5HTOA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1 (tetrameric ldh in an asymmetric unit)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
302
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
total genus 113
structure length 302
sequence length 313
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5htoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5htoA02
3GY0A 3PXXA 3H65A 4AJHA 2VT3A 4OMUA 5EESA 4NG5A 2NU6A 4R01A 5KVSA 5JPIA 4FN4A 4DL9A 4PLGA 4W82A 4OL9A 1TI7A 3B70A 3H3FA 4RVDA 4YQZA 1A72A 4BQRA 2VRCD 1C1XB 3CMCO 1A7KA 2W98A 4GLOA 3GN2A 4YT8A 1PS8A 1X13A 5CDUA 2YHIA 4XEHA 4J16A 5CDTA 4J9UE 1PS0A 1XIVA 3IP3A 4BO9A 2YV1A 3IL2A 4CMKA 1U8XX 2DUUA 3TQHA 2OFPA 3U09A 1GYRA 2AG8A 4NK5A 2PWZA 3VVCA 1T1RA 1E6UA 4MVJA 1U4SA 2I66A 4IS2A 5CEJA 1VSVA 3WTBA 4ZU3A 1GY8A 3O4RA 5JDCA 1HDGO 1YL5A 4IQ8A 4KOAA 4EUFA 1E3IA 4RF2A 2AE2A 4TKMA 2Q3EA 4BO4A 1Y9EA 1B7GO 2Q49A 3PWKA 1U3VA 2PZLA 5B4TA 2PZMA 5DP2A 1RWBA 2DBVO 4CM7A 3L6OO 2YDXA 4A0SA 3ETGA 4E30A 5ENDA 2FZEA 3DO5A 1IUKA 4AJEA 3DZIA 1N2SA 1Z73A 2F00A 5J23A 1E5QA 3P2OA 4JJGA 3TZHA 4AJIA 3NT5A 3STHA 1HLDA 4AG3A 1KEWA 3ZZNA 5CEFA 4HADA 4A7PA 1H6AA 3F1LA 3HZZA 2ZB7A 1LI4A 4FQ8A 5FYDA 2ZB4A 4XIJA 1V3VA 4FJ1A 4GMFA 4O5OA 5K9ZA 4NR0A 1B14A 2Q2VA 1UXJA 5KJ6A 2FR8A 3BHIA 2EWMA 1BG6A 5ILGA 4XGIA 3V2HA 4CM4A 3ETEA 1P1JA 2JHFA 4EBFA 3GVHA 3Q9UA 3MJTA 3BHJA 5DULA 1E7QA 4U6SA 3ZW8A 1D1TA 1DJQA 2JAHA 1U1IA 4Q3CA 4UEKA 5IZCC 3E5RA 2I99A 4YVFA 1PWZA 2ZIZA 2D8AA 4QFCA 1G6KA 1YONA 1DIGA 5DP1A 1HETA 2RBEA 3DHNA 4ALKA 4IXWA 1DRUA 5CDYA 5HS4A 5I9LA 4WLOA 4YJGB 2RHCA 4MKXA 4WPGA 5TGDA 4CM9D 5BSFA 2V6BA 1VKNA 5ER9A 3TNLA 2QHXA 5C7OO 4U0JA 2WD8A 3B1KA 2EEZA 1KYQA 2NU8A 1WDMA 1VJTA 1X14A 1OOEA 3DXFA 4MIOA 4DBZA 1Y1PA 3W4KA 1AXGA 3JQ9C 5IDWA 3PLRA 3I3OA 1LU9A 3I4FA 3MJ4A 3SLGA 4N5NA 2DTDA 2IYPA 4UUPA 3WYEA 2C2YA 2BMAA 3QVXA 2ZB8A 2O48X 5ICMA 1GCOA 2OL4A 3AFNA 1GEEA 4MOWA 1LSSA 1TVEA 2DPHA 3W4JA 1TT5B 1IYZA 1N8KA 1C3VA 2EF1A 3WDSA 3SVTA 1AN9A 4CUZA 1LRJA 2XOXA 2E48A 2BFAA 3H9EO 2PD3A 1U2GA 2RH8A 1TEHA 3V2GA 5L4NA 2CMDA 4OXYA 4P8RA 1DC5A 4LK3A 1DAPA 3E9NA 3SJ7A 2OORA 5F5LA 2H1SA 3OP4A 2ZK7A 3DOCA 3D4PA 4N18A 1BGVA 1MC4A 2BHLA 1NQTA 3MWEB 1ZK1A 2HKIA 1B15A 1Z7EA 3U4DA 3DTYA 3H6KA 2RIRA 3JQ7A 2JFGA 1I33A 4R1SA 4W9NA 4QTZA 4FFLA 3EMKA 2CUKA 1XR3A 2DFVA 4QO7A 1DSSG 3WSVA 3Q3CA 1I2ZA 3G79A 4U7WA 1BW9A 3GC6A 1JA9A 3NGLA 4IBOA 3UCEA 4B7UA 5G4KB 3GPDG 1U28A 3TJRA 1GFSA 2AHRA 2CDBA 3HSKA 5ITVA 1DPGA 1ADFA 1ENOA 3G0OA 3K6JA 1DAOA 3PIIA 4H3VA 4TQGA 2DUWA 4BNIA 3GMDA 4J0FA 4RF3A 4A03A 1ID1A 3ZWBA 3OJ0A 1UZLA 1B8VA 1WDKA 3DEYX 5BNIA 3RAJA 2D5AA 3OICA 2I6TA 3ENNA 5JAMA 3PGXA 4TZTA 4XA8A 2Y05A 1IULA 1WZEA 2Q45A 2VWQA 3EHEA 4OSOA 3GFGA 2DBZA 1VM6A 4FIZA 2Y93A 3W4IA 5FI3A 3G3EA 3M1AA 1A4IA 1WDLA 3FNEA 4R5MA 1R0SA 4ZVVA 5MDHA 2B83A 3H9QA 1GUYA 3D7LA 4F45A 4UVGA 5L7YA 3GAFA 4Q9NA 1KIFA 3UOGA 2NVUA 4IDAA 3BMNB 4FOOA 4YJHA 1DIHA 1TT7A 3E8XA 4AJKA 1UXHA 3ONDA 1ZEMA 2QQ5A 3GHYA 1ZBQA 2YFQA 3PDJA 4YCAA 4YT5A 5JFOA 4PGFA 5TX7A 4FC7A 4OH1A 2WSBA 4JP2A 4E6PA 1PL6A 3MJSA 3AUTA 3AK4A 3F6YA 4XRRA 1UXIA 4LCJA 1UUFA 1P0FA 4NH4A 4QFDA 3BAZA 4FDAA 1Y6JA 4Y6RA 4I5EA 4CMAA 4E21A 3RFXA 3W6UA 4DIBA 1SNYA 3U5TA 2PFGA 2HUNA 2X7HA 1EK6A 4XYGA 3T7EA 5T8KA 5FEUA 1H2BA 5A3VA 3I9LA 4XB2A 1W6UA 3RUEA 1GEGA 4UULA 1YKFA 1C0IA 2I5PO 4IDBA 3RUHA 1H9AA 3F3SA 5DN9A 3WWYA 1O8CA 3EW7A 4J91A 1BDBA 3LDHA 2IE0A 1YJQA 1DO8A 4O6VA 2NUAA 1UAGA 3ZWWA 3EVNA 4B3IA 4FFRA 3P5SA 1QYVA 2I9PA 4UEJA 2C5AA 4JXKA 3WYCA 2I3AA 2Q46A 3MTGA 3N74A 3CKYA 3RUIA 2VHYA 3VPHA 4GI2A 4DRYA 1EE9A 5BSEA 3IS3A 4CLDA 4NNJA 3ZV3A 4DWVA 3FHLA 2GZ2A 1V0JA 3CPSA 1HSZA 4CMEC 1TA4A 1NVMB 4RORA 3WGQA 3I5MA 1U8FO 2DFDA 1QP8A 2PGLA 1ISFA 2WYVA 2PTGA 3GEGA 3M1LA 3OIDA 2E4AA 4MP8A 1CQIA 4XX0A 2OHXA 4YB8A 4E5YA 3WFIA 5CPFA 3OFSA 2XXBA 3JQFC 2Y0EA 4A10A 4R54A 3ZCXA 1Q7CA 5A4DA 4R41A 3B1JA 4KWIA 1XU9A 4WCFC 4AJNA 1D7OA 1CQJA 1YGYA 1X15A 1C0PA 4NI5A 4R1NA 4AICA 1NPYA 3WIEA 1UDCA 2EHDA 1KERA 1B3BA 1MXHA 1P9LA 5TRTA 1BVUA 2TMDA 4ND5A 2O2SA 3BYZA 4WECA 5A9TA 3WB9A 4A2CA 4D79A 3K2BA 2NQ8A 5B1YA 4CMIB 1UR5A 3Q2KA 1BWSA 1PJLA 1G1AA 3QHAA 1TXGA 4ITUA 3FF4A 4WE3A 1RM4A 1HYEA 3INTA 1ADCA 2P4HX 3MOGA 1U9JA 1IY8A 3INRA 4CM3A 3HG7A 1JDJA 2JCYA 3HDJA 4BGUA 1YL7A 2DBRA 4DMMA 2EXXA 2VWGA 2Y99A 3N7UA 1HT0A 2X5JO 1H6DA 1MFPA 5TJHA 4CLOB 4PFJA 3CXRA 4XIYA 2P9CA 3RU9A 2HLPA 3ASVA 1YQDA 1ISHA 1T1SA 2FRDA 5T67A 4MVJM 4BNJA 3TL2A 1PJTA 3FI9A 5TC4A 4IGFA 2BGLA 1LLUA 4W4TA 2Z1NA 5L51A 1U7HA 3JYNA 1X1TA 4HFJA 4UUMA 2C54A 4UVIA 3JD0A 4P38A 3LSYA 1LBEA 3KSDO 2FSVA 4E12A 3IIEA 4WOKA 1YBMA 4UVDA 1NBOA 1NPTO 4I9HA 4FD3A 2JD0A 4GPD1 3F47A 5G0UA 4RPKA 1HE3A 2WTBA 1VKOA 4BO8A 5IFLA 3GDOA 6LDHA 1E77A 2PZJA 4CLRB 1Z45A 4B8WA 1P31A 1SC6A 1LSOA 4EEXA 4MVJE 4XWYA 4DQVA 4Q3NA 4DLBA 1WAMA 1KETA 3TOZA 1LDBA 2AXQA 3ZWCA 2WMDA 1XG5A 1NX6A 2BFMA 4IJWA 1PZHA 2FPGA 4HFNA 3AFMA 5JY1A 4DUPA 1M76A 4XGKA 3GGGA 5K6AA 1EQ2A 1EVIA 2Q1WA 1X7HA 2X58A 1ZH8A 1PGOA 1P1KA 3KV3O 4I8XA 4HX5A 2C7VA 3AI2A 4HFRA 4BNKA 2VYVA 4U6QA 