5HTOA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1 (tetrameric ldh in an asymmetric unit)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
302
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
total genus 113
structure length 302
sequence length 313
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5htoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5htoA02
3WFIA 4QEDA 5DCWA 3G1UA 4PIVA 2XOXA 2YFHA 5DP1A 1FXSA 2DFVA 5IN4A 1DIAA 2ZK7A 1TT5A 2V65A 4YJDA 1VL6A 3KHUA 4OYRA 3RBVA 4CLXA 4OKIA 4CM8B 2C2XA 4ITUA 3IJPA 4MVJE 2IRWA 4K6FA 5I7VA 4IM7A 5L4SA 1XLTA 3VC7A 1VI2A 2NTJA 4OJNA 1PGOA 3FRJA 3F1KA 4P4LA 1QV6A 3QVTA 3AOEC 4CMEC 1K6JA 2PGJA 3JTMA 4P38A 4GH5A 3RASA 4XYGA 1VKNA 4BNZA 2A35A 2VHXA 2P4HX 3IQDB 1AXEA 3ONFA 5EIOA 1BTOA 4CLRB 5CAEA 4CLOA 1O89A 2BHLA 4RVHA 5A9TA 2H9IA 1MG0A 1OMOA 3CKYA 2DBZA 3FNGA 1SZJG 3ZV3A 2E4AA 3CINA 4J1TA 3FF4A 4CUZA 2JFFA 3FCOA 5A05A 1ZH8A 3ZV6A 3EDMA 1K0UA 1FMCA 4BO3A 5CFZA 4PRLA 3VH1A 4CMHA 4IQ8A 4EUHA 1WDMA 4I08A 4R41A 4TRMA 1IPEA 1GV1A 5TJ9A 4Y67A 4ZHSA 1DAPA 1HETA 3R3JA 3ETGA 4G65A 5JYDA 4D46A 1ENOA 3V1YA 1CDOA 5COBA 1PX0A 1JW9B 4GI2A 3M2PA 4E32A 4Y6SA 1A27A 4RDHA 1DJNA 1GCUA 4EZBA 2PH3A 5ES3A 5KWEA 5CPFA 1PZEA 1I10A 2AW5A 3BTSA 2A9FA 3ZHXA 2EV9A 3MWDB 3PK0A 2EKPA 1EQ2A 5KCZA 1DFHA 4URFA 1V3VA 4JIGA 4B3JA 3E9QA 5GMOA 1DLIA 4N7RA 5IDWA 1T1RA 3BIOA 3I9KA 2AEFA 4IJWA 2FY8A 5DCYA 3RUCA 3VPSA 1BHSA 3I9MA 3AU9A 1ZFNA 4I1IA 2V6MA 4IQ0A 4O63O 1LUAA 2A94A 3WNVA 4UUMA 3FTNA 5A06A 4IGFA 2HJSA 3E5MA 3IDSA 4Z9XA 2IZZA 2ZB8A 4FC7A 1AHIA 3PYLA 3WGQA 1CYDA 3ICCA 2YDXA 3MTGA 5KVVA 4YAIA 4KTTE 4MP6A 2GF2A 2YHIB 1U8FO 2VZ9A 3KZVA 3OEWA 4EUFA 4WLOA 1UDAA 1AUPA 3SLGA 2BI8A 4GX2A 1ZZEA 1P1IA 4WKGA 1AE1A 1B0AA 4R1NA 4FW8A 3VZSA 3WWYA 5G0WA 4AJKA 5JFOA 5JDCA 1BXGB 2ZB4A 4CM1A 4RGBA 5DOVA 4A26A 2EJVA 3GUCA 1R66A 3W6ZA 1DOHA 3OJEA 4OIMA 4YACA 2FZEA 2XXJA 2VRBA 4WE3A 3W4IA 1BDBA 1FJHA 1U1IA 2QIOA 2GLXA 3OQ1A 3PJEA 1YJ8A 3OJ0A 2RCYA 5KJFA 1HLPA 1ONOA 4E30A 1G6KA 3AJRA 3ZWMA 3WQSB 4IS2A 1W8DA 4TSKA 3F9IA 4BO0A 3INTA 3A28A 1XQ6A 2J3JA 3ZI0A 1GZ4A 1XR3A 2EP5A 3DOOA 3NUGA 5G2OA 1XA0A 3W1VA 1DFIA 2BFAA 4J1SA 2UVDA 2VT2A 4XCVA 3MWEB 4YCAA 1X0VA 3RC1A 1XEAA 1SBYA 4WK6A 4CQMA 1PL8A 3JQAD 1YBAA 2PZLA 1NR1A 1QSGA 5DBGA 2P91A 4XGKA 1EQUA 2GCGA 1WDKA 1KERA 1RKXA 3RJ9A 3GAZA 3GFGA 4NU5A 1NAIA 3SLKA 1U9JA 4NIMA 1N2SA 1EUZA 2DTEA 4FS3A 4B4UA 4IPTA 2IYOA 4YAKA 1HYGA 4DIBA 4TVBA 1PJBA 4Q3BA 3DHEA 2PKRA 5A4DA 3CPSA 1GL3A 4GWKA 3H6KA 1NQAO 3VPHA 2Y0DA 2HLPA 4LISA 3N58A 3MZ0A 4EITA 4ALJA 2GN4A 1T2CA 4CJXA 1ZMTA 2Y99A 4QSMA 1OC2A 5TJHA 1PJ2A 2PA3A 4E5PA 3PYXA 4RLSA 2HMTA 1LLDA 4LMPA 1ADGA 1VC2A 3O03A 4XR9A 2GN9A 3ZHYA 4B7XA 3H9EO 4Z0HO 1PJQA 2ZTVA 2PKQP 2R00C 3KEQA 3NJ8A 4BB5A 2V6GA 4YJGA 1JKJA 3GNSA 3NTRA 5GY7A 4BVAA 5ITWA 2HMVA 4DMMA 3EHEA 4LMRA 2W90A 4DRYA 1EVJA 3AI3A 5A3JA 4D3DA 4RZIA 4BNJA 1E3JA 1EUDA 1EVZA 3EC7A 3JSAA 2NVBA 3OIDA 3F1LA 3GG2A 1EE9A 2WWRA 3AU8A 6LDHA 1HDZA 1OOEA 3AOGA 1I33A 4QO7A 4PG6A 5ER9A 2DUUA 1N9GA 1ID1A 1I2BA 3C85A 1A4UA 1R4MA 1ML3A 2I67A 4HWKA 1DBVO 4D3SA 4H3VA 3JQGB 4E13A 3CZMA 4I9NA 4B4VA 3NDIA 3ABIA 4J2OA 1VJ0A 1HE2A 4I5FA 1EFKA 1RWBA 3T4XA 3VVCA 5T8KA 1A4IA 3PDJA 3LC7O 1ZSNA 1LTHR 5B37A 1U3TA 1PWZA 1NQ5A 1GFSA 5JO9A 1YL6A 4P8RA 2WTBA 2O4CA 1X7DA 1H0KA 3QW2A 4D0SA 4BGEA 3DMYA 3TRIA 2BRUA 1D7OA 3L9WA 4YJHB 3NGXA 5KVSA 3U49A 2G76A 2NLOA 3TL3A 2WSBA 2J5KA 3DZKA 4DC0A 2JHFA 3BMOB 2Q1WA 2NQ8A 2DU8A 3IP1A 3O8QB 1HWYA 4E4YA 3F5QA 1BDMA 4YDRA 