 3ETJA 1D2CA 4KRYA 4LY6A 1X77A 2H1RA 4MTCA 3PUYA 3MWEB 2WJGA 4QZVA 1T3SA 1SC9A 3VPHA 2BGTA 3T7SA 1H4VB 3HXMA 1R5BA 4L95C 3FLEA 2A33A 3A36A 4L15A 4NFLA 4M9SA 3D2BA 4ZI7A 2LKCA 4IV8A 4Q1DA 3OPVA 1PSWA 3NBYC 3VNBA 2QM8A 3WIVA 4BV9A 5J4LA 5JTUA 3LXUX 2O54A 5TGDA 1YMQA 2QVBA 4ZO4A 1HY3A 3ZTYA 1I2AA 4JLMA 3PHLA 3LRPA 2IOFK 1UC8A 2VO1A 2REXB 3G5MA 3K5PA 1WMFA 1M8GA 3BQNB 4HVLA 1EWQA 5DI3A 3JALB 3L0OA 2B4QA 4QGSA 1MUUA 3FNGA 1C0EA 2IUTA 2R1VA 3MIIA 4B6FA 4I1UA 1BD4A 2OKGA 3O74A 4J75A 3U3OA 3V4LA 1C80A 1RAFA 3HLKA 1IOWA 3SHTA 3IV6A 4KFRA 2VP4A 2O8EB 2BTQB 3QOWA 1YBFA 1NLFA 1NBEA 3O7MA 3V7NA 1C41A 1SZPA 2JFQA 2I03A 3R9XB 2WG1A 1DX4A 1KDZA 2YFHA 5KOIA 5EPUA 1Z47A 4NNOA 3SX2A 1G60A 2AG0A 3AI3A 4QPDA 1QVVA 1YR7A 3EOAI 1H6CA 3IVCA 4R9SA 4FI3F 1QBGA 4FBLA 4XQCA 1P4SA 3RIEA 3WWYA 5IMSA 5KNBA 5LP6A 4WVFA 3RVJA 3JWJA 4M8NE 1SXIA 3LY9A 3P0FA 3RJTA 4N5LA 4NCXA 3RYFA 3T9BA 1RCTE 5DBFA 1A5ZA 2JK1A 2W4MA 4JJ7A 3I34X 3JR3A 5DI9A 3SDBA 3W8NA 1ZD8A 1TO2E 2BSXA 2WUVA 4QRHA 5EIAA 4AXXA 1S6YA 4CIAA 1MAUA 3NYWA 3U4DA 3LUCA 3NIDB 3PQFA 9GPBA 3KLNA 4XKJA 2ESRA 2X9VA 2CV2A 2WSSA 3ZWWA 1VG8A 3HJAA 5HJ7A 1G21B 4L07A 4XPIA 1A7JA 3PQ4A 4R98A 4HAXA 1UPCA 5JEDA 2G5GX 3E3OA 2Q3CA 5E38A 5FUVA 1GNQA 3QOFA 2WTEA 3EVTA 5K0FA 2NSLA 3BL8A 3DPSA 4R1LA 4C04A 4PX9A 3RO7A 3ZW9A 3DEJA 1P29A 2IY7A 3TKYA 1WCYA 4M0FA 5F3RA 5FI1B 2H59A 4LPKA 4ZDIA 3I9LA 4V02A 1K0UA 3SICE 4FJ2A 4OTZA 1E79A 3SF8B 1NMSA 3U80A 1GAXA 3BZWA 1Y34E 4JYMA 3PEWA 1TYCA 4ZIRA 4Q3CA 3GFGA 3T8YA 3RK4A 2PLFA 4IIGA 2IEYA 1CBUA 1N5RA 3KHSA 3O0TA 3S68A 1OXKB 3UWKA 1GEEA 4O4LB 4YT4A 5HM8A 5CCBA 4UCXA 4LXQA 2AC7A 4F60A 1TM1E 4CF5A 1G2OA 4ZEXA 5CNIA 1SBCA 1LK7A 4IDNA 4RSMA 2ZRPA 5I7OA 2CDAA 2HDNB 1X1CA 3PFIA 2HU8A 2XNSA 1RZ3A 1EQAA 2ISQA 3G0CA 1E62A 4ZZ3A 3RNLA 2CFCA 2YVQA 3AL2A 3OI7A 5KQMA 1Y1RA 3L1UA 4KN5A 3DYVA 1FFWA 4PNZA 3PDJA 4ZQHA 3SKYA 5BXYA 4OIMA 1PT9A 2QRVA 2ON6A 2AC2A 3HUEA 3PQ6A 3D6NB 3NEJA 4QXMA 4YS6A 4FLMA 1V4BA 2VPIA 4B7AA 4EW1A 1C9KA 1R6VA 2QTVB 2X5JO 1U90A 2JHAA 3DE7X 4M0DA 5C9ZA 1DRVA 2IZZA 2ZUBA 2I2FA 1NSYA 2WDZA 1OTYA 1UQUA 1V9SA 4J94A 1CUFA 4G0UA 4V0RA 5HXAA 1G6OA 4KDEA 2ZB2A 3IIJA 2X0DA 5C32A 2Q2NA 3KTAA 2WKRA 5HKAA 3JY6A 5E8RA 4OXIA 2MINB 5KYXA 3ZCUA 2C61A 4C3ZA 1ZFNA 5HP4A 3EASA 1ZXLA 3L7YA 4F8YA 4B84A 1YRLA 3BWYA 3SLKA 3E03A 5SYMA 1EKXA 3K0AB 3WGUA 4HMOA 4HMPA 2BYTA 3U9TA 2O8FB 3D64A 4OGGA 5TB5A 3DVSX 3FJOA 2ZDHA 2P5SA 2W43A 5HFAA 1ESMA 4HWRA 2JFFA 3PPIA 4QOGA 5ILOA 4QREA 3H2KA 2XNDA 4GL2A 2AR0A 3SYNA 1P17A 3PTLA 1U28A 1JEEA 4LJ4A 1UAGA 3DTTA 4MVJG 2GZ1A 2VNHA 3T3IA 3DBHB 1SC3A 4YV7A 4NS4A 1UP7A 2G72A 3I2FA 4KO8A 2VNJA 4MHSA 5IN5A 4CEHB 1TEVA 3EVEA 3HY6A 4JGBA 4ND2A 4G2TA 1GTRA 3B3GA 1ECFA 2COEA 3JRXA 1C3XA 3GJ6A 3E2PA 1N6LA 4HLCA 3U3JA 1J6UA 4ALLA 5TIIA 1ZNWA 4QICA 2LIVA 3PKJA 3ZKWA 2A9KA 2ZRJA 1M83A 1XVUA 4YHHB 5TNXA 1GGNA 3LXRA 1JTVA 3BDAA 1NRXA 5LPNA 5DIFA 3ZU2A 3DULA 2CHGA 4MEAA 5B58T 2H29A 1MF7A 4G63A 1O97C 4KPUB 4LV6A 3G85A 4XXHA 1ODTC 5ALDA 4YYEA 2M1XA 3THRA 5IRCD 3C85A 2QXYA 4QYSA 2V45A 5CD9A 4RTJA 4Z4FA 2D2IA 5I4KA 4N5DA 2XUIA 2EEZA 3HR8A 3I42A 3KQPA 3OZTA 1WMSA 1FX0B 3L6OO 2B30A 1VFPA 2O6LA 3OCJA 5IT5A 5DX8A 2JKVA 1NBOA 1O5TA 1JEOA 1G2PA 1FVHA 2X8JB 1JSCA 3R7SA 1I2ZA 3AVXA 2QU8A 1ZGGA 3PUWA 1Z63A 2VHJA 1KS9A 1H65A 1FIUA 5DO9A 1V7PC 1R00A 2ASVA 2O3QA 4TVOA 5CAEA 3QSYA 1GPBA 1ZWKA 3NIGB 3DB2A 5H5JA 4MDFA 4PYNA 2H57A 2P7IA 3IHKA 3E15A 1BCRB 1PNQA 3IILA 3SJAA 3KC2A 3L7OA 1DQPA 2OCIA 3OJXA 1NY6A 1W34A 2IHTA 2D2EA 2ZE8A 1YCFA 2HSJA 5A7GA 3SIRA 1EESA 3K8OE 4BYMA 2NXNA 1TUBB 2IHBA 3WHLA 1JHQA 5H0IA 3EIEA 2FZGA 4R7ZA 1KQFA 1WPGA 3GI1A 