4E2ZA 2HU2A 5AXCA 3AY3A 5A03A 4OIMA 2QG4A 4W6ZA 1MLDA 1KY4A 3AW9A 3I52A 1SEPA 3CIFA 2Y66A 3LK7A 1E3SA 3CTMA 1HLPA 3DBHB 4HP8A 1P1RA 2O7QA 5A05A 4DMLA 5A9SB 2VT2A 4II2A 1CJCA 3L0DA 4ROSA 3PIDA 3O38A 3TN7A 3FNFA 1N7HA 5AQ1A 3KYBA 4LMPA 4MVJD 1Y81A 4CL8A 2OBYA 4XR4A 3ASUA 2EW8A 4E5MA 2H9IA 3WBFA 2CFCA 2VHVA 2VWPA 4N54A 4Q39A 3S2EA 4ZICA 3L4SO 2R00C 4PLFA 1BDMA 4EJ6A 3JQ8B 4B8ZA 4ZGWA 1EE2A 5IDXA 2NQTA 4NFSA 2AQIA 2X5KO 3TDKA 4E5NA 3L6EA 2VTEA 3PVZA 2J5KA 4RVGA 4BVAA 1NP3A 2EJWA 3GQVA 4IINA 4KUGA 1I8TA 4LMRA 4XYBA 2IDZA 3RJ5A 5B12A 1PJBA 3E03A 1VLLA 3ITKA 1ZSYA 2A35A 4BV8A 4YAEA 1BRMA 1Q0HA 2WYUA 3DZKA 3SC6A 4IJUA 5THQA 1KEPA 1GYQA 1UDAA 1P1IA 1ZUD1 4ND3A 3UUWA 3GPIA 1ISGA 4OJNA 3OHSX 1EVZA 4CR7A 1R37A 5HBRA 1M6WA 3QWAA 1QLHA 2NV6A 4JQCA 1BVRA 1FF9A 3ONEA 1OI7A 4ND1A 1VI2A 3DBRA 4IZIA 4JLWA 2HJRA 1QR6A 3BMCA 5COQA 1PJ4A 1DC6A 1WNTA 5T6BA 4DIOA 4AVYA 1ZJYA 3HQ4O 2EGGA 3D4NA 5T64A 1D8AA 2VTDA 1NM5A 3CSDA 1I01A 1DIAA 3LT4A 1C14A 3D5QA 3E9QA 5GZ6A 3KRTA 1C0KA 4CM6A 3H5NA 4TRRA 3I1JA 1XEAA 2EKPA 5EN4A 2AEMA 5F3RA 1SB8A 2NADA 3I4CA 1IE3A 3QP9A 4FGWA 4CPDA 3Q9NA 4CQLA 1MP0A 2ZQZA 1H0KA 1UXGA 1GYPA 4JCOA 2JD1A 1ZJZA 5L7WA 1NHGA 4GVLA 5GMOA 4BNTA 4EGFA 2BFOA 2AQKA 2BRUA 2X22A 4AJJA 4J90A 1ZNQO 3GDFA 1GV1A 3KYDA 5L45A 2ZJ0A 3DL2A 4DPLA 2IZ0A 1K2WA 1KVSA 4OGWA 3H9GA 1N5DA 2C7GA 1HE4A 4N5LA 2PGDA 4BO7A 3V5NA 3RUAA 4K26A 5IJZA 4YACA 4U0KA 3CEAA 2Y1GA 4LRTB 1KEVA 3ZW9A 3WG9A 4HY3A 4I5GA 3RJ9A 5C7IO 2BGKA 2D2IA 2VHWA 3QWHA 1XSEA 5TLSA 1NTOA 3RASA 3HNPA 1JTVA 4KUHA 4YWJA 4WNIA 4RLHA 1KEUA 2O4UX 1HTBA 3WICA 4PG8A 3C3XA 4JIGA 3WNVA 1GD1O 4JROA 5A3JA 1IZ9A 2HRBA 3F1KA 1DC3A 1M6HA 4NK4A 2YV3A 4FC6A 2DLDA 4NBUA 3AUAA 1R4MA 3ZWAA 3U62A 2EGHA 4NJMB 2YJZA 2DU8A 3ZNQA 4HNHA 4YA6A 4BKUA 1CYDA 1Y8QA 4FW8A 3G1TA 3HDQA 2P5YA 3VPSA 2P9EA 4CQMA 4J1NA 1DEHA 1G0NA 4JGBA 5TT0A 4XD2A 3JD1A 2IEDA 2X9NA 2AEFA 1EZ4A 3FCOA 3FBTA 5JE8A 1K89A 2WM3A 3ICPA 5DZSA 4LRSB 2G1UA 1HF3A 5JY6A 3UVEA 1MA0A 4CMHA 2X4GA 1P33A 5TNXA 3AU9A 2GYYA 4CMCA 3DTTA 4F3YA 4DC1A 2O3TA 1ENYA 1A5ZA 1DFGA 1PJSA 3EZLA 4RVSA 1CERA 1QLJA 5BNTA 2B69A 4J3FA 4LVUA 2OXIA 3TFOA 3TF5A 1Y8RB 4J4HA 1PZFA 1EVYA 3EC7A 4E32A 1X0VA 2GN4A 4J4BA 2OOSA 3WYBA 3K2EA 3NTQA 2QZ9A 2O3RA 2NVWA 2TMGA 1NFRA 1UP7A 2X5OA 3OQBA 4UUOA 1YXMA 2CD9A 4NBWA 5LCXA 2ET6A 1QKIA 1L1FA 4YT4A 4QEDA 4YJFA 4BIIA 1HYGA 4G65A 2O3UA 3DBLB 5JAZA 4HKTA 4YEDA 2P91A 2D59A 2DBQA 3V8BA 3QSGA 1HDZA 5GY7A 1PJ3A 3VH2A 4J1SA 1F17A 4JBGA 5JDIA 3O8QB 1LLDA 1WWKA 1XWFA 2Y1CA 2XAAA 3GVXA 3ZH2A 4HFMA 3JQGA 4OOFA 3RBXA 1KY5A 2XF8A 3GDGA 3VPFA 4B7XA 4Q3DA 5L95A 3S2GA 5JBIA 3AY7A 4TSKA 4IIVA 4RF5A 3ROMA 3M2TA 3CE6A 2WD7B 3F4LA 1GQQA 5DCWA 2HJSA 1SB9A 3BMQB 3FR8A 1ML3A 1YOVB 3JQ9A 1C1DA 1YB1A 5DF1A 2GO1A 3ZU4A 4GWKA 1P74A 1N9GA 1PIWA 1DC4A 3VH1A 2H63A 3IJPA 4LCEA 4IZHA 2D5CA 4IS3A 4DQUA 1W8DA 2G17A 1MG0A 3KEQA 2GPTA 2XPCA 4TRMA 3U0BA 3A9WA 1XA0A 4GSKA 2RAFA 2X8LA 4ND2A 3ZGYA 3WMWA 3PYXA 4K6CA 2GCGA 2J6IA 5HRUA 2AMFA 3WS7A 1MUUA 4PZEA 1E7MA 3F9IA 3JV7A 1GZ4A 4WJZA 1DXYA 4YDRA 3DZFA 4CV3A 3AM3A 4M89A 2W2LA 1DLIA 3RUCA 4BNGA 2Z95A 3DZBA 1JAYA 3ZHXA 3TWOA 4MJLA 4BO5A 1LSJA 4PG5A 4GH5A 5G0WA 4RF4A 3PHLA 4WKGA 3LC7O 3GZNB 4J7CA 5JAIA 1DRVA 2GLXA 1V3UA 1LDEA 2GERA 1YRLA 4JJFA 2Q4BA 2ZJ1A 2VHXA 3LT2A 2NLOA 5I7EA 1LC0A 3GGPA 4Y9DA 5JMPA 2W2KA 2UAGA 1ONNA 5COBA 1E7RA 9LDBA 4R1TA 1N92A 4F6LA 1ZK4A 4J2OA 4AJ4A 1YBVA 1X0XA 4J49A 4WK6A 1LQTA 1ULUA 3DOJA 1EBUA 1PSDA 1XDWA 1I36A 1E1KA 1PQUA 4PLVA 3ANNA 3OIFA 1J5PA 4IGEA 3RCBA 3IJRA 4J9VA 4Z9FA 3JQDA 3W1VA 4E13A 3PQDA 4A27A 3S1LA 1LDYA 1YBAA 3U4CA 3QE3A 3NJ8A 2B4RO 1JU9A 1E5LA 3HFGA 1CEQA 2JAPA 1ARZA 3WQSB 2EG9A 2JCVA 1FXSA 3SBOA 4MINA 2YHIB 5DOZA 3VTZA 3AOGA 3V1TC 3AI1A 4D7AA 3PQFA 1B16A 4R69A 3G49A 1H2HA 1U2DA 3OM9A 1P77A 3AM4A 4RO0A 1GADO 4QECA 2Y1EA 4P4NA 4BKQA 1AXEA 4LSMA 5IG2A 1E1MA 2YQ4A 1EQUA 3PHGA 3KOUA 3H9JA 4RZHA 1F06A 3WBBA 5EERA 1I10A 1RPNA 3DZJA 4RCVA 4BNFA 2JD2A 4J1QA 4DLAA 2B4QA 3WXBA 2YUTA 3WNQA 3I6IA 3NGXA 1DB3A 4WNCA 3EVTA 1EDOA 2I67A 2Q4EA 1DDOA 3LT1A 4B4WA 3ZHYA 3C7DB 3RBVA 1GZ3A 3H5RA 3C1AA 3BTVA 1VJ1A 1PL7A 3ZU5A 4PG7A 1AHIA 3DHEA 1WLYA 3ENKA 3GNQA 3I9KA 3JYOA 4CMGA 5BNFA 4IMPA 4IY1A 1LDGA 2IYOA 4CMBA 2VYND 4TRJA 1V35A 1BXZA 7MDHA 2WYWA 1WZIA 2HK8A 1OBFO 3PHJA 2GDZA 4OQZA 1EMDA 9LDTA 3I23A 3WGOA 3BZUA 1ONPA 3L6DA 3QLJA 4K6FA 3VPXA 5JMWA 1ZKMA 1GU7A 4W99A 5FF9A 5CFZA 3LZ6A 1PGNA 5KTKA 1E3WA 3VHRA 3ZHZA 3JQCA 2ZTUA 1DIBA 2PA3A 4CM4B 4DREA 1NHWA 4IQ0A 1E6WA 1BMDA 3GAZA 3Q11A 3QVWA 3WWZA 3WLEA 4AL4A 2B5VA 2FOIA 2GZ3A 1YB5A 3FRJA 4PLTA 1WXDA 1E7YA 4WCFA 4XCVA 1KVTA 2Y68A 1B26A 5GZ3A 3ADPA 4MP3A 4XGNA 1IB6A 4EI2A 4BO1A 3LLSA 1DIRA 2QYTA 1KOLA 1DHTA 4RPGA 4Z0TA 2OUIA 3FWNA 3OIGA 5F21A 3DZGA 1PL8A 2X0NA 4O1MA 1PS9A 1J49A 1IPFA 4CR8A 1BSVA 1K6XA 4IDDA 3OEYA 1E6EA 5EQDA 1FDSA 1YE3A 2EW2A 5BT9A 5IAAA 3JYPA 3D5TA 2J8ZA 2IZZA 1BXKA 1E7WA 1I0ZA 4J0EA 4HV4A 2X0IA 2Z1MA 3BTOA 5T57A 3S2IA 1KVRA 3EGOA 2G82A 2GD1O 3LC2O 4PLPA 3KYCA 3SC4A 1MXFA 5DDIP 4RDHA 4BHTA 2GGSA 1E1LA 3KXDA 5C5IA 1SPXA 2J3IA 3FSRA 