3DBHA 4J91A 1LRLA 3DR3A 3D3EA 3HHPA 4CM3A 5JPIA 4J2HA 5EQFA 1D3AA 4KDEA 2CVOA 1DEHA 3P19A 2AMFA 4TROA 3WYEA 4E6PA 1DRWA 3RUEA 1GEEA 3V5NA 3KYCB 4JJIA 3JQ8B 3F3SA 4W9NA 5AXDA 3GNQA 2CZCA 5KJ1A 4ND1A 3FPLA 3KSUA 3UOGA 4ZGWA 3ZDFA 4UEKA 1ZEJA 2O3SA 3RC2A 2EW8A 3GZNB 3WDSA 4I5DA 2PKQO 2RH8A 2BFPA 3Q6IA 3DMTC 5K0ZA 4E5MA 2ZYAA 3NEPX 2EIHA 3DXFA 2NTNA 4EJ0A 5ADHA 1LA2A 5EN4A 1EE2A 1X14A 2LDBA 3ZHZA 2VUTA 2Y1OA 5THQA 4KUGA 3EZYA 2CY0A 2GDZA 2W2KB 3AI2A 2BMAA 1HLDA 1QYVA 3JQ7A 4PGFA 4O0LA 4W99A 5FYDA 3OJLA 1DXYA 2Y66A 1B3BA 3I4FA 5DULA 5A9SA 1VM6A 2PY6A 2H5LA 4IDFA 2HKIA 2J3HA 2GUGA 5B12A 4KUEA 2ET6A 4FN4A 1I3KA 3TPCA 3LC1O 4QX6A 2JKVA 4PG8A 3KUXA 2OHXA 4ZQBA 4IUYA 2P9CA 3I83A 4BNHA 3PJFA 5T64A 1EMDA 4CUJA 1IE3A 3ON5A 3LF1A 1EVYA 4IJUA 4IGEA 4FFOA 3QWBA 3S2EA 1F12A 2QZ9A 5TC4A 2CD9A 1LSSA 1E6UA 2VHWA 2YV1A 1PWXA 1MG5A 3HB5X 3LLSA 4ALIA 3AY6A 1H94A 2EP7A 4CUKA 4WUVA 3ONDA 5KOIA 2ZB7A 4CR6A 4D7AA 4NJMA 3WGOA 1O0SA 3RAJA 4CMJA 2OP1A 1ZBQA 3ROMA 4NJOA 3D4OA 1X7HA 1NVGA 1CWUA 1P33A 4IY1A 1T26A 1UZMA 4RO0A 2NU8A 2ZTUA 1MC5A 3EVNA 4OXKA 3VDRA 1U8XX 4O1MA 4DA9A 4NK4A 4NI5A 2O3JA 3AOEA 4CMEA 1A7AA 5IFLA 1Z75A 2NU7A 3BMQA 3KVOA 2IEBA 3WBBA 1P9LA 2B5VA 4OXNA 2X9GA 4RPKA 5CDYA 3IP3A 2NACA 4MO2A 5A9RA 3UCFA 3GVHA 3GOHA 1LDMA 1WLYA 1LSUA 4FB5A 4WOKA 3PJDA 3H5RA 4U7WA 1M76A 4B8ZA 2Q2QA 1JKIA 2D1YA 4MOWA 4C7KA 4CL8A 1U4OA 4R1UA 5CP8A 4CQMD 1C0IA 1LLQA 3OJFA 1YO6A 2YFQA 4IXTA 3MCVA 1HDCA 1LRKA 3JQCA 1MGOA 3RIHA 4A27A 4BMVA 1ZK4A 4LSWA 3NRCA 1UH5A 3HADA 1P74A 4IMPA 1IPFA 2X5OA 3UN1A 5KJCA 1BRMA 3ASVA 1PJCA 5EERA 5L7YA 4DQVA 3B1FA 3F6YA 2WYUA 3OSUA 3DZHA 2O3RA 4UVDA 3WGYA 1HE5A 4MP3A 5JLAA 4JGBA 5L53A 3C1AA 1CQIA 3LDHA 4NNJA 4J0EA 5ITVA 3RUFA 3RUDA 5AVOA 4FIZA 3DFZA 4N5LA 4E0BA 1L7DA 3E6AA 4CM4A 1XQ1A 1H6AA 3ADPA 2GNAA 4QFDA 1R37A 2PFGA 3ENNA 2CUKA 1N1EA 1Q1NA 5L51A 3WYCA 3BMNA 3PVZA 3RC9A 3WFJA 3RBXA 2YV3A 3DQPA 1P0CA 4MVJG 3PPIA 2NV6A 3PLRA 1T2DA 5KJ6A 3CH6A 1N92A 1JTVA 4FFMA 4B4OA 3M2TA 3E8XA 4EJ6A 2D2IA 1BXKA 3I6QA 3BZUA 4HY3A 3QLJA 4K6CA 4II2A 1DHRA 1PS8A 1G0NA 3GY0A 2DBRA 5K6AC 3WBFA 3ZWXA 1ISGA 1VLLA 4XIJA 3KM0A 1Z7EA 2C54A 3JD3A 4WLFA 3ZNQA 3WIEA 3F46A 2CVZA 4CQLB 3LYLA 4MJLA 5JXWA 5FWNA 4L0QA 1J0XO 4QO8A 3WWZA 2DFDA 5G0SA 4M8SA 5ICMA 3H9GA 2G5CA 3SC4A 3L4BC 3W8EA 2X0JA 2YQ4A 4Q9NA 3GEMA 3AUAA 1QYDA 3OETA 5I7SA 3AUTA 4G2NA 4NBUA 5K9ZA 4CPDA 5CEEA 2AA3A 4ALNA 1VL0A 3GMDA 1MXFA 3GH3A 3WSVA 5BSFA 1PQWA 1KVRA 1X1EA 3TL2A 3PXXA 5CDGA 3QHAA 4KWIA 2D5AA 2PGDA 2D4AA 5AXAA 1RJWA 2HU2A 3V2UA 3UW3A 4R3WA 1HZJA 3S2IA 1ZKMA 2AQ8A 3PQFA 1YONA 5JDIC 4JNKA 3TZCA 2BKAA 3JQ6A 3GAFA 3P5SA 1NBOA 1SB8A 2HK8A 3B20A 2PR2A 5JBIA 2WD7A 2Y1GA 2JD1A 4J3FA 2QRLA 2FWMX 4D44A 2EERA 3RFVA 3H9JA 1ENPA 2W8ZA 4YVFA 1VJTA 1EZ4A 3TFQA 2JCXA 5FEUA 2HK7A 3R6DA 5T8KC 1I5RA 3VH4A 1R6DA 3INGA 5DCUA 4AG3A 2R00A 2Z5LA 3PJGA 2J5QA 4PLWA 1A5ZA 5G0VA 3RUHA 4A5OA 5CEFA 2DKNA 2TMDA 4EBFA 2Z1NA 1WAMA 1X15A 2HK9A 3BYZA 4UVHA 1XSEA 4TKLA 1FK8A 1NX6A 4LN1A 4BO5A 2O3TA 1UAYA 3BMCA 3O4RA 1JN0A 3N7UA 3RKUA 1C0PA 1JDJA 4YJFA 5I9MA 1V3TA 4OSOA 4P22A 3KYDA 4PLPA 2QYTA 1I3MA 2JAHA 4BKOA 4NHEA 4CL3A 3P7MA 3LU1A 4J1NA 3PHHA 4CV2A 4O5OA 4GVLA 4R1SA 2GD1O 3OECA 5B4TA 3FWNA 3VKUA 2IXAA 1TXGA 3IMFA 3I52A 5HS6A 3VVBA 1HDRA 2DPGA 4DMLA 4Z0TA 4WLNA 1C1XB 1DIGA 3BA1A 3G79A 2FPPA 3ROQA 4TRJA 1V35A 4Q3NA 1UDCA 3R3SA 3TSCA 2D5CA 4RL6A 3H4VA 5DBFA 2DUWA 1VSUA 2DM6A 3C7CB 3JV7A 4RVSA 1YRLA 4LCJA 4R4JA 3AK4A 1U3UA 1ZW1A 1E6EA 1ZSVA 4YAJA 4CMBA 5BNIA 1DIRA 1E1LA 4PLTA 