1CQWA 2UZIR 3OTIA 4V38A 1XNQB 3PX3A 2OBLA 3P4YA 4RFLA 4PG4A 2HCFA 3CONA 2P9QA 2XY4A 3U16A 1WDWB 1J24A 4KFCA 1SC4A 2HQ1A 3CPSA 1KEEA 2JANA 4OHVA 1DQNA 1JH8A 2IK8A 3WDSA 4GKBA 1B43A 1HYQA 4PY2A 2P2SA 3QKTA 3KLOA 1SHJA 4L8LA 4PZ9A 4Q1VA 1M2VB 1TEXA 1VGQA 2I1VB 1RWVA 1ULBA 2GCNA 1HT2E 4GC9A 4QUJA 4TTQA 2A5JA 2OPHA 4CLRB 4HQLA 5C4IA 3BK1A 3K4QA 3AEUA 3RYCA 1KO1A 1RJDA 3OZ7A 1TEHA 1OTHA 2FX3A 4NCKA 2EFJA 3O75A 3OZEA 2I3ZA 4XGRA 4X1YA 4A91A 2VEOA 1ELOA 2H52A 1KOLA 1A7AA 5JXWA 5KTYA 4W1RA 2G1JA 3I1JA 3N2YA 2C42A 1EIWA 3IAUA 4RS4A 4QM6A 1E3SA 4B34A 1Z6YA 3I0NA 3OIYA 1QYCA 2OBYA 4GSKA 3DV2A 2OBNA 4K26A 5L7WA 1J22A 5ENDA 4OHOA 3TNJA 2FV8A 3SYKA 3WL8A 2C97A 1QKJA 2ORWA 3O92A 5PNTA 2P2ZA 4KMSA 1E7WA 2YJNA 1JR4A 2V7BA 4PC6A 4RIHA 3RBZA 3OIUA 3ROGA 4NXMB 4NZPA 3F6CA 4LXUA 3OOEA 5BV7A 4R9NA 1V5GA 1ENOA 3MWYW 3Q6NA 4M0KA 3ZBUA 3CXUA 4F72A 1IMOA 1C3VA 1G3MA 2Q3MA 4YRDA 2F17A 3ONEA 5ULLA 1C5KA 5K3AA 4BLOA 4EKIA 4LMRA 4LZJA 4EOGA 3A4LA 5ALEA 2F3TA 4ADSG 2CHEA 3D7KA 1A2KC 1KNXA 1PE0A 3KE9A 2HF2A 1VKRA 1UMBA 4JJFA 4M3NA 2XGJA 5FBLB 3TVTA 4UNIA 5KVCA 1BIFA 3C2QA 2FW1A 3M89A 1ZAYA 1FYVA 2WB2A 1KC3A 2QW1A 3X44A 3MVEA 2G6BA 2QN3A 4K3VA 3SC2A 1JFFB 4HAOA 1YB7A 1RZVA 1AM4D 1G8SA 3ZH2A 2X8AA 1R4NB 3JAKA 2JFNA 4FCVA 2JEZA 1QGYA 1JG6A 1VHTA 1G7RA 2Q3JA 3CLUC 1KI2A 4F84A 1AGYA 4WDRA 1B15A 1KK0A 4DMFA 4B5LA 3RLFA 1V48A 1EFCA 2V7XA 1FZQA 4XQGA 5T64A 1ORDA 1U3TA 9MHTA 3R3VA 4P38A 2AQHA 1G18A 2NSDA 4TYNA 2NUPB 4YMGA 2A5FA 3N3BC 4NJEA 3LHFA 4EGQA 3TL3A 2B9EA 2OHIA 3L3BA 4GOXA 4H31A 2O7VA 1S9HA 1T3LA 1U3FA 3K1AB 2E5WA 5CT5A 1AQUA 1BXZA 1YZFA 1B26A 3V3TA 3DPIA 3MGCA 4P2GA 3LHIA 2FG5A 3O95A 3NVDA 1ZM4A 3E5HA 4CKZA 2GNAA 1YCDA 1A50B 3HQ4O 1K6JA 3ETLA 3EEQA 1NJ1A 1U7PA 3TSWA 2GTIA 4ALNA 1GCAA 2G82A 3MILA 2DWQA 1P8JA 3L1KA 4B2LA 4LKOA 4JVMA 1KYIA 2DCUA 1XDSA 3EEIA 1IUKA 5BW4A 3MD9A 1FBTA 3NW9A 3MXTA 4K7JA 1NF9A 1E96A 2YZGA 1LDBA 4NQZA 1EMDA 3SS9X 3W3AH 5K0JA 1M8KA 1K3FA 1XCJA 2E5LB 1K8YB 3LWZA 2JRCA 3TO5A 1Q7GA 3GJ3A 2O8CB 2FF5A 2WY2D 4I99A 3TZHA 3EB9A 2RH4A 3UHPA 1H0HA 1U9JA 1NSFA 2C5AA 1O6FA 3G9XA 4E5SA 1RFGE 1NE7A 1JU4A 2X2FA 5TARA 2CLLB 4AP6A 5IKXA 1WZIA 1T3GA 3JWGA 3SFVA 1OBFO 3H0EA 4TS9A 5BY2A 2IT1A 1MENA 3B2EA 3HNPA 4WUVA 3G9QA 3O2JA 5FEUA 3LQKA 4PSAA 2IY9A 4GC5A 5AKZA 3F96A 1ENZA 1IUOA 5KNDH 3HO6A 4ZV7A 4GLFA 1N8TA 2FHSA 3N6XA 2Z43A 2BEUB 3PUVA 2P11A 4KIJA 4X64B 1G41A 4L9WA 1NNI1 1J07A 1L4GA 3M9XA 5DRTA 1I6LA 3FHJA 2MSWA 1PK8A 2P41A 2QN1A 1Y33E 3RRXA 3JZMA 3WLNA 2IZ6A 1QX3A 2JH9A 2EJBA 2Q8NA 3GG9A 3MUOA 1ZG3A 2V4ZA 2ZI9A 1N2ZA 1GUBA 2H1FA 4PQFA 1MG5A 1M7BA 4IHQA 2O5CA 4XW2A 3S7ZA 1KERA 3GZ4A 1RHMA 4N7BA 3H5OA 1TZMA 5JTTA 1ICIA 3WBFA 1KRXA 1CR4A 3NM6B 3GLGE 2AL7A 3VJKA 4EGFA 2VHQA 3O94A 3CRRA 4HEHA 4MHOA 4G41A 2FF7A 5CLFA 1L5MA 3ND9A 3C5EA 3AHDA 4I4TF 1NUSA 4JXJA 4MA4A 4MW5A 1RU3A 4BS9A 2JJQA 1VMKA 3DE3X 4MK4A 1W8DA 2AOUA 3RVBA 1V47A 4Y9UA 4HAYA 1G59A 3TD6A 3WL4A 4NG4A 1Y81A 2C2KA 2R8BA 4N0PA 1NQWA 4N3BA 5C0OE 4BIIA 3LUFA 2FN4A 3LHSA 4M4SA 2IIPA 3E9MA 3OIWA 3NUGA 4Q66C 3N58A 4Y2QA 3U3MA 3R20A 1RXUA 1XRQA 3VYRB 1CY1A 4JP8A 4PSDA 1M54A 1I5EA 2X4DA 2XYPA 4XPZA 3RF6A 5L4NA 3LCMA 4G5HA 2G9UA 2QX4A 4QECA 1NW5A 4J4BA 2ZK7A 4F9TA 4DIMA 2D5LA 1AH2A 5EE3A 1Y0BA 4N5IX 4KHZA 1OT3A 4WZZA 1JAIA 2DHQA 3JR7A 1Q50A 4RHYA 1Z7YA 4DOMA 6PFKA 1GPYA 4JYCA 5TEVA 3U3ZA 1TZBA 2WUFA 3STVA 4YP0A 3DOJA 2IDMA 4CFYA 2AEFA 1UF9A 1BX0A 4IJMA 3QX3A 2WSYB 4WNCA 4WNAB 1Z08A 2VOEA 1XCPA 3U4GA 3T5PA 3G2KA 1C4OA 3S28A 2QU7A 4IAOA 2CXXA 3M1AA 3FHOA 4CF4A 5IKMA 3MINA 5CW2A 5AM4A 4RK6A 1K4MA 4D96A 1MX5A 4A8JC 5BNZA 3NBMA 2FQ1A 1B73A 4H18A 5I7VA 2QD3A 