1M75A 5KCZA 1Q1NA 4OM8A 4BMNA 5CG1A 1H9BA 2CDAA 3M2PA 4OKIA 3D3WA 4XR9A 2HK9A 2AE1A 2YZ7A 1FK8A 2ZTMA 1Z6ZA 4FFNA 4PRLA 4PZCA 4C7KA 5AXAA 3ZWVA 4EEZA 3WGHA 1XKQA 1MV8A 2P5UA 4I5FA 3ZWYA 1I2CA 1UXKA 2GF2A 2Y1DA 4MP6A 5EL0A 1F8GA 4CM5A 5LDHA 5KVQA 1QYWA 2P4QA 3GZ4A 3JQ7B 3I9OA 4H15A 4OO3A 3PRJA 3UICA 1I5RA 3MJVA 3QVTA 5JNLA 1QMGA 3DBVO 2FSSA 3C1OA 3HHPA 3UHAA 3ULKA 1SOVA 2J3KA 5DBGA 4DPMA 1BW9B 2CVOA 3B1FA 1QV6A 2YY7A 4X54A 3AOEC 4MVJF 3T7CA 2FR0A 8LDHA 4CV1A 1GPJA 3H3JA 1QSGA 2Y0DA 4MO2A 4HBGA 1JW9B 1ADGA 2CSUA 3BIOA 3SEFA 1R15A 1HZJA 2Y1FA 4W9NC 2ZYGA 1ISIA 3UXYA 1SCUA 1J0XO 1GAEO 4ZQGA 3WGYA 1I3NA 1N1GA 1NVGA 4YAIA 1IL0A 3E5MA 2O4CA 3C7AA 4OQYA 3NT2A 3IOYA 4B4OA 2PGJA 2POQX 3R1IA 4IJKA 2V6MA 3OMLA 3U4IA 1PGJA 4OSPA 4R68A 1Q7GA 2GN9A 2CNBA 2W8ZA 2NVUB 4QX6A 1RJWA 4YJHB 2DC1A 2NTNA 4D43A 3VZPA 1PGPA 4HWKA 4JBHA 3ZU3A 3TZCA 8ADHA 3ZHBA 4D42A 1ISJA 3JQAA 2QYSA 5G0VA 2NM0A 3ON5A 5JXWA 4CUKA 5LC1A 3WFJA 4Z3KA 2R00A 2HMTA 4TMFA 3X2EA 3DDNA 1UDBA 3OF2A 4CM8A 3LVFO 1AHHA 1H5QA 3W6ZA 4E0BA 3ROKA 3KHUA 1E92A 5L4LA 2Q2QA 1PQPA 4INAA 4R5HA 1PZEA 1NWCA 3HB4X 3INGA 1QV7A 3JSAA 4CQMD 2UUPA 2VZ9A 5U1PA 4BO2A 3WGIA 4XKJA 1SEVA 2UV8A 4BGIA 4EZBA 1X7DA 2FY8A 2E37A 3H8VA 5GZ1A 4RGBA 1ULSA 5IDYA 4Z3DA 1EUCA 2QRLA 4WGGA 1MFZA 1SMKA 3PJFA 4KDEA 2LDXA 2D3TA 3TFQA 1R4NA 2UYYA 3QVOA 1JWAB 4PIVA 2IXAA 1LLCA 3RFTA 1V3TA 5I9MA 3TSCA 3NT4A 3VAZA 3FNHA 3VDQA 1PU2A 3BMOA 5IN5A 5I7VA 4ONEA 4B4VA 5A06A 3UH1A 3H4VA 2NVBA 3CH6A 2DTEA 3KM0A 4IDCA 2Q99A 1G0OA 4XYEA 1LC3A 1MB4A 2ILTA 4FFMA 5JC1A 3KB6A 2Q1SA 1IHYA 2O7SA 1QYXA 5C7LO 3GRPA 1DFHA 3OSUA 1HZZA 3EZYA 3DONA 1U3UA 3DHYA 4KQXA 1UP6A 4RQUA 1JN0A 1OAAA 2G0TA 3DMTC 3QRWA 3V1YA 4BNNA 4O63O 4BQPA 2R2GA 3NX4A 3OEWA 4Z9XA 5BSGA 2Q1TA 3FTPA 1ZK0A 2OBNA 3UKOA 4ZN6A 3U4HA 2E6UX 4AJOA 1N7GA 1FDWA 2J5QA 4JP3A 1BHSA 5EIOA 5DBIA 2AW5A 1GQYA 4ZA2A 4IDEA 4RVFA 1GL3A 1V8BA 3P7MA 1ORRA 4M1QA 3T4EA 2VUTA 4L76A 3NDIA 4E5PA 1O89A 1Q0LA 3FPCA 3GG2A 4Y67A 4MKZA 1NAIA 2IEBA 2WWRA 2IXBA 1TB4A 2DTXA 4YRBA 1ZW1A 4RPHA 3H2ZA 4WLUA 4D46A 4J7UA 1R12A 2PNFA 3KSZO 5AOVA 4M87A 4P4LA 5L53A 5ER6A 2PLAA 4II3A 3RC1A 2V7PA 1I3LA 1I3MA 3I9JA 1VE9A 4E4YA 3P2YA 2OMEA 4TVOA 4Z0HO 3WR5A 4F46A 1BXGA 4Q3EA 4I9UA 1U3WA 3DAPA 3OJFA 5A1TA 5KJEA 5IF3A 2VOEA 2QZZA 1QORA 4OOEA 1FMCA 4L73A 3DMYA 3UF0A 4GAEA 3FPLA 3PWSA 2BLLA 2I3GA 1FDUA 2ZTLA 3PJGA 4L8VA 3JCZA 3B6ZA 2O3JA 2HCTA 1PWXA 2JFFA 4AJ2A 4I9NA 4EYEA 5TS3A 4E2YA 3AUSA 1LA2A 4PLWA 1PJQA 4GBJA 3L9XA 5F5NA 5L40A 1ZZEA 2O3SA 3VH3A 3SXPA 5ICSA 2XXJA 2PD6A 3L4BC 4D41A 4NJOA 2X0RA 3FR7A 2EKLA 3TZKA 1PJ2A 4KWHA 1DOHA 5AXDA 5A04A 1OZAA 4CLHA 1PQWA 4PRKA 4PZDA 4D3DA 5DBFA 4AJ1A 2ZCUA 1LUAA 2UDPA 5U4QA 3D64A 4YTEA 4Z6KA 2FPPA 3RQSA 1HE5A 3T4XA 4EUEA 2C0CA 1IOLA 4MVJI 1GZ6A 1GDHA 1YH3A 4KQWA 5KJ1A 1WW8A 2YW9A 4TRNA 5CHEA 3VVBA 1ZEJA 3K8ZA 4U8GA 1J6UA 3GH3A 1FDVA 1KVUA 3ANLA 1LSUA 1Y7TA 1CDOA 1HDYA 4AJPA 3KEOA 2AEJA 2RHRA 5H81A 1X7GA 2RCYA 5L4SA 1HXHA 3ITDA 4RPLA 3JYQA 3S55A 2ZCVA 1GUFA 2FWMX 3M6IA 4K9DA 1O94A 4BO6A 3QWIA 3LLVA 4DYDA 3ICCA 3GT0A 2YDYA 1YJ8A 1EDZA 3PK0A 5G4LA 4W7HA 1R16A 4RL6A 3ADOA 1JKIA 2GR9A 2WEKA 4JK3A 4TZKA 2A4KA 1UZNA 5B37A 3VZQA 1V9LA 2G76A 2VZ0A 2GN6A 2Y0CA 1U7TA 4QO8A 4YAGA 4R3WA 3FN4A 4O59O 2B36A 2VCYA 5CDGA 2NU7A 3JQBC 3KTDA 4WUVA 1LTHR 2Q1UA 4BL5A 4URFA 3QVSA 3GNSA 1C1XA 4KUEA 1ZXLA 4GKVA 3LQFA 3K30A 3QW2A 3TZ6A 1XHLA 3EYWA 4NBVA 1Y5RA 3PDUA 1DFIA 3PHIA 1U4OA 5BSHA 2IRWA 1NFQA 1XELA 3OQ1A 1H94A 3IUSA 1IZ0A 1YB4A 4XB1A 4D0SA 4F6CA 2V6GA 3TRIA 1P3DA 1E7SA 3DWFA 3PZBA 2OO5A 5HM8A 4LN1A 3VKUA 3JD3A 2D1YA 2GUGA 5MGBA 2PD4A 5DCYA 1MG5A 1AGNA 1I30A 3ZWXA 3A1NA 3DBRB 3X2FA 4R9SA 1CIVA 3BMCB 3HJAA 1NQAO 4OHUA 4YYZA 2HMWA 3ZWNA 4BNMA 1LEHA 3AUUA 4M86A 3GEDA 2AG5A 1YVEI 3O26A 4RJTA 1XQ1A 4I1IA 2VNAA 4ID9A 1AE1A 2R6JA 3NV9A 4L0QA 3DAGA 3GHHA 3MTJA 2HDHA 4B3JA 1JQBA 4IUYA 3OJLA 3PJEA 5KWEA 3KZVA 5IN4A 3PZRA 2B37A 1XQ6A 1O6ZA 4CQLB 3BXXA 4OKNA 1RM5A 1B0AA 4S1VA 2I76A 5C37A 3RBZA 1LDNA 5TT1A 4PVCA 5IZCA 1T2CA 2OP1A 3RC7A 2C59A 2X0JA 3KYDB 2GNAA 1RM0A 4ZQHA 3DFZA 3OETA 3SLKA 2ZQYA 4EJMA 1EUZA 1ENPA 5I8ZA 3RU7A 1R0LA 2QX7A 3DC2A 4DIFA 3WX0A 3IUPA 5G2OA 3ZI0A 1MGOA 3H9UA 3CZMA 2AQHA 4JBIA 4DLLA 3UFXA 4BO3A 4NMHA 1T2EA 2JCXA 5CAEA 3HB5X 4FCCA 4N5MA 2BGMA 1R66A 4OXKA 2VZ8A 3HN2A 4FR5A 1KVQA 2BKAA 4FFPA 4PG6A 2HK7A 4C7JA 2NTJA 4YJGA 3K31A 1P0CA 2B4TO 2C82A 1L7DA 5ES3A 4AJLA 2EJVA 3F4BA 3NYWA 4LW8A 2HMSA 2J3JA 5DNAA 1OFGA 4KTTE 2D0IA 1LRLA 4O0LA 4J7XA 1R4MB 1EFKA 2CZCA 3UCXA 1T4BA 1ZK2A 4BB6A 1PJCA 2X6TA 1OMOA 1ISMA 5JYEA 1Y8QB 3E82A 1T2FA 1DJNA 5JCJA 3SX2A 2UVDA 5U9CA 2PKQP 3PI7A 4PN3A 4CQMB 4XDZA 3VKVA 1JAXA 2PR2A 4M49A 1EUDA 4RPJA 1I32A 2O23A 3AM5A 2O3QA 2DPGA 1TT5A 4Y6SA 1Z74A 1P45A 2WJPA 3SJUA 3WTCA 1YS4A 2VRBA 3OBBA 4XDYA 2HO5A 3ANMA 4KTVE 3ZV5A 5KJFA 1QG6A 4ALNA 1C0LA 1P44A 2EERA 1NR1A 2YV2A 3KSUA 3PEFA 1NR7A 1IPEA 2B0JA 4FGSA 3AWDA 2BELA 4YT2A 4ZRNA 5I7FA 4J43A 1ADBA 3DAFA 3W8EA 1B8UA 4XYMA 3C1TA 2V6FA 1CRWG 1ZO8A 2O2YA 3DB2A 2ZKLA 4WASA 4MIYA 2GRAA 3ZV4A 4QXMA 4M55A 1ZXBA 