1Z7BA 2QRJA 2GRAA 3GK3A 3LK7A 3GRPA 1VKOA 5H83A 2F1KA 1IYZA 3DFUA 2XF8A 2GERA 4NZ9A 5BQFA 2VOEA 1Y8RA 3CZRA 1FDUA 3BTUA 3S2GA 4E2XA 4E5YA 3JCZA 1QYCA 1E0DA 1C0LA 4ZN6A 4MVJM 4R69A 2WYWA 2YHUA 4BO1A 4OOEA 3GR6A 1YOVA 2YDYA 3FSRA 2J6IA 1DRUA 2Q2WA 3WTBA 3ZNOA 4ONEA 4FFNA 4R68A 1UZNA 2P5YA 2J8ZA 4L9RA 3ZU5A 2VWHA 4XYBA 5JE8A 4R5HA 3DMTA 4DWVA 2EWMA 2TMGA 2PD6A 3I9LA 5F1PA 4KTVE 5HM8A 3HZZA 4ZD6A 5THKA 4PCVA 2G0TA 3RROA 3GGPA 3GHYA 4IJVA 3U4DA 4FGWA 3NJ4A 3ZWBA 1E7QA 1EBFA 4KQXA 4O6VA 1QG6A 4XIYA 1YB5A 4D42A 2I5PO 3NDRA 5JNLA 1O9BA 3X2FA 1H6DA 5A5FA 2EF1A 3QVWA 1NPDA 2VCYA 5BR7A 4UEJA 5AOVA 2B5WA 2JD2A 2Q49A 1O94A 3ORFA 2B4TO 1FDSA 2R6JA 4UVIA 1SB9A 5JMWA 2BI7A 1YE3A 1E3WB 3ANMA 4Q3AA 4OM8A 5FF9A 5IZ4A 5I8WA 3KLPX 3QY9A 3ZWYA 2VYNA 1LEHA 1R4NA 3JQDA 1HSZA 1ZXLA 4ZU3A 1WVGA 5JCJA 4XQGA 2ZYGA 4CV1A 4PZDA 3PIDA 1DB3A 3K5PA 4HX5A 2E6UX 3GN2A 3H65A 3D3WB 1YDWA 4F46A 4DBZA 2RIRA 4BKRA 1KBZA 4BKPA 2O7QA 4J9VA 3WGIA 1C1DA 4NMHA 1E5QA 1NQTA 2X9VA 4Q3CA 4E31A 1F06A 1M66A 2ILTA 5G4KA 5JC1A 3DONA 1DPGA 1LU9A 1NFFA 4PG4A 4ZA2A 3M1AA 4DYVA 4J4HA 1SNYA 4IBOA 4Q3EA 4BUCA 2P5UA 4J7CA 2JD0A 2OP0A 1NVTA 1P1RA 1PGPA 1WMAA 1YH3A 4RJTA 3AY7A 3I4CA 2QHXA 3DOJA 4KWHA 1GY8A 4OQZA 2BD0A 3MTJA 5H81A 3DTYA 2ZIZA 1E7WA 3W4KA 4AJ1A 1SPXA 1QV7A 1ULSA 1H5QA 4YB8A 1XU7A 1UR5A 3MJSA 1KEUA 2WE7A 3VOSA 5BSEA 3DL2A 2JFGA 3PHJA 1QRRA 2DQ4A 5COQA 5T6BA 4CMGA 1Z73A 4PZCA 1MFPA 3RQSA 4W4TA 4R1TA 1ZK2A 1Y8QB 2C0CA 2IZ0A 2BFMA 3B6ZA 4MIYA 4H15A 4BKQA 2CSUA 2CDAA 4NBTA 4TWRA 1ISIA 5DDIP 4WCFB 3ZWAA 2NU6A 1HDYA 3UF0A 2FSSA 1EDZA 5L45A 3GC6A 3HSKA 4YQYA 3PI7A 5TSDA 1N8KA 5C3MA 4JN6B 3UAGA 4E3ZA 2EHDA 3QVOA 2B69A 4G5HA 4TQGA 3EY4A 4J49A 3E82A 2B4RO 3QVSA 5L7WA 3D7LA 3QQPA 4WEOA 3WGTA 4XYEA 1FF9A 4R5MA 3F4BA 5EQDA 3JYOA 3MOIA 4IXWA 4XRRA 4B7CA 4DIFA 1Z45A 3DBRB 1MC4A 1B3RA 5I8ZA 5JC8A 3DDNA 3A4VA 3ZZNA 2IEDA 2UUPA 4RVUA 2NVUA 4CM5A 2VYVA 2Z1MA 4BNFA 4PLZA 5L7TA 2OBNA 4ND3A 3UGKA 4NK5A 4CM6A 1Q0QA 1HKUA 3D4NA 1OAAA 3ZU4A 3GGGA 4BGUA 3W8FA 2H1SA 2Y05A 1PR9A 2ZJ1A 5K6AA 4B3IA 3IKTA 3GVCA 3L6OO 5IDQA 1QP8A 4NFHA 4M1QA 1XELA 1KC3A 2WDZA 2IODA 1KYQA 4CR8A 4XRGA 3ITDA 3GVXA 4CMCA 5CG1A 1UXIA 2VHVA 1SOWA 4R9SA 1ONPA 1QORA 2RHRA 4YAGA 1XCBA 4R51A 5AQ1A 2C20A 3LQFA 3NV9A 4FGSA 3U3XA 4E5NA 3KXDA 2B83A 4CM8A 1EBUA 9LDBA 3PWZA 3GLQA 2HCTA 3C8MA 4PLFA 5I7FA 1Z74A 3PFFA 3L4BA 4ZVVA 4DPMA 3ANLA 5CPBA 2ZB3A 3GGOA 4BMSA 4Z9YA 1NPTO 1AHHA 2GZ3A 2I3AA 4Y9DA 4AICA 1MP0A 2WEKA 3AI1A 4DREA 3ANNA 4FFRA 4PLGA 2VHYA 4CLRA 3GDOA 3JD0A 3K6JA 4YT5A 8ADHA 2O50A 4Q39A 1Y1PA 4HXYA 1B8PA 5TLSA 2HMWA 3SJUA 4B3HA 2BLLA 4XQEA 2E49A 3NKLA 3JYPA 1Y9EA 4RZHA 3VPFA 1M6HA 3INRA 1DC4A 1E7SA 1SOVA 2G1UA 4K28A 3G3EA 1DHTA 4GBJA 4MKRA 4ILKA 1YB1A 4BNTA 4DIOA 4D45A 3OMLA 5JDIA 1GQYA 2FR8A 4CV0A 3HN2A 3G1TA 1Y6JA 2X86A 1G0OA 1AXGA 4MVJA 1LNQA 1VPDA 4BNNA 1GZ6A 1XKQA 4Z3DA 1NVMB 4XKJA 1ZIDA 3PEFA 1PJTA 4E21A 4BV9A 4TZKA 1I30A 4GX5A 2NU9A 3UCEA 4DBVO 4A7PA 3E48A 1ZEMA 4IIVA 4QQRA 1D1SA 2PZKA 4NPCA 3G49A 1LDBA 1JLLA 2AHRA 4AVYA 3DZJA 1NHGA 3LZ6A 3NT4A 1F14A 3A1NA 3F4LA 1PJ4A 1NAHA 4IDCA 1EDOA 3O38A 4QECA 1JAXA 1GZ3A 3LVFO 1DC5A 2YHIA 2DVMA 3GT0A 2OORA 5JO0A 2AQIA 1VE9A 1V6AA 1ULUA 3CTMA 4MVJP 3DO5A 1T4DA 1O5IA 4M86A 1GYQA 3PZRA 4HFNA 5CEJA 1TEHA 3RUAA 1W6UA 4FD3A 4TRNA 4XYMA 5F1OA 4A10A 4BO2A 1B16A 1BXGA 3FHLA 5ILOA 1H2BA 2ZATA 2AQKA 4IDGA 5U4QA 4NFYA 4WECA 1QYWA 2VYND 4UULA 1HDXA 4ND4A 1EK6A 3BTVA 4AFNA 2BGKA 2X0RA 3EYWA 4BB6A 1DDOA 1KEVA 2AEMA 4U0JA 5JCJD 2V6BA 1SAYA 