3E2IA 3M8KA 3TNFA 4LQDA 5FTNA 1Y8RA 5K0CA 1KVQA 4U7PB 1XDDA 3JSXA 4HO1X 4Q9IA 1ODFA 4Z53A 2HJHA 4TV9B 1GSAA 1ZISA 5JPCA 2QN8A 1SXQA 1BQ3A 3DAPA 3VU0A 2ACWA 2QAIA 3SWWA 2AS0A 1GL3A 4PQYA 1GZSA 1EX6A 1HL7A 1TQ6A 3AV3A 3E6AA 3F7MA 4FUQA 4B40A 2VP3A 2X5NA 5A3QA 1DNPA 4Y0AA 3KNZA 2ZRDA 3AX6A 5CYPA 3RREA 3HN6A 4QYWA 4KRXA 4C4AA 5KQSA 4Q3NA 1F0NA 4ZQGA 4C89A 2IZ7A 3DFKA 1RWOA 4FDUA 2EX1A 1J2YA 3KBBA 3KKNA 4IGIA 5JNRA 5JJKA 3NNSA 4M1TA 5CVCA 3KT3A 1DAOA 2VI5A 4MLDA 1RTKA 2AFHB 2VKTA 3F3MA 1RJFA 3C70A 1W85B 3B7PA 4NOKA 3MA0A 3R4VA 4TL8A 4UTNA 4OBEA 2PX2A 3IHLA 3GLIE 1F2VA 2PMEA 4BVHA 4EVQA 3OWHA 3BWEA 2COKA 1QVRA 1I3LA 2BM0A 1YQTA 2IOQA 1MP0A 1QH0A 1EE2A 2QT0A 3HADA 3NR2A 4NEGA 5IXSA 3SBXA 2AHOA 4FQ8A 4OIFA 2A0YA 5FLYA 2OG1A 3C3CA 4OGWA 4ZVOA 1L5KA 1MHPA 3GNTA 4EX7A 1AQNA 4LXXA 1XNGA 1KQOA 4DY6A 2XR1A 3KETA 1CULC 2H2GA 5JSZA 1O3YA 2IZ0A 2W2KB 1JHOA 2R7NA 2QMOA 2Z2ZA 3TLGA 4BGVA 5IM4F 1KI8A 2X1MA 4UQOA 5LA6A 5TQJA 4FMDB 1UWLA 3B1VA 1CETA 3G49A 1T29A 3GLKA 2DVMA 4MR8A 4FCWA 4XLTA 3THXA 3HRIA 1YIAA 1WP4A 2N47A 4YRKA 3OVMA 4YUZA 1OXTA 3F1KA 3NIBA 1S89A 3EN0A 4LV8B 2R1ZA 2BZ0A 4UU7A 4CMIB 3MQ2A 3V8RA 1E2QA 4MUKA 4BDTA 1DJMA 3FJYA 1N4DA 4AZWA 1X1QA 1ZNYA 2H18A 4H08A 2X3UA 4CUJA 2ATVA 3CLRD 4ND6A 4ZJUA 2RHTA 1H2BA 5DVZA 3EPRA 1MQ8B 3K9BA 1K7EB 5MHTA 5DN6A 5A0FA 3T12A 4KOAA 2ZIGA 1D03A 1E5VA 5AP9A 2JIZD 3LH5A 3EC1A 2QTMA 5KNBD 2JIQA 3H5LA 2QD4A 3I28A 2OAEA 4OHCA 3CEMA 3EIHA 1O0SA 3PDIB 2F3UA 1KBZA 1AY0A 2FRDA 1M8PA 3NS7A 2W6ZA 3B5EA 1HT3A 1M76A 1WOYA 4LCBA 4K2HA 2P1ZA 4JI7B 5AI8A 2ANCA 2X5OA 1YB2A 4H1TA 1OAAA 3QVGB 4U2BA 4NU5A 5AKXA 3BVPA 3CEJA 3OD5A 4O2RA 5C4MA 5JHHB 5DLYA 3QLTA 2OL4A 1MRNA 2ZIAA 2XT9A 3DMGA 2WA1A 4KC0A 1QG2A 4HDQB 2JF0A 1RYMA 3DP7A 3EBPA 4O4IF 3R8CA 4EFNA 2H51A 3NCHA 4W6ZA 1T2UA 4I46A 4JAVC 1NW8A 2GD1O 4D02A 3FFTA 2NNLD 4A6XA 2XAAA 1KMHB 1S2GA 3EQ2A 4FE4A 4F1JA 1JQBA 1T9CA 1E9BA 1G8HA 2B8TA 1V2GA 1EEHA 2QLNA 2WFZA 4PZLA 4X71A 2OXTA 3MYYA 5LKAA 1M1UA 3EGDA 5AKYA 3WIDA 3H8WA 4RDXA 4XTCS 4HBGA 3GRYA 3K8YA 3D3QA 3EULA 1L4KA 3EDYA 3X2FA 1VI6A 4MQMA 4N7RA 5FO1A 2GTHA 5JAOA 3A4NA 5G41A 1GOTA 2Q07A 3V1NA 4TKVA 1R8YA 1IE3A 3KP1A 2ZRIA 3AM5A 4BFTA 1ZM2A 1X7GA 3ENZA 2QUKA 1MORA 1NKVA 4TTVA 5BRAA 1ZIDA 1MOSA 3KJHA 2H1SA 3FDZA 3HJCA 1Q1AA 1RJGA 2W2NA 1OAKA 2X0IA 1FQKA 2RGEA 3R77A 3EK2A 3SIPA 3X1WA 3D4LA 1JG4A 1I6MA 2C00A 1G9XA 1TJ4A 3IT0A 3MM4A 4B17A 1HBJA 3THWA 4CMIA 4NMLA 5JDCC 1M8FA 2W71A 4NBSA 3ZQKA 1MV8A 5CLIA 3HY3A 4BKQA 4MYUA 1T24A 1OBCA 3U31A 1AGRA 3KOMA 5AK6A 5BXQC 5JRJA 1LRJA 2GM4A 4DWWA 4JP5A 2WP8J 4FGSA 5D85A 5T67A 3KT6A 3L40A 1SM4A 3R2JA 1CIVA 4ODIA 5FJJA 4ARUA 4EAAA 1YFLA 1AXGA 1PLJA 1N3LA 3OZAA 3SX4A 5MDHA 4RDIA 2ZITA 1LQTA 3MQFA 1SUIA 1Z73A 4M1WA 1KARA 2Q9UA 2EGHA 4K9LA 4Q7MB 4J7UA 3DNPA 3WRYA 2TS1A 4A8TA 4B33A 4C3VA 4WJLA 3AINA 3ZUPA 4ZU1X 1R5OA 1RHJA 3NIWA 2COUA 3IMCA 4M76B 3VSCA 1A96A 4XFDA 3DQQA 1WF3A 3WYNA 2GSWA 4LJYA 5EHNA 1Q2UA 2R48A 2REBA 3R7AA 1HETA 4E88A 2FWJA 3WL5A 2B25A 4OYLA 3DLCA 1OVGA 1QKIA 5JCJA 5AOAA 2XYHA 2FMTA 1GPKA 2GA8A 1P0MA 5A1TA 4TZ0A 3H97A 5CJPA 1ZIOA 3LD9A 5KO2A 1QU2A 2WVAA 3N87A 4MEJA 2VUUA 4AKTA 5BPFA 2FFQA 2G71A 1JSXA 4KQEA 2QWXA 1UDWA 2VDOB 4CMJA 2Y68A 3JZDA 1GQQA 4ZKEA 2EYQA 4XLZA 3UJBA 4DMHA 4WLEA 1X39A 2Q7DA 5HZMA 2TMGA 3K9WA 4MV3A 3ZYZA 1ZI9A 2XZDA 3UKDA 3PENA 4B7CA 1XCLA 2HJRA 3N74A 5EJ6A 3DUWA 2XODA 3I62A 3SAJA 2X9QA 5HQTA 5IFLA 2WJPA 2PBLA 2PMWB 5EKUA 3EF1A 5G3ZA 2OK8A 2WF6A 3VOBA 5EJ9A 2PGIA 1IXRC 3F2VA 3DOOA 2E89A 4IIXA 2IHZA 3EAQA 1TJPB 4BZPA 4OI0A 1XJQA 2TMDA 1HSOA 1U98A 3QQPA 4K9MA 1Q84A 4UTZA 4Z2YA 5AVZA 2CXQA 2FQQA 4G67A 4R2XA 