3C8MA 4YJFB 3R3SA 7ADHA 3QQPA 1XCBA 4EW6A 4KDFA 3D1LA 4ND4A 5G4KA 1AUPA 1O95A 4Q3AA 5KKCA 1VL6A 3KVOA 5THKA 2FR1A 3VH4A 4DTIA 3GEMA 4FJ2A 5T5QA 2JJYA 1W73A 3JQGB 3KBOA 4E3ZA 5BQFA 3WGGA 3JQAD 3VTFA 5A9RA 5KIAA 1E1NA 3WJ7A 3I9NA 1K6IA 1OC4A 1WMBA 4ZRMA 3L07A 4FFOA 1O0SA 3IDSA 1WMAA 4G81A 4UAGA 4P4GA 4R16A 1W0CA 4XZ3A 4R3NA 5TSDA 5IDQA 1C1DB 1WP4A 4ZD6A 3CINA 3EY4A 4Q3BA 1N9GB 3BHMA 5JDIC 5KVCA 3GVPA 3ZN2A 2HSDA 3G17A 4IDFA 4CR6A 1UJMA 1Q7BA 2ZYAA 3R0IA 4ILKA 4XJTA 4BNWA 3ZNPA 4D0RA 2BFPA 3BMNA 4I08A 3V2UA 4L9RA 4OYRA 1HSOA 2I65A 2H5LA 3OH8A 1ZMOA 3IP1A 2C07A 3OA2A 4JN6B 3S2FA 4E2WA 1U5CA 1ZSVA 4UUNA 2VN8A 3GMSA 4NFYA 1T2DA 2QRJA 2HMVA 4YQYA 1IHXA 4MPDA 2O50A 5C3MA 4YAKA 3WOHA 2YQ5A 4BMSA 3Q0EA 4TWRA 4QUKA 3ZWPA 3HDHA 4E2XA 4MVJG 2C29D 3PTZA 2PK3A 3UN1A 1I24A 4UVEA 2VHZA 2GSDA 1XLTA 5ITWA 3GLQA 3MJEA 1T2AA 3NAQA 4BMVA 3F5SA 2SCUA 5JDCC 4BNXA 1VC2A 4RQTA 1JVBA 3AJRA 1PGQA 4IM7A 2E49A 3AOEA 1ZFNA 2VOJA 4CMEA 3PFFA 1Q2XA 1R6DA 2FN7A 1PX0A 4OAQA 5TJ9A 4YJDA 3C7CB 3IKVA 2W2KB 2CF5A 3KLPX 3B20A 3D0OA 3R6DA 4XQCA 3E6AA 3L77A 3RVDA 2VYVD 1OC2A 1ZK3A 3JQFA 2HQ1A 3GK3A 4JX8A 1YQGA 1HYHA 2ZYDA 5H82A 4E5KA 4IMRA 3K5PA 5JC8A 2W90A 3C85A 3Q1LA 3NTOA 3GNTA 3GFBA 3WIDA 1VPDA 1EEHA 4Y6PA 4YAJA 1WPQA 1HKUA 1P1HA 3RWBA 3A14A 4A5OA 3QWFA 3MCVA 3K73O 5JO0A 4PLHA 4HNGA 2NWQA 1D4FA 4IDGA 2JFHA 2HMUA 2JHGA 3JD2A 4BKOA 1PEDA 3DFUA 4FOSA 5EMHA 5HWSA 1T24A 5I7SA 3WMXA 3WQRA 3ZU2A 4IPTA 1B3RA 1Q0QA 1J4AA 1LNQA 4FSHA 5AYVA 3LU1A 2NACA 5FWNA 3GVCA 4XQGA 1UZMA 1T26A 2BF7A 5IXYA 1LLQA 4NFHA 1JKFA 3OECA 4L4SA 1H93A 1K3TA 3CUKA 2GASA 4XRGA 5A5EA 1V6AA 1M66A 1YDWA 3NDJA 4CMIA 3F46A 3PLNA 4NIMA 1S7CA 1GTMA 4XQEA 1KC3A 4ALIA 4FS3A 4NU6A 3UCFA 3WGZA 3I83A 3W8DA 1KBZA 3I9MA 2A9FA 2VQ3A 4KZPA 1UH5A 2J3HA 2VRCA 4DVJA 5CP8A 4WOJA 4B4UA 5JO9A 2H6EA 2IZ1A 1YQXA 3MOIA 5ADHA 4BOYA 4H7PA 5HA5A 5DCUA 5EINA 3DOOA 3VZRA 1B2LA 4CLOA 4H16A 4RZIA 3COSA 2P68A 3FD8A 3HADA 4MVJP 5F1OA 1YO6A 1F14A 2PH5A 5CPBA 4QQRA 1MX3A 3DR3A 3RFVA 4BNLA 4GX0A 1DHRA 4B3HA 3KLMX 1GCUA 1O9BA 1EBFA 4NHEA 1NNUA 3ABIA 3UAGA 2BH9A 3NDRA 3E48A 3RUFA 5B4VA 3NJ4A 1LJ8A 2FZWA 2IODA 4K28A 1SBYA 1T25A 1CWUA 4NBRA 3LT0A 5H83A 4DC0A 1B8PA 2D4AA 3DMTA 1ZIDA 4B7CA 5B4UA 1E3WB 1H6BA 1LXCA 3JD4A 4A73A 1U3TA 3EAGA 5AXBA 4L74A 3TOXA 1NFFA 2AQ8A 5HTOA 4CLRA 3DQPA 2PH3A 1NQOA 4GKBA 1A9ZA 3NUGA 4CLXA 4PLZA 3RKRA 3W8FA 4WCFB 4YR9A 2QRKA 4LISA 1XGKA 2NU9A 3GOHA 1ZSNA 1VRWA 3GVIA 4BNZA 4GWGA 4NZ9A 3PYMA 4AFNA 2CF6A 4L4RA 4BGVA 4RLSA 4Y8VA 2NNLD 3O03A 2HRZA 3GRKA 4S3MA 4WEOA 4DGSA 2A94A 3U9LA 2B35A 4IJVA 1KC1A 4CL3A 2FP4A 1VJ0A 1CF2O 1LDMA 5F1PA 2JL1A 3LC1O 4Z0PA 5L7TA 5G0SA 4D3FA 3IQDB 4BGEA 5KKAA 3DZHA 3ZNOA 2F1KA 4B79A 1QYDA 3DBHA 4TROA 4GL4A 1A27A 5A9SA 3KYCB 1R0KA 3LYLA 2VWHA 4XQ9A 2PY6A 4BS9A 3HDYA 1Y9AA 4WLNA 3BTSA 1VL8A 3MWDB 4D3SA 1Z75A 2WE8A 3VZSA 3RSHA 5HS6A 3UW3A 2Y67A 3TPCA 4CM9A 3GUCA 3QV1A 3D3WB 1I2BA 2X9GA 3D4OA 3RROA 4C4OA 3FBGA 5A5FA 3D3EA 4GGOA 1P1FA 3RD5A 3JQ8A 1K0UA 3Q6IA 4PG4A 3OJEA 3O9ZA 5IZ4A 1H6CA 2C20A 1NVTA 3K9QO 4CV0A 2OZPA 2ZTVA 4J1TA 2FMUA 1VL0A 4R1UA 4BV9A 1PR3A 4BNUA 4YPOA 1YDEA 4OXNA 2OGUA 2X1HA 4EITA 3IMFA 3K96A 1RM3A 4BO0A 1YWGO 3L4BA 2PKRA 3AI3A 4NPCA 4RV9A 4QSMA 2G5CA 5T8KC 4ESOA 4HUJA 4XYLA 3CZRA 3GN1A 1QRRA 3QWBA 5JCXA 4A26A 3QA9A 4R4JA 3N58A 5BR7A 4UREA 2YYYA 1RKXA 1RYDA 1GQ2A 3IKTA 2J5RA 2DAPA 4GMGA 3WSWA 2CY0A 4N7RA 1NQ5A 1U5AA 1Z82A 2PV7A 4G2NA 5COAA 1HEUA 3WGTA 2NTVA 3A4VA 5JSFA 2DQ4A 3EDMA 1ONOA 2DT5A 3MZ0A 3QJ5A 4WEQA 2QW8A 3JTMA 5JAQA 1LRKA 1I3KA 3WJAA 2AA3A 5KOIA 5CG2A 1BTOA 1O5IA 2VYNA 2BD0A 2FHSA 4KMSA 2EV9A 3ZV6A 2X9VA 2CVZA 4NBTA 3RI3A 3TL3A 2ZATA 4GVXA 5DOVA 2UUOA 1DRWA 2V65A 1DLJA 3NEPX 2BI8A 4FB5A 4YRAA 1D3AA 4TVBA 6ADHA 1FJHA 3E9MA 5G0TA 5I8WA 2P9GA 3AY6A 2FPIA 2DM6A 1KS9A 3H7AA 5LDGA 1PZGA 3JQAB 1JWBB 4EJ0A 1K5HA 3E1KA 2YHUA 4BKRA 2CDCA 4MKRA 1SO8A 2BI7A 4G5HA 3BTUA 3ZWOA 3JQBA 5JYDA 3ONFA 1NXQA 3FNGA 4GSLA 4IXTA 4CM8B 3LF2A 1A9YA 4YXFA 3Q2IA 4BUCA 4WLEA 2A92A 3WQQA 1HDOA 4GGPA 3HFSA 4W7IA 3VOSA 5JCJD 4RVHA 4BNVA 4EUHA 1HDRA 5KVVA 4RDIA 2W2LD 1NASA 3GF4A 2HAEA 5AVOA 1PTJA 1F8FA 3PP8A 3NTRA 2X23A 1E0DA 3MJCA 4I5DA 1JLLA 4MIEA 4ZQEA 4DPKA 3GA0A 1D1SA 4PLYA 1RYEA 4WLVA 3HWRA 5JS6A 3QIVA 4D45A 5TIIA 2PZKA 3RIHA 3QY9A 1GUZA 4FPXA 1M67A 1DBVO 1TLTA 1F12A 1SOWA 2EKQA 2W4QA 3PHHA 4M8SA 4NJMA 3H2SA 4QT0A 1R4NB 4J2HA 3TZQA 1JKJA 3VC7A 1E3LA 2Q50A 4MVJH 3UGKA 3NKLA 3JYLA 2C2XA 4IQGA 4J4TA 3BMOB 3GUYA 4BNHA 1F0YA 4FBGA 2DKNA 4U5QA 3L9WA 3NRCA 1ZCJA 1SAYA 3U3XA 1UAYA 1S6YA 3I6QA 4UVHA 1HE2A 3PJDA 3GG9A 3C24A 1E3EA 1HWYA 2CVQA 5KJCA 3GR6A 1PR9A 3VPGA 4FJ0A 2EP7A 4Z9YA 5FI5A 1XU7A 2EIHA 4ZHSA 5I9NA 5L9AA 4UEOA 4DYVA 1EK5A 3IAHA 4NQZA 3JQ6A 4ZQBA 4E33A 4PLCA 1Y8RA 3U49A 4BB5A 2LDBA 1X1EA 1HDXA 3ROQA 4E31A 4ALJA 3K92A 2OP0A 4LVCA 4NDNE 4R9RA 4YRDA 3LF1A 1EVJA 1ENZA 2PKQO 3KO8A 4GX2A 4DA9A 4GX5A 4BNYA 3ZNNA 3PQEA 3DBLA 3OQ6A 1UP4A 5K6AC 4JNKA 2YFHA 4D44A 4Y98A 5ENVA 2DVMA 3O8QA 4DXHA 2GN8A 4CJXA 1HDCA 3ROPA 1L7EA 2QIOA 5CDSA 2X86A 4L75A 1NAHA 1YL6A 3CMMA 4JJIA 