1YVEI 2O23A 3DAFA 1O6ZA 5DBIA 3H7AA 4BGVA 1I01A 3B70A 1YQDA 3ROPA 3DB2A 1ENYA 3DHYA 4TVOA 1HE4A 3GEDA 1OI7A 1YBMA 5I9LA 1GQQA 4JBIA 3GUYA 2X58A 4GKBA 3CUKA 2NVWA 3ADOA 1Q7CA 4KP7A 5AXBA 2X22A 4BO4A 2RH4A 2EG9A 4OQYA 4GMGA 3ZU3A 1ZUD1 3PGXA 1A9YA 2P9GA 3RFTA 3F47A 4GSKA 1LLCA 1CERA 1KS9A 3FNFA 1I32A 3DBLB 3AM3A 1MFZA 5HBRA 3FNHA 4S3MA 4HBGA 4HP8A 2PD4A 1DO8A 5L40A 3VH2A 1MV8A 4BO8A 3HE3A 5B4UA 3KV3O 4E33A 3KYBA 3LT0A 1TVEA 1PIWA 3I1JA 3VZQA 1A72A 3VH3A 5IXSA 1D4FA 2WYVA 5HWSA 2UUOA 4QTZA 1WPQA 1LQTA 1UDBA 1R0SA 4N18A 3E1KA 2O4UX 4MKXA 4M54A 2Q3EA 1LBEA 1PZFA 3U0BA 4K9DA 4GVXA 1T25A 3QJ5A 1CETA 1XWFA 2W98A 3H2SA 4ND5A 3SX2A 1UAGA 2Q45A 1M2WA 2J5RA 3Q9UA 3IUPA 2VT3A 3FI9A 4INAA 4HKTA 3S1LA 5C37A 2X5JO 4DGSA 4XWYA 4BNIA 5TRTA 2GR9A 1I24A 1NR7A 1T2AA 4I9UA 4WLVA 1Z6ZA 3NT2A 4BNMA 2VNAA 3FN4A 4HNGA 2GSDA 3JQAB 4CMIB 1Y7TA 1VSVA 1NWHA 4PLHA 4EI2A 1EFLA 3ZWWA 1SO8A 1LC3A 4E2ZA 1HEUA 1DAOA 2V7PA 1LSOA 5DOZA 1WP4A 5KJEA 3VZPA 2VYVD 2HSDA 4OMUA 1BVUA 2B0JA 3PYMA 3ZH2A 5LC1A 4XD2A 2EGGA 4NQZA 3WJAA 1GDHA 4CMAA 1IB6A 1XU9A 2UDPA 3D1LA 1BW9B 1PJSA 3JQGA 4CLEA 1K2WA 3D4PA 3JYQA 3VHRA 4I9HA 1Y9AA 3C24A 2VUSA 1ORRA 3GN1A 3L07A 4RCVA 5A5EA 1PJ3A 1E7MA 3U5TA 3I9NA 1ZMOA 2YQ5A 1BMDA 2GN8A 4ROSA 2Y1EA 5IXYA 1VJ1A 2VZ0A 2AE2A 4GSLA 4YJHA 2Y0EA 4A0SA 2V6FA 3GZ4A 2OL4A 1NQOA 2DLDA 1PL6A 3RD5A 2Q2VA 1SEVA 2YW9A 1GTMA 1O8CA 3BMOA 3PP8A 3WS7A 3ZCXA 3ZHBA 3O8QA 4BS9A 2A4KA 3HDQA 3JD2A 5U1PA 3V2GA 4YAEA 3RWBA 4R54A 5JY6A 4XYLA 1N5DA 1DRVA 3IAHA 4L76A 4BO9A 3WMXA 3QWAA 2PNFA 3ZNPA 4JXKA 1KETA 4R16A 3DEYX 3HJAA 4IINA 1Q7GA 1KEPA 3KYCA 2HRBA 3KBOA 3JQ8A 1P1FA 5L4LA 4ZQGA 4RF3A 2HO5A 3ZN2A 1U2DA 3IUSA 4FFLA 4CMKA 2Q1SA 4B4WA 2DBVO 3T7EA 3GZNA 1DC6A 5F1KA 5GZ3A 1T2FA 1LC0A 4IIUA 4J7XA 1NWCA 3WTCA 4K26A 1H2HA 2PLAA 4HFMA 4MVJD 3WLFA 1E7YA 2O48X 3BAZA 1A9ZA 2W2KA 4FJ2A 2C7GA 1U3WA 4UUNA 4UVEA 4JP3A 1UZLA 1TT5B 2QRKA 5F5NA 2CDBA 5TNXA 1J4AA 1XGKA 2OBYA 3DZBA 4XJSA 3VTFA 3M6IA 1JVSA 1KIFA 1ISFA 2RAFA 1U28A 2Y68A 3MOGA 4IZHA 2B35A 4DPKA 3UH1A 3Q1LA 4LCEA 1JQBA 1U4SA 2BGMA 4BNLA 3UHAA 4OKNA 1H9AA 4RF5A 1GAEO 1V9LA 3V1UA 4C7JA 4PG5A 3LSYA 4Z6KA 1LXCA 4EEZA 4QFCA 3X2EA 3EZLA 4GL4A 3H3JA 3TWOA 3DZFA 1ZJYA 1CF2O 2EKQA 3SJ7A 4WASA 4CLOB 3ONEA 1QYXA 3HFSA 4MP8A 4L74A 2IYPA 5IG2A 3RC7A 3JYLA 1P1KA 4HNHA 5BT9A 3AFNA 2PZMA 4L4SA 3DBVO 4DYDA 1UP6A 1WXDA 4CV3A 5TGDA 3FWZA 1T24A 3U4IA 4KOAA 4QXMA 3ZV4A 2YV2A 2DTDA 1T1SA 4BV8A 1XIVA 2DBQA 2D3TA 2H63A 2JAPA 1PS9A 1RM0A 1U5AA 4BQPA 4PLVA 3OA0A 3HDHA 4QUKA 1JA9A 2VWGA 2Z95A 1DSSG 4BKUA 1C1DB 1E77A 4NU6A 4IDEA 3L6EA 3VKVA 4BOYA 2HDHA 1UXJA 1O95A 3PWKA 3K31A 3QA9A 2EGHA 4DC1A 3COSA 4Y98A 3I23A 1HYEA 4ZQFA 3H3FA 1E6WA 3W8DA 3AY3A 4KMSA 2VRCA 4AJNA 5BNFA 2C82A 2HMSA 2QW8A 1I8TA 5JW6A 3Q3CA 3I9JA 4AJPA 4H16A 3OJOA 3ZWPA 4DUPA 2AXQA 1ARZA 5A02A 4OOFA 3MEQA 4NG5A 3U09A 2J3IA 3ENKA 4KUHA 1M6WA 4LW8A 4IDDA 1ISHA 2O2SA 2QX7A 3IKVA 5TS3A 4RPHA 1M75A 4IQGA 4NDNE 3SBOA 4AJ2A 2FPGA 2CF6A 3UFXA 4M89A 4J43A 1MB4A 1UXKA 2WE8A 2YY7A 1KVQA 1WNTA 1UP7A 2EKLA 1D1TA 3ICPA 5LCXA 4EYEA 3Q2IA 1FDTA 4Y8VA 1OZAA 3KOUA 2VWQA 2Y0CA 3VTZA 5CDSA 2C29D 2GO1A 3WG9A 5MGBA 2C2YA 1AGNA 1XDWA 1YB4A 4E12A 1RM5A 5G0TA 4D43A 5ICSA 4FSHA 3V8BA 3K8ZA 4PG7A 1HZZA 1EVIA 1ZJZA 4DTIA 2W2LA 5J23A 2SCUA 3K2EA 5EESA 1EK5A 5BSGA 2C5EA 4IDBA 2OO5A 1FDWA 4PN3A 2FR1A 2D59A 5KIAA 4FOSA 1SCUA 4U0KA 1KVSA 4EEXA 1PJLA 4FJ1A 1IHXA 1XHLA 3LF2A 4RF4A 5TX7A 2NUAA 1LDGA 4YEDA 4MDHA 4PFJA 2GZ2A 3B1KA 1PR3A 2X0NA 3NX4A 1ZXBA 4BNUA 3KEOA 3KETA 