1E6EA 1XRPA 2JHFA 2BKUA 3CUSA 4JXXA 2JFHA 3H18A 1YA4A 4PPQA 2HMSA 2P9EA 3WBKA 3ICWA 4PGAA 2G9QA 5B2FA 3V42A 2ZZNA 1KL7A 5L6MB 1ZD5A 3MLEA 4IJ6A 4TMWA 1YFJA 3RR2A 4PPFA 1C29B 3CX4A 3JAWA 2FPRA 2HU7A 4OVKA 3VGPA 1U04A 2BPOA 1BVRA 3DBIA 4WCVA 3Q8KA 2OBFA 1XZ8A 1RQGA 2OYSA 3C6XA 4M89A 1DFGA 2HCRA 1A9TA 3GUZA 2I29A 3VPSA 5J2TA 1GA1A 1DT5A 4HFJA 2A9FA 4DLZA 5CEJA 1P2VA 1VHLA 2XD9A 3AEUB 3REQA 1T0PA 5ECWA 4PQGA 3T9EA 3ZDRA 2NUBA 3U4MA 4DARA 1ZOSA 2J9YB 4DLKA 1G20E 5EHGA 4IIHA 2B2XA 3UJ6A 3GLVA 1OLXA 3B48A 4B2IA 4PONA 2QKYA 2GEJA 4HYQA 4Y98A 2XYRA 4JI3B 4QPCA 3KLBA 3R7LA 3DDHA 4B3JA 1TKBA 5EN4A 5E2IA 3DTVD 4K05A 3T15A 1XFAA 3IKTA 3KEGA 1P2GA 4H6XA 4M0MA 5DF1A 4L8FA 3CKKA 3O9VA 1EUYA 1JVSA 1KHHA 3PQCA 2OXFA 3A8TA 4JQSA 4RFSA 3BCUA 4Z7JA 5FULA 4LJ9A 2ZJ0A 3FCEA 4TUYA 1ML3A 5DGXA 3K8QA 4XYGA 2PBZA 4H4CA 3L8MA 1NXVA 2VP5A 3GA5A 2GOYA 5COAA 2RH9B 2A14A 4BATA 3KBOA 4I8IA 4P5DA 1FZTA 3EUWA 1GTVA 3FPEA 3BZBA 3O2SB 4RMIA 4N03A 1JQDA 1OXVA 5IEBA 2W48A 3V1UA 1WSDA 3K6RA 1CYDA 4IJVA 1K92A 4L0DA 4YMUA 4REQB 4GX1A 1IZZA 3BRQA 4GM1A 3LDFA 3ZHUA 1JVNA 2JAXA 3KTAB 5EMLA 2XWBF 1SA0B 4ENQA 4ZVQA 2X2EA 2VT7A 4TMKA 3ZNOA 3DZGA 3OX4A 3OIVA 2PLNA 1LK5A 3WWOA 4LBZA 2RMKA 1FTQA 3ND7A 5ETJA 4JBNA 4DAOA 3BXHA 4ZJZA 4OGLA 2AYYA 2I66A 1XKTA 4ZYTA 1CFJA 2D62A 2GYWA 3NWBA 4O4JF 1KAHA 1UC9A 1FSZA 2QK4A 3Q87B 4JXKA 3UHFA 4J2OA 5HUJA 4AN4A 3RC8A 4JKYA 3VC1A 1XZAA 1AC5A 2B5VA 2XADA 1U0GA 3BPSA 3CZ9A 4H27A 2ZSKA 2EIHA 1D07A 2WJ6A 1QVAA 1ZKMA 5E8JA 2VJQA 5HA5A 5H7XA 3SZOA 3H17A 2PNJA 1I7NA 3EARA 3RB8A 1RWBA 4FHEA 4K86A 3TR5A 4D98A 1XZQA 1CXZA 1CZNA 2JD2A 1Z7BA 3LDUA 4GYJA 3GCZA 2Z0MA 4L9RA 3KPUA 5DP2A 2W2MA 3CW2A 1Y9ZA 4HEA6 3MJEA 1QHHB 4J0FA 2XD4A 3KS9A 3NGMA 4OB8A 4CLOA 2QRHA 3FNBA 5K09A 1S8FA 5DRYA 3R9KA 3W05A 1RYEA 3HEAA 4Q1CA 1KEVA 5HKKA 3CX7A 3DE6X 3FYTA 3DMTC 3I04A 3P5BA 4PZUA 4HDOB 1UKZA 1ST3A 4RHFA 4UMDA 3KR0A 4Z49A 4WCFC 4B7ZA 3NMUF 1A04A 2M6LA 2W6JA 3FZYA 5LQCA 3UENA 3W3AD 3TAXA 1N6HA 3REQB 3VAAA 1WHSA 1U0EA 3H1EA 3H2HA 2NPFA 3VVCA 1ZOIA 5AUOB 4AJPA 1CF9A 1QO0D 2ZJ1A 3BFPA 3Q9UA 2ZUSA 4L3WA 3RSFA 3D2CA 4CUKA 1QNLA 2OB2A 4G1CA 3P2MA 3R3JA 4G09A 3G5UA 2AVDA 3CUEF 4NKRA 5EJIA 4KXLA 3G8CA 4TTJA 4AIIA 5AUNB 4AQ7A 3AVYA 3WK8A 1U7DA 1FFBA 2FFHA 2LCFA 3QPWA 3TL6A 5HZKA 3CR3C 1VTKA 3A1DA 3ICVA 3PYXA 4MR9A 2VUIB 3KOOA 4UHBA 3W5JA 1U6KA 3Q3IA 4BBAA 4Q48A 1GKYA 5JROA 1GNVA 4PV7A 2ZI4A 1I33A 4KR7A 4N3CA 4NMWA 1F60A 1G2IA 3A32A 4PLYA 5BN5B 4ZK6A 3LKZA 2JL1A 4BGIA 2BUBA 3L07A 3L6DA 3MTIA 4EG0A 2IOHA 2P5TB 2WF8A 5DCUA 1TW2A 2I6GA 1B8VA 3AU8A 2WF9A 2PRIA 5CP8A 2ZYDA 2G4LA 4DLWA 4YIKA 4ZZ1A 2K6GA 2QLLA 4OJYA 3TD2A 5DYIA 2UVPA 4G07A 3AVWA 5JFTA 2G40A 1XYYA 3L43A 1MPXA 5C5EA 3D5QA 2DH6A 5KZMB 1CUGA 3FDFA 4XRRA 4FIZA 4ENRA 2CXTA 1E9DA 2Q0QA 2CD9A 4Q19A 1PJQA 3AHIA 3H84A 4L2IA 4QD3A 3UMVA 2Z56A 1FNMA 4ZIRB 4XFJA 1AB5A 3QX7A 1Z38A 1N4AA 1X1BA 2P40A 3HCFA 2OD2A 3DJYA 4QT0A 1FFYA 3HU1A 2R1TA 1SRRA 3B9QA 4U6QA 3VPGA 1BH6A 1A0OA 4KGZA 2FX5A 1KE2A 5FJIA 4WXYB 3ENQA 5TF4A 1D5CA 2EKBA 3JQ7A 2QYOA 2WIKA 2E18A 3JWEA 4AG6A 2YH2A 3E7FA 4B6RA 1VSBA 2ZYWX 4QIHA 2B61A 3G17A 1BXGA 4UBLA 3MNFA 1Y3CE 1XHFA 3G89A 4TLDA 1A8IA 1TLLA 5I48A 2I8LA 1WD7A 1GITA 5IYZF 1DRJA 1B6RA 4TV8A 1ZUNB 4W9RA 4X65B 1SVOA 2B98A 3HXPA 5H16A 3ANLA 2C7PA 5AR1A 3WA7A 1YBVA 3HA5A 3L5KA 3WBJA 3L06A 4D8TA 3G5TA 4HH1A 1KA9H 1P7ZA 2B3DA 4ERXA 4KZKA 2W37A 3OE5A 1EFHA 4NC9A 4GAEA 2H17A 1BNCA 2WC1A 5E95A 1B8PA 2ZIZA 4LNUB 2NP6A 1O8CA 1RPZA 1JMYA 2R97A 3JQAB 4HF7A 4IDGA 1D2AA 4TL6A 5ICCA 5FOUA 3M3DA 2OCXA 1YJQA 1PQUA 3SQMA 1R15A 3QBTA 3N0TA 2VK2A 3HVRA 3GMDA 4BMSA 3COPA 4G36A 