5DT9A 5EJ2A 1HRDA 3ZWMA 2VNSA 4CODB 3ZDFA 3OA0A 3MEQA 3R3JA 1ZVMA 4XJSA 3JQEA 1M2WA 4GQAA 4DBVO 2WD7A 1GV0A 4WLFA 3PYLA 2C5EA 2VUUA 3BMQA 2Y1OA 3GGOA 1BXGB 3AU8A 3A28A 1YOVA 5IXSA 5ILOA 1WVGA 4L4XA 4ALLA 5L3ZA 5JW6A 1MC5A 3G1UA 2ZB3A 5TQVA 1K6JA 1LX6A 5JLAA 4LGVA 1Z7BA 3F5QA 3EUWA 4PCVA 4ALMA 3KUXA 4YBZA 5EPOA 4IIUA 3PWZA 4ZJUA 4WCDA 3H5AA 4BKPA 2EP5A 2Q2WA 4GLLA 4CM1A 3PFWO 1CETA 3HN7A 3RUDA 3KETA 4CV2A 2GZ1A 5K0ZA 3HE3A 1QYCA 2VUSA 3EK2A 3S8MA 2RH4A 3RKUA 4MDHA 1HL3A 2JKVA 1E3JA 5A02A 3RC2A 1W4ZA 5KNLA 1A7AA 3WLFA 3PPIA 5F1KA 3E18A 1ZMTA 3BA1A 1A4UA 4HXYA 1VSUA 4GX1A 1N1EA 4K1LA 1NWHA 1SZJG 3GZNA 3ETDA 2WE7A 2WDZA 4CLEA 1FDTA 3HUDA 5EQFA 1QXSA 3FTNA 4J6FA 4CUJA 3RC9A 4LSWA 3IC5A 4PVDA 3V1UA 1LQUA 1NPDA 2NSDA 3FWZA 3ST7A 1Y5MA 4EDFA 3P19A 1GR0A 1XYGA 4M54A 4P22A 2Z5LA 3A06A 1A71A 4NU5A 4ZQFA 2E82A 4R51A 1EFLA 1T4DA 4KP7A 1NYTA 2P2SA 4CMJA 5CEEA 2B5WA 4RVUA 3VDRA 5TF4A 3ORFA 4DQXA 1GPDG 5FFFA 4TKLA 1JVSA 3PGJA 3OJOA
chains in the Genus database with same CATH superfamily
4MQMA 1JG2A 1P9NA 2GYUA 3PXXA 4H31A 4NOKA 4S24A 4OXQA 1VMEA 4NG5A 4R01A 3VR4H 4D8UA 5JPIA 1VCIA 1PSZA 1LH0A 2I1VB 4YFVA 2PGIA 1R3UA 2WHPA 3VI3B 1G20A 1JI3A 4H35A 4PSAA 5KOHB 1N8TA 2I7XA 3B70A 1AQLA 4U7GA 4KH0A 4Z9AA 1Y9JA 4C01A 1A72A 2FNAA 4BQRA 2VRCD 1C1XB 2A88A 1FFHA 2R7MA 3Q88A 1V7PC 1HMPA 4YONB 1ILEA 5LMUB 4LOAA 3UAVA 1G8YA 1NBIA 4Z4CA 3WI7A 4AF8A 2XJ4A 4HAXA 4OU4A 1ACLA 2B7LA 1SOMA 3FHCB 3IL2A 3ZJTA 1U8XX 4LYYA 1C4KA 2DUUA 3P52A 3TQHA 3UWMA 3TDMA 4UM7A 4TN1A 1LS1A 3E2IA 3TGPA 1QP0A 4MUEA 4MVJA 4YDQA 2BL4A 2FWJA 1SUDA 4H2DA 1ZA1A 5H3CA 1H2YA 1I4LD 3LCRA 1VSVA 5F2OA 1B0ZA 1YDHA 4GEGA 4GP6A 2R1TA 1NOIA 2WSSD 1OBHA 3DEKA 4DTCA 4EUFA 3LQYA 2J08A 5ALMA 4UUAA 1I5OA 1Z7WA 1QCCA 1JDTA 4O2AB 3KZOA 1G63A 4L8FA 1KAQA 2C77A 2YXEA 3IHKA 1AQJA 2R44A 3W5DA 3OCZA 1R8QA 1TK2A 1U3VA 2PZLA 1EQAA 2QTWB 4RCYA 2CUZA 4HN2A 2DJIA 2DBVO 4ROTA 2M6SA 3ORHA 4Q9JA 3TIIA 4Y0AA 2QLNA 2WHXA 4UM5A 5JMTA 2QPLA 2EATA 2VDOB 3IVXA 2IF0A 3E0QA 3H5LA 3DZIA 4X20B 1ZA2A 3G88A 4TMTA 4D26A 3CR7A 4M0FA 3NT5A 1ST2A 2AXNA 1QRUA 3AP1A 1HLDA 1SHJA 3PA6A 4FX5A 3ZCQA 5KMGA 2B8TA 1IDOA 2HQSA 1O6GA 3BL6A 1F8XA 2HHCA 3HR4A 1ZD3A 2IJGX 4A7PA 3MWGA 3VR5D 1H6AA 5EJMA 2CVHA 4TWBA 2FK8A 3F1LA 4TL7A 2YRWA 2F4VB 3KSRA 1TK3A 4BE9A 2XQKA 1TU3A 3FYSA 3H99A 4FGUA 3KB2A 4U2KA 3SNKA 1TQ8A 4AULA 3PL1A 2VPQA 4Q12A 4XIJA 3B9PA 4ZCPA 4DEVA 1RZRA 3WLAA 4FJ1A 2XKJE 5AI4A 4NR0A 4EVRA 2FR8A 1IBLB 5ILGA 3HU2A 5BSWA 4O25A 3DZDA 3D5EA 3ETEA 3L04A 5EE1A 1QIFA 4ER7A 1JAZA 1S3FA 5ADVA 3MJTA 3HYSA 1OLSA 4JH0A 3HB1A 4PAMA 2O7NA 4Q3CA 2H59A 5EXPA 2W2XA 3CCFA 1YCGA 5IZCC 2BKLA 4HN9A 2YN2A 1PWZA 5HQTA 1YONA 4BQQA 2I4LA 1A2QA 2WFMA 1TAQA 1UJ2A 1UFRA 4X1KA 5M3BA 3RR2A 4TS4A 1QRDA 2IKQA 2IZ6A 2FEWB 4LE0A 4QE3A 4RD2A 2CFOA 3AYZB 3ETJA 4WXEA 1UQTA 1SZDA 3TD2A 4BNDA 5ALOA 5BSFA 1H2ZA 2GMWA 4EOGA 1GQFA 3TNLA 2QHXA 3IEMA 5JS7A 2XVXA 4RZ3A 3NHZA 2BR4A 3HEMA 4YPFA 4CDGA 2AN3A 3UAWA 1DZ3A 1PT8A 4MIOA 1E1QA 2HV9A 4RIGA 5IDWA 3PLRA 3I3OA 3SLGA 3T1NA 1QGDA 1IJFA 2IYPA 4PWZA 1E1CA 2OGZA 2C3OA 3M5DA 2ZB8A 3O2SB 3MT7A 3R9IA 1GCOA 4WL0A 1EUDB 5AVSA 4OGFA 5ALYA 1N8KA 1T1GA 3L7KA 5AK0A 5T4HA 1SQSA 3WDSA 3V7YA 4Q4CA 3LPMA 6YASA 4GMDA 4A9AA 1E8DA 2XOXA 2I29A 5B7QA 2E48A 2BFAA 2QT9A 3VU3A 1TEHA 2RH8A 3HEBA 1L4LA 4OHBA 4TTVA 1YS2X 4W8GA 6REQA 2A5FA 1RLMA 2RAPA 2BC9A 4LK3A 5FBZA 3I5AA 3PUYA 3E9NA 4XVRA 5CYGA 3TZKA 2OORA 2QRVB 4B9AA 1T9KA 2H1SA 3K0AB 1XEXB 3OT4A 4TLCA 4DOMA 2NO6A 2WJZB 4BMXA 5BV1A 2O8DA 5JRJA 2BHLA 5BVGA 4MDEA 1NW3A 1TIKA 2WDPA 3ZC3A 3KG2A 1IHPA 1ZK1A 4AXXA 2GX6A 3C1UA 1B15A 2ZEJA 2ONKA 4QL3A 3U4DA 3DTYA 3H6KA 4EGCB 5F9MA 2IOQA 2J9GA 4W9NA 1Y82A 1VCHA 4ZT6A 3A11A 3G89A 2QQGA 2JVKA 4DLWA 5JD4A 1IXRC 2DFVA 4M0EA 4QO7A 1DSSG 5GQSA 3R09A 2HCFA 4JOSA 4NAHA 1G1MA 3UAYA 4G8DA 4MGKR 4G86A 4PNEA 3GU3A 3MFYA 1QB8A 1S2DA 3LP6A 1G7TA 3K5WA 4IBOA 4QLOA 1U28A 4TTTS 1OROA 1GFSA 2GTPA 2QRNA 4L5YA 4DXDA 3PC8C 5K3EA 2R86A 1BZYA 1ENOA 1VG8A 1DAOA 3F67A 2WZBA 1JLRA 3GD5A 3K6JA 4TQGA 3UANA 4BMYA 3PA8A 2QYOA 3GMDA 1YS7A 1HTWA 1U7PA 2Q0QA 3MW8A 3OJ0A 4AK9A 4C03A 2QB5A 5BNIA 5JEDA 3RAJA 2NV2B 3UB3A 4XVCA 4FBLA 3SEZA 3H1EA 3ENNA 3OESA 3CUTA 2Q45A 1PL0A 3JWGA 2ZSUA 4MUNA 1XTZA 3GFGA 1SHKA 2DBZA 1VM6A 2VPYA 2JFNA 4HGZA 1A5AB 1ANKA 2Y93A 5BXYA 1U0HC 2PWAA 4FDVA 1VG0B 3ZE0B 5F76A 1G6HA 1EWRA 1WDLA 1X87A 3LGAA 2QN2A 2Y71A 4LJSA 2B83A 3TOCA 4A0GA 3NTXA 1YC5A 4EKDA 1M1YE 4F45A 5KX5F 2QU8A 2LRHA 4Q9NA 3UOGA 1SXJD 2QSUA 4IDAA 3WIOA 2C88A 1M2NA 4PQFA 2JCBA 2HSJA 2WKSA 3VMFA 2X2OA 9MHTA 3KP1A 2I4IA 3PVSA 2P3LA 2HNAA 1OWNA 1XMVA 1J24A 2ABWA 2YOFA 3EDOA 3FB1A 3FCSB 3ONDA 4IMIB 1K86A 3WAJA 3KSMA 3L7CA 3GHYA 5D2CA 5TEVA 2UUCB 3R9KA 2VT6A 4C29A 4IOLA 1G8KA 4IJQA 5HFNA 4OH1A 2JLRA 2WSBA 4MW5A 5IJXA 4MULA 3LV8A 1QF7A 2A59A 4IQ4A 1X42A 2BISA 3B1VA 3TPFA 2G7MC 3AK4A 2JGJA 1RPAA 1Y4ZA 4BQNA 3EH2A 3FI0A 3Q3IA 4U4AA 4F12A 2JH3A 2BUAA 1Y6JA 1GUAA 1ZNWA 1ZRHA 2R11A 3LDUA 4IVQA 5E6UB 2QBYA 2ZP1A 2YIMA 6ABPA 1IEWA 4EJSC 4FKMA 1ZRSA 4ZGGA 2J3DA 2A0XA 5CXQA 1SNYA 2SCUB 5CB6A 2GEKA 