3L4SO 2PD3A 2NQTA 1H9BA 1QKIA 2I3GA 1WZIA 3ST7A 3KSDO 9LDTA 1GCOA 1W4ZA 4CQMB 3BHMA 4WLEA 2AQHA 2X5KO 4CQLA 4FC6A 1YKFA 4FR5A 4YQZA 4EW6A 3GDGA 4JJGA 5KNLA 1JVBA 1GADO 2X7HA 4MIOA 3SC6A 5JS6A 3GG9A 2YUTA 4MVJI 4D0RA 3JD4A 1CJCA 3HB4X 3OH8A 3PHGA 2CNBA 1X0XA 3JQ9C 3KSZO 2PZJA 4QT0A 5IDYA 4L75A 4KZPA 4P4NA 4B8WA 3DAPA 4FDAA 2FRDA 1NPYA 3WGZA 4GGOA 4WNIA 5COAA 1YJQA 1GEGA 5CHEA 1K3TA 3ULKA 5TT0A 3QP9A 1YQXA 4ND2A 4Z3KA 4J6FA 2E82A 1DIHA 3PRJA 2X9NA 3ROKA 4XEHA 4XGNA 5GZ1A 4WOJA 1HE3A 3RFXA 4CR7A 1IL0A 3MJEA 3AM5A 4L8VA 4C4OA 1Y5MA 4FBGA 4GLLA 5GZ6A 3WGHA 1Q2XA 4U6SA 7ADHA 4I5EA 4YJGB 4H7PA 2Y1FA 4LRSB 1HT0A 4UUPA 3TZHA 4TRRA 1GPJA 3M1LA 3FPCA 1XG5A 1UXHA 4HFJA 3TF5A 1B8VA 3KO8A 1KY4A 2B36A 2ZJ0A 4EJMA 4BNGA 1ENZA 4YT8A 3WYBA 1PQUA 2POQX 1HSOA 2X0IA 1P45A 1Z82A 1TB4A 3NDJA 1HYHA 1YDEA 5JAMA 5BSHA 3UXYA 2F00A 3JQEA 4GX0A 4JX8A 4MINA 1V0JA 1A71A 4OHUA 3FR8A 3CIFA 1N9GB 2O7SA 2Y1CA 5F21A 4I5GA 1R4MB 1YL5A 2P4QA 1MXHA 3ZU2A 4WGGA 2ZYDA 3OFSA 1E1NA 3K73O 2B37A 4D79A 4ESOA 4J1QA 2QG4A 1J49A 1QLJA 1PU2A 1IULA 2X6TA 3JYNA 4XB1A 5IZCC 3L0DA 2GASA 1OBFO 3GEGA 1X13A 2QZZA 4KQWA 1PZGA 3PHIA 3WLEA 3CE6A 5AXCA 3W6UA 3NT5A 4B79A 2DPHA 3S55A 1ONNA 2AG8A 4XQ9A 3LT2A 5L4NA 4BGIA 1B15A 1P3DA 4N54A 4E5KA 3TZKA 2NSDA 3PQEA 4Q3DA 2G17A 1JKFA 3DBHB 3JD1A 4L73A 1C1XA 4YPOA 2ZTLA 3TFOA 1P0FA 5IDXA 2UV8A 5G4LA 5TIIA 4B7UA 1X1TA 3CSDA 3I5MA 4XDYA 2Q46A 1Y5RA 3QWFA 4Y6RA 3K92A 1ZK3A 3HFGA 3ZGYA 4GMFA 3NYWA 4U8GA 3WOHA 3S8MA 5DF1A 3OM9A 1Y81A 2P9EA 3PLNA 4EGFA 3RBZA 3ZWCA 4J7UA 2O2YA 1P77A 4A73A 3DWFA 4DQUA 3MJ4A 1W73A 4LRTB 1XYGA 3BHIA 2ZCVA 2OGUA 4AJ4A 1G1AA 5A04A 2C59A 2RHCA 4YXFA 1WMBA 3GHHA 4DXHA 1C0KA 2D0IA 4UVGA 4BMNA 3AWDA 5KVCA 4MVJF 1VL8A 4U5QA 4RORA 4AJLA 3CMCO 5L3ZA 3JQ7B 1KVTA 4RQUA 4O59O 4GKVA 3N74A 3H9QA 1I3NA 5C5IA 1HL3A 5A9SB 4OH1A 1LLUA 1ZO8A 2I66A 3Q0EA 4XR4A 3WNQA 1NTOA 2BELA 2VRCD 3UCXA 3MJTA 4BNVA 2HAEA 5JCXA 4II3A 2FP4A 3IC5A 2QQ5A 2CDCA 1H93A 1RM3A 1LX6A 1K6XA 1HF3A 2DT5A 1EEHA 1KOLA 3FNEA 1NP3A 5LDGA 4EUEA 3GPIA 2Q99A 2O3UA 2C5AA 4A2CA 1BWSA 3JQBA 4BHTA 1GUZA 2JCVA 4CM9A 3VDQA 4U6QA 1B7GO 2FZWA 1R0LA 3GMSA 2DTXA 1UXGA 4IDAA 1H6CA 1QR6A 4AJHA 3D64A 2HQ1A 4NJMB 4ZQEA 2O3QA 1GQ2A 1CQJA 1U2GA 5F3RA 1EUCA 3PFWO 4FFPA 5EINA 3OEYA 1R0KA 3E03A 3WGGA 5DZSA 1LDYA 3TNLA 2H6EA 3D5TA 1QXSA 1YS4A 1E92A 4JQCA 1RPNA 4FOOA 3FBTA 4R3NA 1HRDA 3R1IA 1E3WA 1KY5A 2FR0A 1Q7BA 3GRKA 2W2LD 2VHZA 3I9OA 1ZNQO 3QIVA 2XAAA 3CEAA 3BMQB 3H5NA 4D3FA 3WSWA 3HN7A 4FCCA 2CVQA 3OICA 2CMDA 3AFMA 3E5RA 3EUWA 2GZ1A 3F5SA 3L6DA 1LJ8A 5FFFA 1E3IA 3SVTA 3D3WA 4BO6A 3TN7A 4DVJA 1B26A 4J4BA 4L4RA 3ZWOA 1IHYA 3KB6A 4ZRMA 2WJPA 3O9ZA 4PRKA 2W4QA 3RKRA 4IJKA 1L1FA 2HUNA 2ZQYA 4AJEA 4ZICA 5JSFA 2E48A 2HRZA 3RCBA 4YT4A 5IN5A 1IOLA 3UVEA 1ADCA 4YA6A 1ZVMA 4UEOA 4RVDA 3HDYA 4J90A 3QV1A 1V3UA 2CF5A 4ALMA 4AJJA 4F3YA 3ZWNA 4W7HA 3MJCA 3ZWVA 3PTZA 3LLVA 2FN7A 3A9WA 3E9MA 5TT1A 3AM4A 2BGLA 5L9AA 2AE1A 1IZ9A 1F8GA 3BHJA 1LQUA 5HRUA 5FI3A 2Y1DA 1R15A 4GAEA 1PSDA 3VAZA 3Q2KA 2FMUA 1BG6A 4ALLA 4BNWA 3PIIA 1UP4A 3JQFC 1ISMA 1I0ZA 3OIFA 1S6YA 5A3VA 4CM4B 3PQDA 4S1VA 3BXXA 3SXPA 4NBVA 1BXZA 1Y8QA 3OIGA 3O26A 4XDZA 3BMNB 1YWGO 1JWBB 4BIIA 2VOJA 1K5HA 2HJRA 3WQQA 2IXBA 1HDGO 2EW2A 2JL1A 4TMFA 4YWJA 1A7KA 2BH9A 4WCFA 5JYEA 1N1GA 1P1HA 4YRAA 2OUIA 4DLBA 4YR9A 3T7CA 1E3SA 3E9NA 3ZW8A 1H6BA 4F45A 1LI4A 4UUOA 5EJ2A 3OHSX 1TI7A 3OP4A 4A03A 2OFPA 4KDFA 4JLWA 5IAAA 1P44A 3P2YA 4LGVA 4Z9FA 2Y93A 3DTTA 4E2WA 3DBRA 1JU9A 4UREA 4XJTA 4ZQHA 1SC6A 3WJ7A 2OMEA 