4JQZA 1A76A 3NHPA 2DP4E 3B5JA 4NU6A 4MX8A 4QQ8A 5JVDB 5F23A 1TYAE 1K86A 5EQTA 4NP6A 1M2EA 1PFYA 1Q92A 5BMVF 1R3DA 5B2ZA 4NABA 4IRXA 1HDEA 3HBJA 2OT3B 2WK1A 4HRYA 5DBGA 5EA2A 1JPNA 3SZUA 5AUPB 5JH7F 5LP6B 4Q1EA 2C58A 4LZWA 3AB7A 4OXKA 3IQEA 4PHHA 1AZTA 1UDXA 2I54A 2JFUA 2P4EA 3L0IB 4RD2A 4X97A 1CJTC 3ZCTA 2XYVA 1XTPA 1GZUA 1RM4A 1UJ6A 1EAYA 2JHGA 3BS4A 2A0KA 3ETCA 2PU5A 3JQ9C 3QG1A 3QF4B 4HNGA 4J1NA 2IHUA 3IKMB 2CXSA 1Q0ZA 3IPYA 2VRCA 1DSSG 4EKDA 5DHTA 3QPUA 1UDCA 3VPDA 4ESOA 1VJ1A 3E4CA 4K28A 2IYAA 1FJ2A 4CCWA 4NZYA 5FPTA 2H4FA 3JQBC 1JEQB 2NU8A 3DHWC 6AT1A 2D6FA 1UBNA 1THMA 1BE1A 3F5QA 2NYUA 3IIKA 5CX4A 4B35A 1JIKA 1GUDA 3GOHA 5A4JA 1NR7A 3U7JA 3LQ4A 2ZS8A 4Y9TA 4AAYA 3IXMA 3HFRA 1E9FA 3X1XA 5BWNA 2CZGA 2JAOA 2D1FA 5JXGA 4JLPA 3VOSA 1A9RA 3IOCA 3MMZA 2ZCVA 4LJ5A 5DX1A 3GLIA 3KUCA 2B0CA 1Z6QA 3QVXA 5HFJA 1T25A 2ZUUA 4I4CA 4C7XA 3R7BA 2QSJA 3UV6A 3GGGA 1JTEA 2QRMA 3DE0X 4M9UA 1H2FA 3TD9A 4EYOA 1LI5A 3T9FA 4L5IA 4YPOA 1SQ6A 4EZBA 2R6DA 4IQFA 3FX2A 821PA 4DM4A 4MVWA 4R01A 2QQ5A 3AI1A 3NANA 2C5HA 3CKLA 1SUAA 4EY3A 1NT4A 2CXNA 5KQGA 4IJWA 3DM5A 1L5LA 2B1IA 4WOJA 2JEOA 4K9DA 4PVCA 4HLDA 3U60B 3CZRA 3GFQA 3TW4A 1UIRA 2QT1A 1V7CA 3JRNA 4H7JA 3FR8A 3SS7X 3KB1A 3W3ZB 3WRYC 1GRQA 2H54A 3LMKA 4BN4A 4JI2B 3NHLA 4WKPA 1Y9AA 2C07A 3WK7A 4DC0A 3HP4A 4PC3A 3OQNA 1L7OA 1VM6A 4UOQA 1QO7A 1U1DA 2PKWA 5CYFA 3SKVA 2DT5A 5AM5A 4IZIA 3ZYCA 4E11A 4DMMA 1UEJA 2J85A 2TYSB 2Y71A 3RJ5A 1KY5A 1M1YB 4QASA 4JEHA 1GVNB 3QG5A 4HLUC 4KFTA 4YAEA 3JD0A 1X7WB 3I23A 4G0XA 2O8NA 4IVPA 4JBYA 5TE9A 2OCPA 2GEVA 3UV7A 4TLMB 3NUZA 3T4XA 1CT9A 3WLRA 3DEFA 5CFMA 4KR2A 3ABIA 3ZOZA 4X62B 1R0SA 4GZLA 1L8AA 3EGOA 1JAZA 4EY5A 3CN7A 1SEPA 4M2LA 4Q24A 5DK4A 3TOXA 3ZJYA 4GE0A 1IUPA 3HBMA 2O7RA 3HKDA 2I99A 1VHWA 4KAAA 4Z8YA 2G8LA 2CUZA 1J0AA 4WCFB 1PYDA 1PU2A 3OUTA 2MJLA 2B92A 1CCWA 2GUWA 5D1HA 4CEJB 3P71T 3ADDA 1JXQA 2P2NA 4EF4A 1GG9A 3IBTA 3RT1A 4L57A 1NPDA 4K9KA 1SXHA 2Q29A 3O03A 1QGUB 3OPMA 3FYCA 4E13A 1J09A 3GLFE 1SUEA 4JLDA 5CMLA 4MI6A 3RC9A 3I9OA 1GPNA 1BFDA 2UKDA 1RBQA 4LSZA 1IXYA 2AIRA 2BE9A 1SEVA 1DCFA 2NX2A 3H4TA 1QFMA 3H1TA 1RKQA 3Q40A 4H2DA 3TEFA 1A1SA 2O5EA 1Q0TA 2GVDC 1U9YA 3SF8A 3KKEA 1JR6A 1TEZA 3T3HA 3VA7A 1TM2A 4FFMA 3N8NA 2K7FA 3G02A 3ROPA 3TXAA 4RTKA 3SZGA 5BMOA 1KI3A 4BN5A 4MUIA 4ZEMA 2IX3A 3MQ4A 5GTDA 4X91A 1T9BA 3GA0A 1N25A 3N0XA 1KI4A 2OZVA 3IDFA 4EF5A 3IP9A 4J07A 1P45A 4G0YA 4MAAA 3B8HA 4MWEA 5EL0A 3EWIA 3IVRA 3QI7A 2C5SA 3FFXA 4WKCA 3X1DA 4CDMA 1JS1X 4KLCA 2XT6A 3W1WA 4C0SA 1DRUA 2H9AA 2AVNA 2FN3A 1RT9A 3NHWA 1IHXA 1MJGA 4MUEA 1HT0A 2YHIA 4RSHA 1M6VA 2BV3A 1JKFA 1KJYA 4IDHA 3KQKA 2XAUA 2ZIUB 2HGZA 4F5YA 3CC8A 4XR4A 4PYMA 4TLCA 3IAFA 1GG5A 3CISA 4NULA 1CZUA 2BKAA 4ETMA 2DAPA 1E7SA 3G9UA 4H15A 4DABA 1E9VA 3DUFB 4MQ4A 4ZAYA 1KMMA 1HFWA 5F4BA 3W7AA 4E1BA 4RH1A 5FTJA 2XUKA 3S1AA 4WECA 2FMXA 2NSJA 3LC7O 3OSZA 1T2DA 2GSDA 5D3MA 3O1HB 3J81k 3FWNA 2YQ4A 1N6NA 2PH7A 5LSAA 4JC4A 3BN3A 3SG0A 4ECEA 4W9NA 4EDFA 1TAHA 1CV2A 4JB0A 2X15A 4N01A 3EZ2A 1FFSA 1XEXB 4GLLA 4RSRA 6Q21A 3IMKA 4QFDA 2JGRA 1EPUA 2YOHA 4M53A 2IYWA 4ZVRA 4FFOA 1W6UA 1R4MB 1EP2B 1IQPA 1ZD3A 3I2JA 3PSHA 3JALA 3R6GA 5MN6A 1I7DA 2PX8A 2XIJA 2Q5QA 2OCLA 2W5UA 4XWYA 3UCEA 4P4NA 3BXFA 4YQZA 2BDTA 3NWJA 2ZYSA 5J4HA 3HN7A 4M1EA 3NC4A 3TQFA 3NAZA 3V2HA 4P4SB 2Z6AA 2RGAA 3SR3A 4MDYA 1VOTA 4G8DA 1C3OB 2C8JA 4WSOA 5EOVA 5ABPA 3HXOA 4JBLA 3EC7A 1D09A 4PZZA 1MJ5A 1QTRA 3M34A 4LOKA 1VJGA 2ZKIA 2QS9A 2PS9A 3N6RA 1W2GA 4KFSA 4BVFA 1Q1ZA 3EHEA 3A1NA 1JA0A 5IF3A 2ID4A 4MRMB 2O1WA 3NVKI 1QAOA 5H8WA 4WKBA 3KB8A 4PGMA 4AS3A 2BCGY 1Z5VA 2FVYA 3OZBA 2O0JA 1IWPB 2QP4A 1FFEA 