1EK6A 1NN0A 1NUSA 1RZ3A 2P69A 4GPBA 4XYGA 5F4ZA 3SM3A 4B33A 5LD2C 4JIMA 1V16B 4AMGA 1HRKA 2ODPA 5K8VA 1YKFA 1SKBA 3KOXA 1O77A 4D98A 3V8EA 2WIFA 4RZUA 2Z08A 2DLCX 4IDBA 4R3UC 4XJVA 4TT3A 3SDSA 4MGHA 2G9UA 2MSLA 2P8SA 1T9GS 3VR6H 2WIGA 4FW9A 3EDYA 2C03A 5KHAA 4YK7A 1E9AA 3ZDDA 1Q2UA 4EABA 1H0HA 1I6WA 1DO8A 1RLJA 2DFTA 3C6BA 2GS9A 5M2QA 1ZOIA 3W6PA 3QFTA 1RJEA 4B3IA 3AVVA 4RV5A 2IIQA 4JLPA 4UEJA 3AJAA 5JFTA 3FAKA 4ID3A 3WYCA 2I3AA 3CEJA 3RRFA 3AKYA 3G0BA 4NECA 3PFHA 2VIIA 2VHYA 1YQ9A 3BG5A 1G16A 4DRYA 3V8NA 3F2VA 1QU3A 1RAFA 3IS3A 4TLEA 2IUSA 3WKBA 2YUIA 4CLDA 3ZV3A 4DWVA 3RYFA 5BPFA 3UPDA 1U5BB 1FFEA 1T9HA 1V0JA 3FHLA 3L02A 1J2TA 1N77A 1NVMB 2BFCB 3I5MA 1QP8A 1UKAA 1JSCA 2OZVA 4JU9A 4XWKA 4I1PA 1ZD9A 3BD7A 4EKEA 2H4HA 5DSXA 2QT0A 4JVLA 3KOMA 1IQ0A 1C8KA 4PR3A 3UJPA 2EQ5A 1XMSA 1AD2A 1SG6A 2NXCA 3DSRA 3M5CA 3BX1A 4HO1X 3L84A 4M36A 3VHLB 3DPIA 4JGIA 3W77A 3JQFC 2Y0EA 5CBKA 3MS2A 5LJIA 4I4TB 4KAFA 4Q1EA 3P9SA 2O2IA 3RYHB 2YINC 4WCFC 1PV1A 1B76A 5FXMA 3T3GA 1YGYA 4DCPA 1C0PA 4AICA 3OZEA 3DO8A 1KDOA 4DY4A 1MX5A 1D6NA 2JEZA 1P9LA 5EIWA 5GOZA 4Q1VA 1SC3A 3IYLW 5A9TA 1SUSA 3T5DA 8GPBA 5JNUA 5KNBH 4OI1A 2GN1A 1WDWB 2YJ6A 3MUNA 2BW0A 1V7ZA 1OB5A 2PX4A 4QULA 4CMIB 2VF8A 2YJ5A 4DV4B 1AGRA 3IQWA 1PJLA 2ECFA 5E7MA 2IBMA 4NCKA 1H1LB 2G6BA 4ITUA 3TQCA 4GXQA 4EB3A 1AG9A 1G5HA 1HYEA 3NC4A 2P4HX 3WY9A 4MWZA 1JG7A 2B61A 3MOGA 1G8GA 1U9JA 2A0KA 3HA7A 4L5JA 3EJWA 1L5VA 2V58A 3CT4A 5FULA 1BROA 3HG7A 4Q9AA 1TQ2A 3C5WP 3HDJA 4QUAA 1ORWA 2DBRA 3OZCA 4IHJF 2ZI4A 4RWEA 4AO7A 4BE4A 3N0TA 2VWGA 1GSAA 2C2GA 3AJDA 4OUDA 4E88A 5BRAA 3RRBA 4D74A 1HT0A 1SHLA 2OAP1 3CC8A 5IVPA 4GR5A 1H5NA 1H6DA 2X0DA 2WW8A 5CFQA 3CXRA 4DMKA 2ZI3A 1W581 2HLPA 4PQEA 1YQDA 2G71A 2P4UA 4Y2HA 5KDOA 2FRDA 1GXSB 1RWXA 4FONA 1I7NA 4YUWA 2XZTA 2YWJA 5JWRA 3WHKA 1ECPA 2WF5A 4LXHA 1JTEA 2FFAA 2F3TA 3C5VA 4MO9A 2NSYA 2ZGVA 4QVGA 3AHGA 3MF4A 1EFRA 4LYEA 3DXXA 4P83A 2E5FA 5BWCA 2G25A 1NBOA 2LE0A 3LGXA 1PV2A 4WNYA 3G0CA 3CF4G 4OBWA 3I1YA 3L3BA 3OLVA 3MOSA 3RH0A 4PGAA 4A91A 3HBFA 2GTHA 2AJ8A 2HT6A 2HQOA 2WTBA 2XDQA 3LW7A 2VBFA 1L7MA 4R71A 1GM5A 2G8LA 3OKCA 3GQBB 5E9QA 1Q7RA 4URVR 2OV1A 1Z45A 1BKYA 2VTKA 1P31A 3HY3A 4B8WA 2BHSA 2C7OA 1SC6A 3FTDA 4ENQA 4EEXA 1PFGA 5J9FA 1E2PA 2A7XA 4Q3NA 1AM4D 1MT3A 5IT9A 1SJ9A 1Y1RA 1NKTA 1KETA 5LOVA 5J40A 5K0BA 3KBBA 2BR5A 3D59A 2XCOA 4YXWA 4WXRA 5C34B 1LDBA 3KQWA 1UINA 4IICA 1UWCA 1XG5A 4IJWA 4GPTA 2XT9A 4AD8A 1CUJA 3QXHA 1UPAA 2RONA 1UIRA 2P2ZA 2E4XA 3AFMA 1EVEA 5GONB 5IBCA 3V7NA 1TKCA 1ZC3A 5K6AA 1J06A 2X4IA 4RYDA 4C5CA 2C7RA 4IWYA 4ZTBA 4WJLA 1T5BA 1Y33E 2FUKA 1S9DA 2HWUA 2YIVX 5IC5A 4B87A 3HCDA 2IYUA 3FKSA 3FWPA 4LOKA 4G56A 3AFGA 4S1WA 5I3CA 3EF3A 1QCDA 1BGWA 1EUYA 3NAGA 3NM5A 4G84A 3SEAA 1ZY2A 3CN7A 4OIMA 4YCBA 4W6ZA 1MLDA 2RH9B 1CHDA 1T6YA 1VMIA 1SEPA 1Q1QA 1YE5A 3LK7A 3CTMA 1P1RA 4YMIA 1RMTA 4QASA 2AYZA 3G2MA 1VA5A 5A9SB 5EJ8A 2VT2A 3PITA 3NIWA 3SR3A 5B6PA 1EP2B 1RWNA 4FMBB 3FGPA 3L0DA 1YVUA 5KNDD 3COPA 3PIDA 1HDEA 3CF2A 1XWIA 3TN7A 1V1MB 5JAPA 2J0SA 5F35A 3KFVA 4MNTA 1TA9A 1A1SA 3I1IA 3LLUA 1Z2EA 2DCMA 2JLBA 1M1NB 3EIEA 4AUNA 1VHTA 2Q3JA 3ZQUA 4TL9A 1W4RA 4KO8A 2Q3HA 1J22A 3ZOZA 2H9IA 4ND6A 3WBFA 3VC2A 2CFCA 2I7DA 2VWPA 3S2EA 4AIRA 2G72A 3L4SO 4UASA 4ZICA 1BDMA 2AK3A 3BD8A 3JQ8B 1RTKA 3QMWA 4ZVOA 2J9YB 4GI1A 3IUNA 3O2JA 3HWX1 4ZGWA 2NQTA 5KTTA 1NBMD 3ADBA 5KYUA 3L6EA 2VJDA 3H11A 3IUQA 2J5KA 1UKYA 5ESDA 4BVAA 2JKZA 2VAWA 2I8LA 1E58A 4OFWA 3OPVA 2CNLA 4KFUA 2J46A 1I8TA 3HA2A 4KBYA 4XYBA 1VLZA 3PGMA 3RK4A 3T35A 1A97A 1NRXA 2Z3ZA 2VHJA 4YV1A 4DA8A 5FLXA 4BV8A 5ADWA 1U9IA 2WYUA 4W1RA 2Z2JA 4RKQA 3JVEA 5DX1A 4MAAA 3TCXB 4I1RA 3KQVA 1ZUD1 4JEMA 1KYXA 3QM1A 4B0OA 3ICVA 1W5BA 5HBRA 1Z34A 2KPOA 3QWAA 5T7BA 4JQCA 3EMDA 3ONEA 4M21A 5TS2A 2BMVA 1KOJA 4ECAA 1OU0A 2PH7A 2HJRA 1D1PA 2YHBA 3IEIA 2FPKA 2HRDA 2ZXUA 3FRIA 1ZJYA 2NYRA 1F2DA 3E3MA 4JDPA 2EGGA 2QL6A 2ZIUB 4WT7A 3UY4A 2JLCA 5IVDA 2YASA 3CSDA 3ET4A 1I01A 4L0CA 4ZYYA 4ZCIA 4JJZA 3I04A 4HH3C 4L8YA 5GAJA 3BRWA 1JDBB 5GZ6A 1YUMA 3SSMA 3JARA 4DDMA 3WJ2A 4ND7A 3H5NA 1EA5A 1FX1A 1N3YA 2EKPA 1UDXA 1SB8A 2NADA 1IEVA 2ZWVA 3Q9NA 1Z33A 1AKYA 2HD4A 2P77A 4M0LA 4Q3KA 4W1PA 4RKEA 3R7FA 4G25A 4D0LB 5BUSA 4ENPA 1YE8A 2AOVA 2YBDA 2VTBA 3IVGA 3H05A 4HB0A 1TVKA 2VYCA 4ETIA 2X22A 1POXA 1Z4LA 5BSUA 3TI7A 4BRWA 5BN5A 5JCZA 4LYDA 4IF4A 3IIIA 1WP9A 1UANA 2G70A 1REQB 1HT2E 3QE2A 4DPLA 1GLGA 3GRFA 1KVSA 2C9BA 2QVGA 3L43A 3NHBA 3D0RA 2O5VA 5A6SA 1A77A 2JHPA 4F7DA 3CUSA 4B3DA 5LQNA 4K26A 2OV3A 4OJYA 3O0DA 2ZJ7A 3E70C 5BW8A 1W4BA 5IJZA 2DH5A 4EMTA 3CLSD 3CEAA 2DX7A 2Q2NA 3K0CC 1K8RA 3M81A 3KSBC 4W7SA 4HLUA 1ZZGA 3UBMA 1KEVA 1TQDA 13PKA 3O8DA 3ZW9A 1TC2A 4HY3A 3RJ9A 1W35A 3KHTA 1P5RA 4LZAA 5C7IO 3H7IA 4I50B 1QHNA 4FYMA 1KAOA 5TLSA 3RASA 5A5DA 1DO0A 1VOTA 3HNPA 4GG1A 4KUHA 4Y1EA 4YWJA 1JLLB 3RAEC 1HTBA 2GHTA 5J4YA 3BL8A 3C3XA 3JWHA 3BCRA 4JIGA 1N5JA 2PUBA 1GPYA 4MUBA 1GD1O 3LCUA 3MUFA 4W5WA 5A3JA 1H23A 1ULHA 4KRGA 1DC3A 3AR6A 3A9SA 3TKLA 1EIWA 3OZFA 4I4NA 1KR2A 3K70C 1KI6B 1EU1A 3KUCA 1Y6QA 3FLEA 3T0FA 3AFHA 1R4MA 