1FDVA 3DHNA 3TOZA 5EPOA 3OF2A 4MPDA 1GYPA 3QWHA 3H8VA 1E1KA 1JAYA 2JFHA 4HADA 3RUIA 2WMDA 3TJRA 4GWGA 1RM4A 4X54A 4PVDA 1U7HA 2Q4BA 1U3VA 4R01A 1PGJA 1KVUA 3GQVA 4DLLA 4OGWA 4FQ8A 3WXBA 1YGYA 3S2FA 1F0YA 3ZV5A 4RPJA 1AN9A 2AG5A 4CM7A 5I9NA 3FR7A 1PEDA 3A14A 2FHSA 2Q1UA 1V8BA 4J0FA 3V2HA 5C7IO 1N7GA 1BVRA 2OXIA 4AL4A 3ETEA 4NBRA 4JCOA 3VPXA 4M49A 4JK3A 3D5QA 1I2CA 3EGOA 7MDHA 3JQ9A 3DC2A 1GYRA 3Q9NA 3AW9A 4HUJA 2P2SA 3ZW9A 3TDKA 1HTBA 1T4BA 3R0IA 2WD7B 2AEJA 3K96A 2HMUA 1CEQA 3RI3A 3MJVA 3QRWA 2I9PA 1U5CA 2BFOA 3ASUA 3Q11A 5F5LA 1UUFA 1T2EA 3AUUA 3WB9A 5T5QA 4BL5A 4W6ZA 2PGLA 3FTPA 2YZ7A 3TZQA 3U62A 3GNTA 4OO3A 5HA5A 1RYEA 4LK3A 3IIEA 5JAZA 1E7RA 2IZ1A 4GLOA 4YRDA 1IY8A 5T67A 2NNLD 1B2LA 5KVQA 5AYVA 3G0OA 4TKMA 3HG7A 4WJZA 4XZ3A 1GV0A 2CFCA 3B1JA 4PLYA 3PWSA 5DN9A 3PHLA 5I7EA 5EL0A 3QWIA 5DNAA 3BMCB 4W7IA 3FD8A 3RU7A 1NM5A 2FSVA 4R9RA 4F6CA 4YJFB 4E2YA 3KYDB 3ITKA 3PZBA 2NM0A 4XGIA 1YL7A 1LDEA 3CXRA 1NHWA 3OQBA 1TLTA 2B4QA 4J16A 4K1LA 3G17A 3VZRA 5JDCC 4BNYA 2VZ8A 3IS3A 1DLJA 4IS3A 2C7VA 2I6TA 1ADBA 4GX1A 4L4XA 4G81A 5JAIA 3QSGA 2VTEA 1Q0HA 2DAPA 4LVCA 4M55A 4WEQA 1LSJA 2PTGA 1K6IA 4TZTA 1NXQA 2GGSA 4ALKA 4CM9D 4JJFA 1R16A 4GQAA 2NADA 4DPLA 4HFRA 3UUWA 1IUKA 3GA0A 5IZCA 2NTVA 4JBHA 1E3LA 3C1OA 2ZCUA 4M87A 5JMPA 5MDHA 4D41A 3V1TC 1GD1O 5CDTA 5DT9A 1HDOA 3C7DB 1M67A 3A06A 1NASA 2I76A 1F8FA 1GPDG 3C3XA 3PGJA 4WPGA 3RJ5A 4J4TA 2RBEA 4MKZA 3RU9A 2QYSA 1J5PA 5C7OO 2E37A 3U4CA 2ZKLA 4AJOA 5BNTA 1SMKA 4I8XA 1I2ZA 2OOSA 3IL2A 3EMKA 1C14A 1Y8RB 4PLCA 3P2OA 1HXHA 1QLHA 1I3LA 3STHA 1GUYA 4NH4A 5HTOA 2GPTA 1B14A 4EDFA 4J9UE 1KEWA 4IZIA 3JQBC 1OFGA 3C1TA 3ETDA 4NR0A 1YOVB 2YJZA 5KKAA 2X4GA 3ZNNA 2I99A 1PGQA 3RSHA 3TOXA 1L7EA 4ZJUA 3WQRA 5CG2A 4NBWA 3SEFA 1LDNA 1MA0A 3KRTA 4ID9A 2YYYA 4MVJH 3L9XA 1PS0A 3C7AA 3E18A 1VRWA 3L77A 2Y67A 3CMMA 4IMRA 1IZ0A 3GVIA 2VNSA 4FPXA 3WIDA 1U7TA 2PV7A 4XA8A 1CRWG 2VTDA 2P68A 1WWKA 3IJRA 4XQCA 2FOIA 1NNUA 1JWAB 2EXXA 1QMGA 3DBLA 2JHGA 1BSVA 5TF4A 4JBGA 1E5LA 2JCYA 1PQPA 4BNKA 3IOYA 3EW7A 5JY1A 2GN6A 3HUDA 5ILGA 3I6IA 1X7GA 4FJ0A 3W4JA 3OQ6A 1YXMA 1E1MA 3EAGA 4GPD1 3DZGA 2XXBA 3WR5A 5A1TA 2R2GA 4YBZA 5EMHA 3HNPA 1TT7A 3PDUA 3VPGA 4RLHA 4DQXA 1R4NB 3HQ4O 5B1YA 1DC3A 1TA4A 1KC1A 2Q50A 4Y6PA 2DC1A 1D8AA 3LC2O 1OC4A 4RDIA 2J3KA 1GUFA 4RQTA 4XX0A 4YRBA 2PK3A 1C3VA 1YBVA 4BNXA 5HS4A 5ENDA 1BGVA 4DL9A 1ADFA 1WW8A 4F6LA 3H2ZA 2VUUA 3HDJA 1P1JA 3HWRA 1LRJA 5G4KB 4WNCA 2BF7A 3WX0A 3LT1A 4RVGA 2G82A 8LDHA 3GDFA 4RF2A 1W0CA 4JROA 5TQVA 1MX3A 3UKOA 3I3OA 4N5MA 3RVDA 3KLMX 3JQAA 4CMIA 2X8LA 2JJYA 3EK2A 4WLUA 5KTKA 2I65A 1N7HA 1CIVA 1F17A 1P31A 3NTQA 4RPLA 3GF4A 1S7CA 3K2BA 4Z0PA 4UAGA 1PL7A 3GPDG 4WCFC 2C07A 3QVXA 1I36A 4CLHA 3GFBA 2UAGA 4GGPA 3EVTA 5G0UA 1BW9A 4HV4A 2FPIA 1UJMA 2PH5A 2Q4EA 3H5AA 4N5NA 1E3EA 2OZPA 4JP2A 4WCDA 2IDZA 4BO7A 2VQ3A 4CLDA 2ZTMA 1RYDA 4YT2A 2D8AA 1ZK0A 5B4VA 4OXYA 1MLDA 2X23A 5ER6A 1SEPA 5DP2A 4W9NC 2VWPA 1WDLA 2UYYA 1B8UA 3BTOA 1NFRA 1ISJA 2WD8A 4DLAA 3T4EA 5KKCA 5C7LO 3OA2A 2XPCA 4RVFA 2EEZA 4W82A 1Q0LA 2NWQA 3NGLA 5A03A 5CDUA 5IJZA 6ADHA 2GYYA 3FBGA 4OSPA 5IF3A 2WM3A 3D0OA 4BQRA 4OL9A 3WMWA 5L95A 3TZ6A 1WZEA 2X1HA 1R12A 1J6UA 3JQFA 4RV9A 5JAQA 1GU7A 4RPGA 1DJQA 3UICA 4P4GA 4OAQA 4PVCA 2VN8A 3OBBA 3KTDA 3TQHA 1K89A 5T57A 4AJIA 4XB2A 4YYZA 4MIEA 2LDXA 5U9CA 4PZEA 4NFSA 3GVPA 1ZK1A 1PGNA 1DFGA 3NAQA 1DIBA 4LVUA 3LT4A 3QE3A 2IE0A 2PWZA 3DZIA 2NVUB 3WICA 3H9UA 3DOCA 2Q1TA 2ZQZA 4LSMA 4CODB 1MUUA 5LDHA 3DAGA 2EJWA 1PZHA 5ENVA 1PTJA 1YQGA 3K30A 1GR0A 4YTEA 1ZCJA 5H82A 5FI5A 4ZRNA 3AUSA 3U9LA 3U4HA 1NYTA 3NTOA 3K9QO 2A92A 1ZSYA 1NFQA