4QUKA 2FOXA 2JI8A 4GPBA 5IT9A 4MUYA 5T8KA 2PZBA 1NOIA 3HY4A 3MF4A 4PRZA 1DGQA 2YIVX 1CLUA 2DTDA 4A0GA 3K6JA 1P9WA 1NNSA 1SVKA 2PYIA 4HWPA 1ZP6A 2J9ZB 3T9DA 5EYPB 1Y4SA 1NP7A 3OE4A 4G0ZA 4Q37A 5TXGA 4UUOA 3AH8A 3DEZA 2IWHA 1MTOA 1LDGA 1ULHA 3EVNA 1NUUA 4AO8A 4F5WA 2DLCX 2XV1A 5CPFA 1EGVB 4ZV9A 2A9RA 1ND6A 3KXLA 4YP9A 1G8FA 5TVKA 3TRHA 1WPQA 4CCSA 4FEEA 3RCBA 2G1PA 5FWYB 1E2IA 3K0FB 3AW8A 1E63A 1P5JA 4NRDA 4DDWA 3MGKA 4TS4A 2RK3A 4RVFA 5FOXA 4QUBA 1N32B 4IZOA 2HMUA 1HOXA 3FF4A 4JLAA 4P31A 4L8YA 3Q2KA 1OFGA 1ZVQA 4PZYA 2GN2A 1MOZA 1WMDA 4IOMA 1S3FA 4O4JA 4DR6B 4FCTA 4XUDA 4EYSA 4WTOA 3DH0A 1WV1A 2J6BA 3L6EA 2IVZA 4YECA 4A9AA 1K88A 1N3IA 2OHVA 1N5IA 5EP4A 5HRCA 4P7GA 1KDPA 2JAWA 1XDWA 2CYAA 1TC2A 2QROA 3B85A 3R5JA 4DM3A 1NVEA 1VL8A 5A03A 2HZBA 4F4IA 1FW6A 3ER8A 1OHHA 3I9V6 4I3FA 1KMCA 3R7WB 3S2UA 4LXGA 3WYDA 2SCUB 4L73A 2EW8A 1U80A 2ZYGA 1CQJA 1YJXA 2OLEA 3IXQA 5F1OA 3TB4A 3DEHA 4N76A 1NIJA 2PE5A 4GMDA 3RUCA 2CNOA 2SKDA 4CKXA 3UFBA 1N34B 3D4OA 1K75A 4QQNA 3S5UA 4R1TA 4Y2TA 4BMVA 3GAAA 3JQBA 4R2JA 1A9OA 1U5BB 4DPMA 3DOIA 4DRXA 3BWVA 2AX4A 5EUBA 3D6UA 2HQSA 3DVLA 4G8BA 4OJTA 4FMCB 1I5OA 3WGGA 1M73E 3QYPA 4PW0A 4GX5A 2J33A 3TDKA 2H2AA 1QPBA 3L7LA 2XQKA 1Z0SA 5CURA 1LTKA 1R88A 1SIOA 4BTLA 4DNOA 3WWEA 3W8FA 5SY9A 3WFIA 2XTNA 4B3GA 3F1LA 1D2RA 1OOEA 3I4CA 2DBRA 1L5OA 1NFFA 1TM4E 5C34B 4YACA 2H08A 1X8XA 3EY4A 3RVMA 4RU1A 4U7JA 3FVWA 5IHXA 2QBYB 3S6JA 2YZMA 3BIFA 4AQYB 2C9YA 1Y5NA 5IYZB 1YA6A 3IE0A 5JCOA 1X9HA 4WZAB 1S1MA 3KKQA 4U7DA 5DHPA 1SD1A 3ZPXA 5BQ3A 4DGQA 5GVSA 4FKBA 1GG2A 3OCUA 2ACKA 3QWAA 4YROA 1G42A 4BAZA 2OCDA 2A1UB 1UBJS 2ATCA 2O57A 3W9SA 4D81A 4EJMA 4EVSA 3VDMA 3ULKA 2BY4A 4EHFA 2CLEB 2NPOA 4EARA 1KY3A 4KBGA 3CX3A 3ZV4A 3H6KA 3WAGA 3KKZA 1MKYA 4KXWA 2IOFA 4UMVA 1QSGA 1XZNA 1OC2A 4R2IA 2JLUA 5SV2A 3ZE9A 3V1YA 3WG9A 2V97A 4R16A 1NJGA 1VBNA 2JCGA 3KLMX 3NHRA 4NATA 1DAPA 4W7IA 3X2SA 1GQFA 5KMGA 1IY2A 3QKSA 4MB2A 4YO7A 2QZ9A 2VHCA 4CMEA 1TQHA 1ZINA 1QGAA 3PQ8A 4U00A 3ZIAA 4B87A 5AJVB 1EUQA 2WMNB 3RC7A 1PGNA 5JXJA 1OI3A 1U9IA 2IQ5A 2XE8A 4YHBA 4KO4S 5JQGF 2YWRA 5BVHB 4GX2A 1P0PA 3DBLA 1V1MB 4Q00A 3S4YA 4DJFC 1O7JA 3S7TA 4KP7A 1J8FA 1S8NA 3B51X 3Q11A 1C3JA 4XPIB 4EECA 4DJEC 3UT5B 1GKIA 4BNKA 1JYFA 3QVVA 4MWZA 4NU8X 4OB7A 2XGOA 2JVJA 1PNVA 2BF4A 4NONA 3GEHA 5LP6C 2P6UA 3TOVA 4H59A 4DWJA 3EZYA 3HFSA 4BHTA 4XVRA 3MCUA 4H1WA 4NV3A 3O8LA 5BURA 5C3UA 1FUKA 4LUCA 2FSVA 4F21A 1JA9A 3W2TA 1K7FB 2VZ8A 1PJAA 3VKFA 2VK4A 4WW0A 4UU1A 2WIDA 1N92A 4O5OA 4CM4B 2JD0A 1N2OA 1F7UA 1K8RA 2ONJA 4F11A 1JEJA 1IWBB 1FW8A 4K2AA 5T8KC 1T36B 3T7AA 5J2UF 5L6LB 3DHEA 3COYA 5B57C 1SIBE 4M0LA 2NXJA 1X7ZA 4CODB 3H8SA 3COWA 2I2WA 5KYWA 3QBDA 4QL3A 3L6BA 4LJ7A 3B89A 1LVUA 4D2IA 2HF7A 3GRRA 1ZM3A 3ZWAA 5JI2E 3AKZA 1W6RA 3HO8A 2V6GA 4TXHA 1ZYUA 2VZLA 2XIQA 4N0MA 1X3LA 3HEMA 2NZWA 3CBQA 1XRNA 1GUZA 4ZJPA 3K1YA 4AI6A 3LI2A 3GGSA 4BLRA 2AOWA 1OI4A 3BK7A 4QGAA 1NWCA 4NV1A 3BE5A 3C98A 2YDYA 1GL7A 2Z2KA 2AUMA 2HI0A 5A3SA 3HCOA 1UZMA 4IIEA 4LBWA 4RFSB 2IHVA 4AF7A 3WWPA 4YCNA 4L02A 1KPHA 3P9IA 4E1AA 1AZWA 2AUTA 3GEGA 2X6QA 1CZKA 5FP0A 3FDJA 2R9VA 2C57A 2PUJA 3PD1A 2C7BA 3QITA 5HBGA 4HS4A 1O08A 4Q47A 4Q3AA 3HI6A 4QDXA 1PQPA 5LDDC 5FADA 5D5PA 4FFSA 4R8VA 1G4HA 1PJ8A 1KKMA 1N1EA 2JRLA 2ABWA 2N3ZA 1ECPA 1CW2B 2CUKA 2VJCA 2XUHA 1W25A 2XWJI 2Y9PB 3FOBA 3HHPA 4OYRA 1OVMA 2ZBDA 2GCEA 3W7VA 1JX6A 2EP7A 1ZN2A 2HA7A 3AJ8A 4PHGA 5B7PA 1I1QB 1T8SA 3H2GA 5K3EA 5DXFA 4AY5A 3KQQA 3U3DA 3JWIA 1QS0A 1IBMB 3T5BA 1KZ9A 1MGOA 2IU6A 2WNHA 1QMGA 3A1EA 3AQ4A 4LNUA 5NLLA 2PFSA 1KDVA 1X7HA 1IMJA 3UUWA 1CS0A 3U1TA 2B4RO 2CLSA 3AR5A 5JPIA 2A88A 4DM7A 