4QQFA 4RKFA 3WLSA 4LNHA 2AYXA 2UZ1B 2EGHA 1KQNA 4BBPA 4KCGA 3W3ZB 3WB1A 2YJZA 2DU8A 3TECE 4HNHA 3G2NA 1V9CA 4K3UA 2EFGA 3FROA 3JW8A 3OX3A 4CYMA 3RABA 2ZPUA 4UTZA 4NXNB 4G41A 1DEHA 2ZJ8A 3BRSA 4Q66C 4XD2A 3JD1A 2IEDA 2XYVA 3CEHA 4JBXA 3UPUA 1K89A 1N1DA 2WM3A 2XTJA 4OGLA 1NV9A 2VXOA 2NUTA 2X77A 5C5CA 2XBUA 1A7JA 3EZFA 2OD2A 5EWJB 1YRQA 3EQ6A 4LJKA 1HF3A 2FX3A 1WTAA 3WMRA 1MA0A 1OV4A 2X4GA 1FYWA 1RR6A 2H9YA 1FUYB 2GYYA 1KMHA 5HKAA 1W85B 2OSVA 2P65A 2XEDA 5EZYB 1DFGA 3EZLA 4OB8A 2Z8ZA 3RTAA 1AF4A 2SKDA 2HU5A 5BNTA 3WP1B 1JMKC 3VV3A 1L3CA 3UUFA 2L82A 1FFCA 1ZGBA 4WZAB 5AVKA 2X19A 3DGFC 3IESA 4E32A 4ZYWA 1G38A 4Z4QA 3DT9A 2R8PA 1X0VA 4J4BA 4TXJA 3JX9A 4WZ6A 3WYBA 3BJRA 3SQMA 2TMGA 3BZBA 2BKVA 3A31A 4UUOA 3WB2A 5BMVF 1YXMA 2CD9A 3G13A 1T2VA 5A4KA 3C4QA 4UDYX 1JI0A 1V43A 2AJBA 3GFQA 3KKMA 4QEDA 4BIIA 2LPMA 4KBFA 1HYGA 3RK0A 2YCLA 5JAZA 2V4ZA 1QH1A 2P91A 2W70A 1UMDB 1FRQA 1Z4JA 5GY7A 4Z7JA 1PJ3A 5HK8A 1F17A 2JJMA 4HX9A 4MS1A 4BBJA 3EOAI 3G2PA 3WV5A 5CB4F 3ILYA 3GVXA 2D4HA 2OV6A 2LCIA 3K1AB 3ZH2A 3RRYA 4P54A 1N33B 1KMMA 4NCIA 2O2CA 1IN5A 3RBXA 1Q15A 3PXGA 2BVNA 4D0NA 4KR7A 5FORA 3S2GA 1C3LA 1NJSA 2DFNA 1JFLA 1I4WA 4F8JA 2JFXA 2XWBF 2RHHA 3CE6A 1O94C 1YIAA 3EXEA 3TEMA 4OBXA 3FYCA 4JP8A 4PN7A 2FZCA 2M2IA 2GM9A 2VA9A 3BMQB 4UAUA 5DCWA 2PVSA 3GBVA 1I7QB 1YOVB 4KN9S 1HNXB 3JQ9A 4TQUS 2GO1A 2PMEA 1GL6A 4GWKA 3C8HA 1JSZA 4U6NA 1N9GA 2FSUA 3M1IA 3SQOA 3IJPA 4TPKA 1X19A 4IZHA 1M0SA 4AB1A 3LHFA 5CFRA 5EUBA 2WVGA 2DY1A 2XPCA 5B2FA 5BSTA 2BMEA 1Z06A 3AF0A 3O8BA 4H18A 3U0BA 1M2VA 4CWAA 1DRJA 1XA0A 4ND2A 4ZCTA 3HNRA 3PUWA 3ZGYA 5A0FA 1QIMA 1Q95A 1M10A 3HZHA 3PYXA 2GCGA 4EY6A 2AMFA 3I39X 4QPJC 1ODJA 2G1KA 4ITVA 3JALB 3BS4A 4D3ZA 4F4UA 3T12A 2ECOA 3PWTA 1RCFA 2TECE 4WJZA 4X63A 1A8HA 1C2YA 1D2MA 1KO4A 2HH9A 3RREA 2QLJA 2XCLA 2E18A 1Q6YA 1E69A 4TTSA 2VDMB 1C29B 3AR9A 1VJRA 2I03A 2IL1A 2CLOB 3EIHA 4WN9A 1L5HA 4MQEA 4KJXA 1MO5A 2J6CA 2P3QA 4M0MA 1LSJA 1OLXA 2I2DA 3G6KA 3A0RB 3KB8A 1WM1A 4PG5A 1Z6GA 1T34A 3H5VA 3VVLA 1JTFA 3QFSA 1N2JA 3UWOA 5HJEA 5DNCA 2GLXA 4E09A 4PAGA 4DV7B 1YRLA 2ZJ1A 1U3CA 3MWLA 2G5GX 5AI6A 1MO6A 2E85A 3JY6A 4AG5A 5KVAA 4HNAA 4L27A 5FNVF 1W2GA 2NUPB 2RGNA 3K35A 1VMKA 4TQAA 4Y9DA 3K9GA 3OAAA 4D9JA 5FDFA 3MJDA 1ONNA 1E7RA 4EHLA 1X7YB 3NHFA 4F6LA 1KZGB 1MJGM 4B3CA 2WIJA 3FVWA 4RIHA 4N3CA 1IY9A 4A4DA 5L3SB 4NHEA 4A6XA 1YBVA 5LQJA 2W9XA 3WGVA 4WDRA 3OJWA 1KQOA 3KZKA 1CKEA 1LQTA 3MA0A 4M1MA 3S2SA 5HIAA 1N6HA 3HCOA 1DU4A 4D9MA 1YZUA 1PSDA 3E58A 1PQUA 4N1AA 4PLVA 3IOEA 4QQ8A 5K3AA 2PZ8A 3ANNA 4PYNA 2UYHA 4IGEA 1XK6A 2O0MA 3IJRA 3OVMA 4TWJA 5TB5A 3PC4A 4JU8A 3F2IA 4MWEA 1SUIA 4Z9FA 3UENA 3W1VA 3L0BA 621PA 2O0KA 2ORED 1BHJA 4A27A 3E5HA 3V4FA 3USCS 2RKOA 1MW9X 1PW7A 1IAVA 1FFXB 2CJWA 3FYTA 1E5LA 2CLDX 3HFGA 3NH6A 2K2WA 1CEQA 3TSYA 5ARBA 4KITB 3WQSB 4YDSA 1I9GA 1VE3A 1FXSA 2BI4A 2HADA 3WHLA 2OPHA 5BR1A 721PA 5KYYA 4ZTZB 5AW5A 4KXXA 4ZT3A 2JFWA 3FUXA 2VH2A 4G5SA 3VTZA 3ZDXB 4ND8B 3V1TC 1CHNA 1ECLA 1I2DA 1B16A 2VDRB 3AHFA 3PQFA 2GEDA 4LJ5A 3PB3A 3RODA 2YIJA 4AZVA 3DB1A 1P77A 4K9PA 2QK4A 4H4DA 1GADO 2W2NA 2ZXFA 3LKVA 4RO0A 1AXEA 2R7LA 1COWD 2O2ZA 4BKQA 3GJSA 4N3BA 4C0BA 3H9JA 5IX8A 3WBBA 1ORDA 1I10A 2H7XA 1VKHA 2GYWA 4DLAA 3BGWA 5J2TB 1FUKA 4RA6B 3VPAA 4RMNA 1C30A 2RI6A 3NP9A 1M34B 2GEJA 1GGMA 5ECWA 2E55A 5D86A 5HIMA 1O4VA 2PGAA 2RHMA 1HM5A 1TCCA 5D85A 3WK5A 2JH9A 3KDSE 3KWMA 1VMDA 4WNCA 4EKGA 4JT9A 3ABRB 1EI9A 1GR1A 3LY7A 5JPCA 1B6GA 4PQRA 1R8JA 3LT1A 2PG3A 3TQQA 4B4WA 1RVV1 3ZHYA 4RXTA 4DBLC 5BWMA 5EJIA 1OVGA 5FO0A 4NE9A 5JCOC 4RMGA 3BTVA 1JIXA 4QATA 1XDSA 3M9WA 4CEJB 1VB3A 1VJ1A 3MTAA 2XLBA 3JZDA 1JPJA 2VJMB 4GMXA 2Q6LA 2RCNA 5CBPA 2ZIAA 1FE8A 3ENKA 3UJBA 4EO7A 3I61A 1CBUA 3QLVA 4IMPA 3DZCA 2H18A 1W5TA 4IY1A 3A32A 2VYND 2W42A 4TRJA 4CKWB 5BSVA 4WV3A 2Q3BA 2GDZA 2QOEA 2IHYA 5ETJA 3A2KA 3HYCA 4BVKA 1KJQA 3WGOA 1DEAA 1DTWA 2HIGA 3L6DA 5JMWA 3QLJA 5LQUA 4TSFA 1NW4A 1GU7A 3ZEAA 4DLKA 1CULC 2MR5A 2IITA 1HORA 2WSIA 1K7YA 3I9FA 1CB7A 3LRPA 4ARUA 5HIKA 5IJWA 3V9PA 1Z4KA 1LF5A 1PTKA 2PA3A 4G89A 4IFBA 1YR1A 1U2RA 1NVWQ 4DREA 3UJ7A 2N46A 4RK7A 3G8CA 3C5CA 3THRA 4OLAA 4B8ZA 3IAM1 3GAZA 3QVWA 2CFTA 4DRXA 1UWLA 1LW7A 1QE0A 2FOIA 2GZ3A 3FRJA 2BPOA 1WXDA 4PLTA 1E7YA 4HEA1 3RG2A 5EY5B 3AVPA 3KC2A 4RACA 4R98A 1YVPA 4XGNA 1O95C 1IB6A 1OTHA 1XDDA 5ICFA 4IILA 5GVSA 4PCUA 3W9BA 4ESHA 2XTNA 2Q0SA 1KOLA 5BUCA 2X1LA 2ZTHA 1IQPA 1EX7A 3FHOA 4P36A 1MEOA 2X0NA 5TPWB 1BSVA 1C4XA 1K6XA 1N32B 3OIWA 3Q8LA 3HXLA 1QO7A 2NU8B 3HN6A 1Q91A 1E6EA 1YI8A 3AIIA 4Q9LA 2F1RA 2HTEA 3V4ZA 4WY2A 4DAEA 3S8EA 4DJJA 3FRHA 1Z29A 1OWMA 3OBIA 3B36A 4PHHA 3A37A 3D5TA 1L4YA 2J8ZA 1BXKA 3FFXA 1L5KA 2OG1A 2X0IA 2IUEA 2YVUA 4GPAA 4Q9KA 2JGDA 3VR6D 3EIXA 1IB0A 4PLPA 4S12A 2GAFA 1KE1A 1FEZA 5DDIP 3ANSA 4EG8A 1K4YA 2PRZA 1IPHA 2P75A 4BHTA 3T1HB 1NJ8A 2YN4A 1QB7A 1PZXA 1XX6A 1Q1NA 2CMKA 2MSKA 2R8XA 4KLCA 1H9BA 3OMWA 2CDAA 1E99A 3QEMA 4LV6A 4ESEA 5H1YA 4OKIA 2A9PA 3GLHB 4XVUA 3D3WA 3L4KA 2YZ7A 2AE1A 2ISSD 2ZIEA 2ZTMA 4WK2B 5JHGB 3EIOA 4UNQA 4XEUA 4PZCA 1C3OB 3L1KA 4OHCA 1JEQB 1PLKA 