chains in the Genus database with same CATH superfamily
5DYNA 5BSKA 5CA1A 4LOLA 1WS6A 1GZHB 4UATA 2XZDA 2YFHA 5GTDA 1KDZA 2H1LA 2CV2A 1ZA1A 3EVDA 1ULTA 1A7JA 1WB5A 3NTXA 1YI8A 3KR1A 1SUIA 3P52A 1VL6A 3FIJA 4ZO7A 5FQOA 2CLHB 3OZGA 3U44B 3RBVA 5AP9A 1WBJB 4CLXA 4OKIA 1BHJA 2C2XA 4UC0A 1H3NA 1AF4A 1A0OA 4GT1A 5EEHA 3GD7A 4K6FA 3EQZA 3PTLA 4LVNA 1U0LA 2E6KA 5F2KA 1GVNB 2FG6C 1EXDA 2OV1A 3FRJA 3U7IA 4BP3A 3QVTA 3UY4A 2CKDA 3AOEC 3JTEA 3M3HA 2PGJA 4P38A 4ZODA 4GH5A 4QODA 3F8WA 3G5AA 4XWKA 4H08A 5CT8A 5KDLA 1UMCA 2A35A 2Z5VA 3CQ9A 2CV0A 1AXEA 3O74A 4QPPA 1FP2A 3RO7A 1NQXA 4P3PA 5KTOA 2D00A 4RVHA 5FBRB 4AO6A 3E9DA 1K92A 1PW7A 3WLHA 1OMOA 3CKYA 3Q3VA 1BOOA 2DBZA 4AN1A 4BLSA 5JADA 4ASUA 1D2MA 8OHMA 1DTWB 3GWZA 4J1TA 3SQNA 3DBOB 3FF4A 3FCOA 4Q34A 1L4LA 1ZH8A 1EX7A 2HIHA 4HUQA 2XMGA 5C8ZA 1F20A 5CFZA 4PRLA 2R8XA 8ABPA 3B38A 4IQ8A 2O2XA 2CXPA 2REBA 4H18A 5A5DA 1WQ4A 3UWPA 4J16C 4ZHSA 4OAOA 4PPFA 3IRVA 4KKVA 4X7MA 1RXWA 4BC1A 4LC0A 3KFVA 1ENOA 4AICA 1YQUA 5CLGA 5CD1A 3KEGA 5COBA 5EHXA 3PQCA 1JW9B 3THWA 2WK1A 1P7WA 3IGFA 3OPYB 1A27A 4Y6SA 1GCUA 1JQDA 1FQWA 4B2IA 2PH3A 5FPTA 1KP2A 2A9FA 1AHNA 5IULC 3W5CA 3AUJB 3OZEA 2EV9A 4UPEA 1XCJA 3O3MB 4R6XA 1F3LA 2X2OA 3DFKA 5BV2P 4URFA 5KCZA 3WYNA 5EUBA 3SS8A 3FOWA 1EJ2A 2ZS8A 5AKLA 4A3SA 1T1RA 3WTBA 3UJ8A 1CFJA 5K3OA 2FY8A 3H2KA 3VPSA 3ZLBA 2H4XA 4QUAA 2IIQA 4CL0A 4IQ0A 2WKWA 1LUAA 1YVUA 3KE9A 5EMLA 3ZY2A 3KAQA 4OREX 3WL4A 4BTLA 5A06A 1RRCA 4IGFA 1IATA 3I2JA 5CB8A 2ZW9A 3P0FA 4BFVA 4ER6A 1N0WA 1M8PA 3E15A 1XTIA 4Y2HA 1AHIA 3A1FA 3SAJA 4OI1A 4L50A 3ZOKA 3H87A 1W5FA 3FPGA 1WU8A 3IAFA 5ED0A 1KO4A 2GF2A 1YS6A 2WHYA 2X76A 2GKOA 2YHIB 3EH1A 3LPCA 1OFHA 3KC2A 3KZVA 2VZ9A 3ZK8A 1AJEA 4YRPA 4U7JA 3VJKA 1QO9A 1VLQA 4LS3A 4YUWA 2W8BA 3GP5A 2BP7A 2BI8A 2AUTA 2JGAA 4GX2A 3SLGA 3W5AA 3CH7A 4L5BA 5K0FA 4JYAB 3FVWA 2VZEA 1P1IA 4L4UA 1AE1A 4Y2QA 1EFAA 1JSRA 4E1AA 2XUOA 2FYTA 4YRIA 3TIFA 2JJ1D 3UPDA 4F5DA 2ZB4A 5EJ4A 5JDCA 1OLUB 1PEAA 3DOEA 3W2TA 4MKHA 4PFKA 2PKEA 3QPDA 2VAWA 4LE1A 4FHCA 4PF1A 5DOVA 5A7HA 2ZSFA 4MA5A 5KKNB 4X6UA 1CTQA 1QBKC 1TM4E 1I80A 2ETXA 3HBAA 3OURA 4CKCA 5EE0A 2PUDA 5JT1A 2GM9A 3AVUA 3OJEA 4JVMA 1OZHA 4FD2A 4RJJA 2OQIA 2FZEA 2C8KA 2VRBA 2VTVA 2XXJA 4P1ZA 4YO7A 3I64A 5KNCA 2FFBA 1BDBA 1AO3A 2J9YB 2RJOA 2QIOA 1RD4A 3FYSA 3VV2A 1TZCA 4QSHA 2DECA 3OQ1A 3OJ0A 4NVRA 5CTJA 1NZFA 2Q6LA 4L8GA 4P7GA 3E9RA 1HLPA 1P2SA 1PTKA 2CMHA 2RG1A 3A2MA 3EUFA 3AVQA 2IUTA 4JOSA 4EX7A 2PKXA 1WHTA 1JDPA 2ZI7A 4QKQA 1XQ6A 1F7VA 4FP9A 3QEOA 1M0EA 1HURA 1JJAA 3I8OA 1DFIA 1S01A 2BFAA 2FSIA 2WVJA 2WJZB 1RAEA 2R87A 2VT2A 2WPDA 2ID4A 4DR1B 3W77A 2OBBA 4Z9AA 1T10A 3MINB 1GPAA 3RC1A 4BX3A 3DXYA 1EFVA 3D3NA 1PL8A 3NHSA 2KJQA 4X6XA 4CW7A 2AKEA 3LWNA 3PT5A 1R9GA 1T5TA 3MD9A 3D54D 1QSGA 3ELUA 2P91A 4MJXA 3WMEA 4ES6A 4O2BB 1EQUA 1E1RD 1UAAA 1KERA 1RKXA 1FVFA 2YINC 3U48A 1JIXA 2XECA 4MI6A 3V7UA 4XWGA 2GS9A 2QDKA 3BWXA 3B89A 2DTEA 3MF4A 1B6TA 4BJ6A 1B00A 1M2HA 2AHOA 3FMGA 2NOAA 4QXOA 4DIBA 3C87A 4TQAA 4Q3BA 5K4HA 3QX3A 3DHEA 4RTQA 2WWTA 5A4DA 2O8DB 2DJ5A 2GBLA 2F6RA 4GWKA 3NTUA 1NQAO 5AI9A 3WLIA 4EKYA 5K20A 4TYYA 5ERGB 4N82A 2ZSDA 2V7GA 1USIA 3N58A 4UUBA 2PAFA 3LUAA 2CUTA 1PJ2A 3BERA 3GMIA 3GFVA 1G6Q1 3PYXA 5C32A 3H9CA 3MMZA 2Z04A 1LLDA 4WXPA 4REQA 3SHOA 1QQAA 3PXCX 4QOIA 4DAOA 4RESA 4PC1A 4RFSA 4D8TA 2WF8A 5JFGA 4B7XA 2WABA 1R8XA 4QVKA 2IYRA 3H9EO 1PJQA 1Y5IA 2ZTVA 1ABEA 1QDLB 2I8CA 3ZTYA 4KIUA 