3PEYA 1KI9A 1C1YA 1DDOA 3BCHA 3P9CA 2RI1A 4FVTA 4R9UC 3VHXA 4FB4A 2BL4A 4HQ6A 3L1HA 4QOSA 3LX4A 3GROA 4CLHA 2FPUA 1U7HA 2EKZA 1XRLA 2NQ8A 4HQNA 1N0UA 1O4WA 4WVLA 5LZ7A 4EB8A 5K05A 4L0QA 2K87A 1M10A 5DE3A 1OFTA 2V59A 3K0CA 4QBGB 2IYRA 2WEKA 3F97A 4E2YA 3RKSA 1YMUA 1E2BA 4GI7A 4KJXA 1GA4A 3S44A 1KP3A 1AXEA 3BGOS 4BVEA 4CT5A 5J5AA 1H5UA 1NG1A 1Y4DE 2D4AA 3CF6R 3L9WA 3VOAA 2DTXA 2A0FA 1WAMA 2YV2A 4M1SA 5CB4B 4AMZA 1KQPA 1Z29A 5HIKA 2Y2UA 3HKBA 5L7TA 2Z1MA 4J7XA 1MXFA 3CV3A 3PIDA 3HMQA 4DA7A 2FKNA 3FCAA 5JAHA 3L4EA 1KZ4A 3KG2A 3WJ1A 1BXKA 1UM9B 1Z9BA 4ZOLA 1EUCA 1SCJA 4OQDA 3UFXB 1S4MA 2F8TA 3L1JA 4CM9A 3PUKA 1LQUA 1KAQA 1FLVA 1RM5A 2HPVA 3EUFA 4YGXB 2GJ9A 1DQZA 1LWNA 2QN2A 4WAUA 4TYYA 1L7RA 2P3QA 2FPIB 4JSTA 9LDBA 1WDLA 2XITA 3VX4A 1ORIA 2G77B 5DCWA 3THYA 2P9HA 4Q3KA 3ROEA 4MUFA 5TQ2B 1NZJA 2PIAA 3NVMB 2A58A 2K4MA 4P4TA 3RFFA 2HUPA 5JSUA 5KIAA 3OJWA 1SPBS 1V4NA 2Y1LA 3OP1A 3T1YB 3E23A 1WXQA 3G2JA 5T41A 1A4RA 2HWWA 2CV1A 5AIAA 3WC4A 5HCNA 1OJ7A 2JC3A 4X45A 3H1GA 3TOZA 2QX6A 3CWZA 5JBNA 1WS6A 4ND5A 2RIRA 1RRMA 1H93A 1UFOA 3L4SO 1GAEO 4P83A 2IUEA 3RUEA 4AZVA 3GA7A 1DXHA 2J3KA 4Q9NA 4YAJA 1C4KA 3VHXB 1BEZA 1Q1EA 2AW5A 3ZQ4A 3H4IA 1FLAA 4JBXA 1ZWLA 4AO6A 1QJ4A 2GD2A 5F4ZA 2JFXA 3F4KA 1MB9A 3C7KA 1M1YE 2WM2A 4ZALA 2FGJA 1NQVA 1X15A 4MVJP 5K8UA 1VQ1A 4G4SP 1U65A 3GDHA 2UXBB 3N05A 5B3KA 3HVJA 1N6KA 1UCFA 1WQ3A 2WM8A 4HLQB 2YWEA 4MVJA 4OAQA 3HSYA 4DZRA 1YASA 1ZGBA 5IASA 2LCQA 4X66B 3X1YA 5AO9A 1NVKA 2WTUA 4TWZA 3ZVNA 1QH1B 5FL7A 4G01B 4IFTA 4BP3A 3SS8A 3RIGA 1VCHA 2L69A 3HWX1 5H4HA 3MUNA 4AYXA 3AP3A 4AS2A 4IICA 1OU4A 2YFYA 1J5XA 4ETNA 5IG2A 5K9ZA 2FZEA 4R1UA 1TU4A 1TU3A 1UXHA 1G6KA 1W5TA 2FK8A 4YDSA 3OCVA 1NAIA 5LVAA 1OZAA 3V4VB 3OURA 2VBCA 3C3WA 4TPKA 3PVSA 4Q4AA 4I5FA 4UTVA 2BLLA 1CRZA 1BJRE 1X13A 2ZUDA 2P8SA 4GQAA 3SZ3A 2J6IA 4KXXA 1Z62A 4KR0A 3WNVA 4HGZA 4KN9S 1ISSA 2GZSA 3HNRA 5H83A 1F8XA 4IVQA 1P0IA 1HO3A 1Z5OA 4LZZA 2NPIA 4D25A 4MI9A 1MC4A 5LYJA 3RTDA 3WDLA 1ULSA 3ETEA 3PSAA 2FR1A 4UBIA 5JAQA 3OZUA 5KC9A 1NVGA 4XD2A 1CJUC 4F46A 3BD9A 3NRJA 2ZPTX 5T57A 1JYSA 2GT1A 4AKSA 1E5DA 1GRVA 2RGNC 2ZETA 1LLQA 2J0EA 2J3MA 2ZTHA 4MUNA 5EY5B 1PKEA 2JDIA 1MX1A 4AK9A 3T0IA 2VUTA 1JVBA 4PYOA 3AR3A 3TINA 5AJWA 1RI5A 1KRWA 3P9SA 5BYJA 3MOIA 2BEUA 3KT0A 1F2TA 2GYYA 4Y6PA 3TDMA 3DO5A 2HC9A 1RLMA 2RC6A 4C6HA 3HZHA 4H7IA 4JL6A 1J0DA 3N2ZB 2EXXA 4WNIA 4YN3A 4PRKA 2QE7A 3ZZNA 1SD5A 3L84A 3IOBA 1ZNXA 2P5UA 3DEKA 3LPMA 4GYWA 1AO0A 3Q98A 4KU4A 1ZMOA 1IJFA 1TAUA 3WL3A 2PJRA 2O5RA 3LY8A 5GONA 1LCIA 3V3KA 4A0QA 3W5DA 1DDGA 4OHWA 2W6JD 1TMOA 1GPH1 1IG3A 2OD9A 3WGOA 4KMOA 1QH1A 4ROSA 1RMYA 3JQCA 3IAHA 4DNPA 2HF8A 3ZXSA 1XMPA 4XIFA 4D3DA 3GWZA 1NAHA 3RC3A 2I62A 4BVGA 3PL1A 1U8YA 2AE1A 2HCJB 4IYRA 4LRTB 3W7BA 3O8RA 4QGFA 2WYIA 2ZSDA 4S1OA 2EF1A 3PDIA 2REQB 2WWXA 3OQIB 3GZNA 3MJFA 2R65A 4AJEA 5JASA 1VCOA 2OLJA 5JYCA 5K20A 1T15A 1UXJA 2J41A 4EA8A 1EDBA 2GHIA 1WU7A 4WLFA 3WTCA 3PCRB 4CN9A 1I01A 4QO8A 3D8SA 1NG9A 2PJDA 5C1IA 2BFDB 1G5QA 3ZS9A 4E07A 2D13A 4Z0HO 3ABZA 4GW3A 5BOVA 3MELA 3PUHA 1KVUA 4PN3A 1ADBA 1P3Y1 2CVQA 2H1LA 3TTSA 3O83A 1N77A 3NAMA 3Q3HA 2QAJA 1JALA 2FWRA 2Q3HA 4F6CA 1BHO1 4HAUA 4BAUA 5C8VA 3WRVA 3K70B 3LPDA 3W77A 1SBHA 1LNQA 2VF2A 3NHJA 4GEGA 4JSYA 4MIOA 3NFYA 4CQNA 3RNOA 2JA2A 3A6HA 4BMZA 5CA0B 3U7GA 1P80A 2Z3VA 4HNRA 2MWMA 3IO5A 4LYGA 1JLSA 1L7EA 4MR7B 4L22A 1KTIA 4NYMQ 4OK5A 3E70C 3T3DA 2IS1A 4R2LA 2Q4DA 3PUZA 4P58A 5DM0A 4HNVA 3DW1X 4UAUA 2HLPA 3CNNA 1YONA 2ZRMA 4JJIA 1IB0A 4FYWA 2YJTD 4RY8A 2HU2A 7MDHA 4HZUA 1SKQA 4A4DA 5CDTA 4MKIA 3OCYA 4BX3A 1OZHA 2ZQ5A 4AB1A 1TU0A 1V5WA 4L9AA 4IXWA 1H4TA 