5AXAA 4QG7A 1PYDA 4LBYA 4V0RA 4EEZA 2ADFA 1QHIA 4MAFA 3AL0C 4P3OA 3TVDA 2P5UA 4I5FA 4OATA 2J9XB 1EHCA 4BQIA 9ATCA 1Z37A 1WU8A 2PFKA 1I2CA 1VHQA 1V8DA 1F8GA 2F6RA 5JAHA 4ZI7B 2BP7A 4BUZA 4D0GA 4DHEA 4KE8A 3UWSA 4NZNA 3X1MA 1A0OA 1XHEA 2XUJA 4MQUA 5EHNA 4AY3A 3MJVA 4RTRA 4DVGA 4CI0B 3ACCA 3FPHA 3HLYA 3T3MB 1AHNA 2FSSA 2M1XA 2WF6A 1CP2A 2BCJQ 1SOVA 2J3KA 5DBGA 4RAOA 3NQ41 1KAGA 1ZI8A 4IZ6A 3SHFA 3HFRA 1TIBA 3B1FA 4QJIA 4TLLB 4U3JB 4JLMA 2W37A 1E9SA 4ZREA 4Q7JB 4UBOA 2IY8A 3T7CA 4CV1A 1GPJA 2W6JD 1OH6A 2NMVA 2HCBA 1QSGA 4QBGB 4F6RB 4EAAA 1VE7A 2BDTA 4MO2A 4OQ4A 4KJZA 1KU6A 3CCBA 4TMVA 3VR5H 3ZQ4A 3K9WA 4QU0A 2A1TS 1PWHA 3N0WA 3QVJA 4KO3S 3SF8A 1ADGA 2DFKB 3PU6A 1Y1TA 5AUQA 3BIJA 3HKCB 4LMBA 5FPYA 2J6HA 5CD9A 1R15A 4H7DA 2VAXA 2Y1FA 4W9NC 3QBEA 1ISIA 4FWBA 3CX4A 3N2KA 3CV3A 2MR6A 5FYQA 4CTNA 1XTIA 3A27A 2D0PB 2BV3A 4EW1A 1T5TA 2QMZA 3GUUA 4X95A 5F2EA 3E5MA 4Y2XA 3C7AA 3M4XA 3ZE2B 2ODQA 2XRYA 2VHCA 4OQYA 1BFKA 2WP0A 2PLFA 5LU9A 2VJQA 2PGJA 2D7JA 2POQX 2ZRDA 5K0SA 2V6MA 3OMLA 3AEYA 1HNNA 1U28C 3FIJA 3WRVA 2IZ5A 1GTJ1 4PS0A 2AJTA 3U4IA 1PGJA 1D04A 2MSDB 4OSPA 1US8A 4TTIA 2GN9A 1R18A 5C51B 1UFVA 2Y77A 2BIFA 4RZ2A 5CA1B 2NVUB 2XA1A 3WYNA 4PFQA 4YGYA 5EMNA 5ED4A 3LM8A 4Y0NA 1XZJA 1Z08A 4V0LA 4C6TB 5IJ0B 3RSGA 1VIVA 2O54A 2WJIA 3PHBE 4ARAA 3ZHOA 1HFEL 4K9SA 3NW9A 3ZHBA 2V7QA 1THZA 1UBSB 4C5AA 3JQAA 2GAIA 5REQB 4HDOB 4RKYA 1AZTA 5LC1A 3TM5A 1KMIY 2RGXA 4K8RB 3MRVA 1TJNA 4L7VA 4EB6B 5DMHA 1UDBA 2YC4C 4PZZA 3VGPA 1UODA 4CM8A 3N87A 1A7UA 1JH8A 1GPMA 1KPHA 2V3WA 3ROKA 3KHUA 4BIMA 2AC2A 2Q2QA 4C30A 4R5HA 1ODTC 3L79A 1VZ3A 3SAJA 3JSAA 1QV7A 2GZAA 2VVTA 1NRJB 4F91B 1FFYA 1NDUA 2VZ9A 4FOLA 1SKMA 3OY7A 3KPUA 4BO2A 3TR5A 3U7IA 2YWCA 2DWQA 3CUEF 3R5FA 1CS0A 1SEVA 1XEWY 3EXG2 4JCCA 1P9RA 5F33A 4CCSA 4D9IA 1NI3A 4EZBA 2FY8A 1U2QA 3K16A 4UTOA 3MM4A 2E37A 4D81A 1GHTA 3IVAA 4OHMA 5LYYA 4B35A 1N5IA 1OV6A 3ROZA 2HLDA 3ETHA 1YRWA 4AC9A 2XI4A 5IDYA 3BKWA 1OVMA 5ALGA 4Z3DA 3BK1A 3CVWA 2QRHA 4JLSA 4K6KA 5FHRA 1XKLA 3BQ9A 1MFZA 1SMKA 3AEUB 3DUFB 5E2BA 4J3NA 4ZVKA 5AI5A 2LDXA 3EB9A 4MX8A 1QS0A 1Z88A 2NUAB 2YNMD 1R4NA 2UYYA 3QVOA 3FMPB 3ZHUA 2ZT5A 5BMVA 1V3TA 2DPYA 4PTZA 1NVDA 4DARA 2EBHX 1JX6A 1VZ2A 3VDQA 2B7BA 4BX3A 3B1WA 2JNWA 1X7WB 2XUGA 4QNMA 4WXYB 5CXUA 4G1EB 3TLAA 2P79A 3QPVA 4JJEA 1YZ3A 3Q3GE 4RFLA 3STUA 3UH1A 5AI0A 3E8MA 3U7FB 3KKPA 5JC1A 3SYLA 2Q1SA 1A9XA 2O7SA 2P78A 1Y3FE 4WBNA 3MINB 2R85A 4F96A 5AM1A 5KOJB 4G23A 4P5EA 4PV7A 5HSGA 3OSUA 1HZZA 3EZYA 3DONA 3IBCA 1EB8A 1CT9A 1UP6A 4LMAA 4A0RA 1JN0A 1Q20A 4Q1BA 1IJEA 2FGKA 3QRWA 4RETA 1CQIB 3USZA 4CFYA 4BQPA 2XF2A 3R5HA 1ZK0A 2WR8A 1BNCA 2GHRA 4N48A 2HL6A 4ZN6A 3U4HA 3H0CA 4AJOA 1MIOB 1MC1A 2CBZA 3R5SA 4JP3A 4DB4A 2IS6A 3F9CA 4J0IA 4CHGA 1UM9B 2WK1A 3IEUA 1F4PA 2AW5A 1HFKA 1II9A 4I7EA 4ENRA 3RE1A 4NQRA 1GL3A 4MV6A 4L16A 3KPVA 3P7MA 4HSEA 3T4EA 3KJHA 1SUAA 2PFSA 1EFVA 2YVLA 4GZMA 5E8JA 1WBDA 1Q0LA 3BXPA 3L8DA 1U8CB 2XA9A 3SDBA 4EGQA 3AKZA 3U5ZB 2R2AA 2Q0XA 2IXBA 1TB4A 3PD1A 1PNRA 1DGQA 3QFFA 1TLLA 2ENUA 1NE7A 2R5NA 1PR2A 4J7UA 4F85A 1R12A 1UBEA 2Y6UA 1HOTA 5JT1A 3KSZO 4QUDA 5AOVA 3UYKA 4OFBA 4P4LA 1RWOA 4Q16A 1KYVA 1GDDA 2FRVA 2H1HA 5CHYA 2J5XA 4II3A 4O4HA 5ER6A 2RC5A 2Z57A 4O0MA 4BYGA 2V7PA 3OURA 4FR0A 5DI9A 4PYOA 3T5PA 4E4YA 1XOIA 1NI5A 2V9CA 1G64A 2Z0MA 3HBLA 4Z0HO 4ZV9A 1JDNA 3CURA 2E2WA 3GBSA 3BIWA 5DHFA 1BH2A 1N2OA 1W49A 3AEZA 3PBKA 3QVGA 5E0OA 1Z5PA 5BWLA 1SXJA 5LA6B 3LQ2A 4YRCA 4II7A 3U7QA 1FMLA 1F20A 3UK7A 4GOMD 3U3ZA 3JRWA 4B8YA 3HKDA 1JLKA 4TTAA 5ECGC 5K0LA 2F1JA 3UAZA 2ACWA 2BLLA 1ORHA 2IELA 4D9KA 2GHQA 1UBOS 1N5KA 3BMXA 1PWXA 3PPVA 4J7AA 4AJ2A 4GU5A 4I9NA 4L5CA 2FEMA 4NONA 4N41A 1FP2A 2DT8A 2R3SA 5E4TA 5IXJA 1TA0A 5L40A 3L9XA 1M73E 2ECQA 1KYYA 2YOHA 4L6IA 2C8JA 4D4LA 3AF1A 3FSJX 5BO5A 3LQQA 1ZS9A 1QVWA 3FR7A 3K20A 3NKVA 3QX8A 4G0MA 4LHYA 3R5TA 2WFLA 3NOOA 2CFIA 4DILA 3IAS6 4JSTA 2I0FA 1ZN2A 4KWHA 3OCCA 2A57A 3ZBTA 5ALWA 5DSZA 4DSTA 3FH0A 3FVVA 3E22B 3L4EA 1OZAA 5A04A 4PRKA 4UPDA 3FMGA 3DP9A 3I1FA 1H5UA 3C8UA 3MCWA 1E2LA 4IJ5A 2C9OA 2CCGA 4JYPA 1NR5A 4G1BA 4QBKA 2W71A 5BW5A 3D64A 2FPPA 2VAMA 3T4XA 2ZIXB 2C0CA 4EQ6B 1K68A 4G07A 3FLAA 4L07A 2EL9A 4MV1A 5K6RA 5KJ1A 4H08A 1WW8A 2FX5A 4O2BF 4QPDA 3BC1A 5BXQC 1JFVA 5EE0A 5CHEA 1E9CA 1ZEJA 5FH9A 4BLWA 3K8ZA 4U8GA 1J6UA 3BE6A 4UD2A 1R27A 1KVUA 5UKDA 4AP6A 4QYIA 1M1UA 3C3DA 4HK4A 4MVXA 1Y7TA 3V46A 4DZZA 1RRGA 1SHUX 4X1OA 1KPGA 4HGPA 1PX2A 1JPVA 3C4JA 2POCA 2RCYA 5L4SA 1HXHA 5L8VA 4LXYA 2ZCVA 1WY5A 5L3VA 1GUFA 4JSYA 5FEMA 4DDTA 2YXLA 3LLVA 4XPIA 3ICCA 2DUNA 5AW2A 2BAGA 1LNZA 1UBGA 2Q5CA 3PK0A 5JZSA 1OLUB 5C80A 4B3RB 1G18A 2QYHA 5AHXA 1EM8A 5EE9A 2YWXA 3ZD6A 2HU8A 1TM4E 3EXFA 2WICA 3D6NB 2WZCA 1LI7A 1NBWB 4MITA 2A4KA 5B37A 4FHEA 1ML4A 1ZISA 3KHSA 3LUCA 5MFZA 2C99A 2EX1A 4FEGA 4QO8A 3DLTA 4J07A 2IUUA 1N2CE 4L08A 2Z9DA 2FEOA 3O84A 3PEYA 1N6RA 5CDGA 4FHDA 3EA0A 2YV5A 3FKJA 3JQBC 5D3KA 5KOHA 1MQ9A 4UZFA 1LTHR 2Q1UA 4MW2A 2H08A 5GONF 1TAUA 1C7FA 3HDTA 3K5IA 3QVSA 1KGDA 3RC3A 3WL5A 2FWNA 1C1XA 3LQFA 1GN8A 4KC0A 4YHHB 4I9FA 5HZKA 1ZOSA 3DKRA