4YRGA 1RD4A 4HFMA 4JP1A 1YZLA 5B37A 2F1RA 4YLYA 4NBUA 1XN4A 4BRUA 1BGWA 2HRDA 4YAWA 3CY6A 1YOBA 1GU0A 2H92A 4MICA 2VHVA 3Q7IA 4ZVPA 3R0IA 3I5AA 1RQXA 1DC5A 3B6ZA 2GJ4A 4FS8A 1BEUB 1T5IA 1W73A 1QK3A 2AOVA 2QDKA 3CUTA 4GPD1 1YS9A 4P34A 4Q3BA 3PL5A 2LKDA 2V7VA 3G88A 2N1BA 2ZJ8A 5DBOA 1KGSA 4BWGA 1JNXX 2QLBA 3LECA 3LQ2A 2Y66A 4RCVA 1U7ZA 2ILVA 2OV2A 1MXHA 3ND6A 4ZOEA 1JL3A 4BX9A 4Z4HA 5DGDA 1KJZA 2NAPA 5T5QA 1J9ZA 5LOVB 5EMHA 2IUSA 3BWCA 2FWPA 3K70D 2ACEA 4RVSA 4ZT7A 4HPWA 1E64A 3OJ0A 2XMCA 4P3NA 1K27A 1U28C 3ZY4A 3HO1A 1NE2A 2OBBA 4E2WA 2QRKA 3V34A 3EDOA 1J39A 4FZ3A 5BR8B 3OA0A 4KDFA 5M5BA 4RJTA 3TSYA 3OFND 1N1MA 3SZMA 1X1DA 3BL6A 1EK0A 2B8WA 4ES6A 2LR0A 1S5PA 3R44A 2PUCA 3UT5A 1X80A 3TUZC 1I8TA 1T5DX 1PS8A 1N5OX 4GR5A 3RASA 2UZ1A 3RHZA 3NHSA 3WLEA 2PWYA 2ODTX 2QEQA 3DDWA 4OHUA 4E33A 5GIOE 3I2GA 1ZHOA 1QOQB 1A5BB 2JLSA 3OHMA 2V0NA 4R2MA 2O0MA 2JARA 4DYDA 4B4KA 2GQ0A 2OHXA 3CVVA 2FCAA 3FCCA 4LZAA 3DCJA 2YKGA 2C2XA 2Q9BA 1LNZA 5BWCA 4TYWA 2HA6A 3AIIA 2EDAA 2I6XA 3QFSA 4KEAA 4MUAA 3PITA 3I1YA 4HKTA 4NAVA 3OSUA 1R10A 5EMNA 2ZULA 1ODKA 5HTKA 3Q4GA 4DBVO 4EQZA 1L7PA 4BO5A 3GW8A 4Z9YA 3D2AA 1DEHA 1PCXA 4BB9A 1KR2A 3NCTA 1IPHA 3U4IA 1W0KA 3UXYA 2G5TA 1HURA 3ELDA 4R0VA 5BV2P 3RUFA 1FMFA 4TXLA 2B20A 3GHYA 2YIJA 3PICA 3VSDA 5L3SB 1NIPA 4WIAA 4YCBA 3VYUB 1G9TA 2E6KA 5IVIA 1UP6A 1ONNA 4BMDA 5AKEA 4YJHA 2GILA 1UZUA 5CD1A 1P61B 2QL6A 3RVDA 2A7XA 2PZEA 3AIOA 3IDOA 5I5EA 2J07A 1NYQA 3OLVA 4YP7A 4F2WA 1JHAA 2ZR8A 2XXAA 4KPGA 4JT4A 1GUFA 2RGUA 4A0FA 2VPWA 3ADKA 1ZM7A 2Z4SA 1QKKA 2OECA 5CVUA 4JQYA 2RONA 3K6SB 1AKMA 1M6NA 2R00A 2C9ZA 4IG4A 3RFTA 4YWHA 1X70A 3KZCA 2E21A 1CVRA 2C95A 4PXSA 2C8KA 2EX0A 3PWTA 2RARA 1ISIA 1Z36A 2ZWVA 4JH0A 3ADCA 1U5BA 2PKYX 1DELA 1PYGA 3GF4A 4QJ4A 3VNVA 2NU6B 1E1RD 2V7GA 4OFZA 1N57A 3AYXB 1EP3B 1OWLA 2DY0A 1NBAA 1E2PA 2W93A 1OXXK 1R0WA 2WINI 2X13A 2ZR9A 4WXPA 4POOA 5JYEA 2Y1CA 2NV0A 2Q2QA 5CLHA 3PQEA 3IPRA 4LYFA 2W6PA 1Y9JA 5GOTA 5LZ9A 1U4NA 2Z98A 4YRLA 5E7MA 2A57A 4HY3A 1SZCA 2PTGA 3ICOA 2CMFA 3D5EA 4LI0A 2X9NA 5GVRA 3WLPA 3PTAA 3MSXA 3FPCA 1F7VA 3ITKA 3UT6A 1GSOA 1JT2A 3EVAA 1FSPA 3BFKA 5HOEA 2PFGA 1ANKA 4K9OA 4QBTA 5DM60 1V7ZA 1WKVA 2D1RA 5AW8A 1GPLA 3ZD6A 3AF1A 4D3SA 3AHEA 1PUXA 1Z06A 3CLKA 2QJRA 4JA0A 1JJIA 5CT9A 3HZZA 5JC8A 2PUFA 1DFIA 3ZWPA 4BVAA 3QU5A 5DDIP 4YUVA 3IUSA 1WB4A 3CT4A 3EXIA 1JLKA 4WY8A 5CDUA 1WZNA 1TVKA 3S81A 2C1ZA 1YVDA 3AEYA 3W9BA 4DMUB 1QFZA 1YDHA 4BL5A 5AXDA 5IDWA 3A0UA 1MX9A 4BO6A 1SKYB 1USKA 2B5WA 3UF0A 3NYRA 1KU0A 3H4MA 1TM5E 4EFKA 2P4QA 1VSTA 4R1OA 2PMKA 2OXRA 2Q6OA 4IGEA 2ZQYA 4Q1BA 5A4FS 4ZGWA 1H1LA 1DJOA 3ZBQA 4YDQA 2GBIA 3N5CA 1MB0A 1NXOA 4KVZA 1UBFA 1WZ2A 3I04M 3VJRA 2DC1A 3L49A 2WWRA 3FH0A 3BH6A 3HWSA 4F2HA 1SHTX 3QFHA 4F6LA 5BYAA 4RESA 3DVAB 3HU2A 5CPBA 2C7GA 3H5NA 4NBVA 1QUFA 1U8EA 4CR6A 1P4RA 1SFRA 2V9PA 3HCWA 4X44A 3UMBA 2HQRA 2VQSA 2QTHA 3QFTA 1AKQA 4RCYA 4YT5A 3A04A 1E4EB 1PQ4A 4G65A 4NJEB 5TEWA 4DA9A 3KOWA 3QEMA 2VHWA 1CY6A 2VA9A 2JGDA 2OGWA 3DE4X 4XD7D 4FJ1A 1Z88A 1HFJA 1VP3A 1GRRA 2DX7A 5KAMA 1KS2A 3CQ9A 1XEXA 2R0QC 1UBEA 1ZJ5A 3HJUA 3I39X 1F2UA 1DQYA 3RAJA 2VIIA 5IDYA 1CF2O 1ZZGA 2JKYA 2WHPB 2ZRQA 2H31A 3BICA 2GA9A 5CHYA 3WK5A 4BTVA 2JGKA 3IBFA 1GNPA 3U6KA 3L4BA 3W06A 3QEBZ 4L3OA 3CF0A 3PLNA 1CQJB 2J9GA 1EBFA 2W4IA 1E0SA 2X86A 4EH1A 3BEOA 2R8ZA 3SSAA 1FRZA 3U2QA 4QVIA 2VYND 4Q4HB 1EK6A 1DRKA 2DWOA 1F5SA 2DOKA 4HJRA 2OBXA 3AQIA 2BR5A 1XMIA 2R84A 2Z83A 3MSCA 4LS3A 4K6CA 4X24A 4EEKA 1UBSB 2NTNA 3PFCA 1T6NA 1YJ8A 3FCUB 3JRWA 2BE7A 4AJLA 3DMRA 3KTDA 2XF2A 3ZLVA 3GMTA 5IDVA 2XCLA 4IDPA 4HDCA 2O1EA 4EQ6B 3MMNA 4IVRA 4X3OA 4WKNA 4G1VA