1D0VA 1Z88A 2QRZA 3VGPA 2V6IA 3NLLA 3NTRA 4JSYA 4QJBA 2ZBFA 5ITWA 4M4SA 5KDOA 3IALA 4ZP1A 2W90A 3VSAA 4N4AA 4DRYA 2C5FA 2IYLD 2WJYA 2XNCA 2Y8EA 5HUHA 3J81k 5BW4A 1E5XA 4QNNA 4RZIA 3MCWA 3OLZA 2IYUA 4BNJA 1E3JA 4DV5B 1IONA 3EC7A 3G6KA 3A6FA 1O96A 3QTLA 1N2XA 1YMUA 1VI5A 4FILA 2HA5A 2AUMA 3ZBQA 3H05A 5ETJA 4YJ2A 4LF5B 3FYUC 1EE9A 1Q0SA 3O93A 4BVJA 6LDHA 1KEEA 1ZIYA 1I33A 1DS6A 3FUTA 3GNLA 4XUCA 4ZOBA 4PG6A 4YECA 1E0JA 3T5GA 4QBFA 2Y0PA 1KE1A 1LPOA 2WWXA 2NZYA 1NXXA 1JQKA 2YBDA 3OX4A 1QFXA 1QB8A 5B1SA 4GKJB 2ASVA 4FB4A 3IQHX 2QORA 3OSZA 2FOXA 2ZR9A 3VJMA 1DBVO 4M76B 3ZWQA 4E13A 4W5RA 4I9NA 3R20A 3NDIA 3ABIA 3LFHA 4ENVA 2WHQA 1W4RA 2VK4A 3O21A 3VVCA 3EARA 3GZJA 3IXMA 3K3PA 4JI1B 2VQ6A 3HSSA 4L8FA 1LY1A 2RGCA 2WOOA 1LTHR 4K2AA 2PSEA 1PWZA 2E18A 1LGYA 1ND6A 1GA1A 1H0KA 2OFFA 2GMWA 4DV7B 4D0SA 4KJXA 4M1YA 4BGEA 1DBIA 1E6LA 4HAVA 4LG1A 1OWMA 4C0XA 4Q0MA 3I32A 4YJHB 2GEKA 3BFPA 1LK5A 2ESRA 3ESYA 2NLOA 3W8NA 4OJTA 5EP4A 1SVIA 3SFTA 1XKLA 4ZYLA 1TK3A 5IVKA 4DC0A 3BMOB 5EXSA 4GPEA 4GFDA 2V55B 3OKPA 5CLJA 5KNBD 4W9RA 4LK2A 2HA2A 4C4AA 1VLHA 2OAQ1 2XQFA 4E4YA 1XMOB 3DBHA 3AJ8A 2NG1A 1YQWA 3BILA 3LYAA 1UOQA 2JGFA 1QJCA 3ET5A 4LXHA 4N12A 3ZZUA 4C76A 7REQB 1BYIA 1T0JB 4K46A 5EQFA 2XDQA 1D3AA 3OTWA 4KDEA 4LGCA 1JPVA 4Y30A 3T6KA 4E51A 2QSYA 2AMFA 2R751 3WYEA 3X2SA 1DRWA 3H8JA 3DUWA 3AEKA 3KVRA 3M5CA 3RUEA 1I6KA 2R9VA 2PH1A 2JAOA 3JQ8B 4WK0B 2PMEA 4EGQA 4ZHQF 2MYUA 4TLAA 1A9SA 5AXDA 1EFPB 1K9VF 3CH4B 3FHJA 4ZVTA 2CC2A 3UOGA 1P0IA 2J0QA 1V1RA 1P2BA 4HJXA 4B6OA 1H8EA 1ZEJA 2FN9A 3FFTA 1S8AA 2MMCA 3OZVA 5EHIA 3C6MA 1DJLA 4I5DA 1Q19A 4F2DA 5P21A 4OI4A 1KJJA 1E9FA 1F2DA 1WCIA 1P8AA 3HJCA 1R7RA 4X3PA 3OJXA 2GYWA 1JDBB 2XWQA 3GX1A 1KSHA 4QL3A 3LY5A 3ZHZA 1JLSA 2Y1OA 4Q7EA 3EGIA 5THQA 3KKOA 3EG5A 1UKBA 2WB4A 3EZYA 3AI2A 2W2KB 2QD5A 2BMAA 3JQ7A 5FYDA 1YNOA 3T5MA 2YZGA 3FROA 1T9GS 2P27A 1DXYA 1UC9A 1P2DA 2QG6A 1E5TA 2Y66A 3I4FA 5DULA 4IDFA 2GA9A 4ENQA 1QTRA 4B6QA 2DHQA 2J3HA 2ISCA 3AHDA 3T1HB 1MDBA 2ET6A 3B60A 3TPCA 4AZVA 1D4ZA 1GQOA 1XTTA 2JKVA 3KUXA 3HKBB 1CUZA 4OUDB 4ZQBA 1VDMA 2C4WA 5FL3A 3WSTA 4EFMA 3I58A 3E2IA 3ON5A 4DUYB 4KQIA 2AOTA 3S7TA 1EVYA 1Z5VA 3TIXB 4LF8B 5FNZA 4MJ3A 5CYPA 3KZXA 1YUNA 4NPAA 4KO8A 5TC4A 4TKVA 2ZRJA 3LCJA 3LLSA 1PV2A 3UKJA 4AG5A 3S1SA 4YRGA 1KBQA 1OTXA 4HC4A 5F5XA 1CZUA 4WUVA 3ONDA 5KOIA 5KYKA 2R7AA 5AW9A 4CR6A 4NJMA 3WGOA 1UPXA 1KJZA 4MS1B 5GGYA 2OP1A 4B5KA 4CMJA 4DLRA 1ZBQA 5GONF 4R71A 1B2RA 1TCUA 3TW8A 3D7MA 5AH0A 2XVAA 4QYTA 1TEVA 1CLUA 4MWSA 2VLIA 3B85A 4V2IA 3Q0IA 3KKEA 4KRFA 3CB2A 2HI0A 3UUGA 1F7UA 2JGRA 2X0FA 1HQKA 4O08A 4NK4A 3UH0A 3HVJA 1EWKA 3PS9A 2PGXA 3DV0B 3M6MD 3PUVA 1HMPA 1M33A 4IOJA 4RD0A 5D7BA 3UK1A 1SQ5A 2NU7A 2HF8A 4US1R 4K03A 1OYWA 4OJYA 5JQGB 3KVOA 4UE3S 3QMVA 1CUWA 2XQGA 3NVMB 1PYGA 2M2IA 4HDQB 1A8PA 3HU5A 4OXNA 4RPKA 5CDYA 1XF1A 2H2GA 2NACA 3AFIA 2CUNA 2GPBA 3I04M 3OBIA 3OHMA 4QT4A 2ZQ5A 4OSEA 3UCFA 4LYYA 5HM6A 5F64A 2OBLA 2I9KA 1FFHA 4P5DA 2B3DA 4MWTA 4N0EA 3DLHA 3H5RA 3IPXA 2OWDA 3UJ3X 1IRXA 1AURA 1DAHA 1WF6A 2NMVA 2IC5A 3G9QA 3DC7A 1E2NA 1GA4A 2I03A 2XWBF 3KZCA 1PCXA 4WZBB 2FPGB 1SBNE 1U4OA 4BE9A 1JXMA 4PAQA 4GO1A 5CP8A 4YPFA 1LNZA 1YO6A 2GD6A 2YFQA 1A77A 4FCWA 1GJRA 2I4MA 1FY2A 1MGOA 3JQCA 3RIHA 1O77A 2Y2UA 3AQIA 4LSWA 5EGNA 4EY3A 9ABPA 2QY9A 5F23A 1UH5A 3GT3A 1IPFA 4B2LA 3HWSA 3F4KA 2O54A 5ALXA 5EERA 3DL0A 4IO0A 1QCCA 2AVNA 1VE3A 2ZIVB 1K8RA 3ZJ4A 3QOFA 4BRWA 4LTNA 1XVUA 3EXEB 5CLFA 3QA3E 1CHNA 2O3RA 3WGYA 2F43A 4HWPA 1HE5A 4DWOA 5EZ5A 1FFBA 1H4QA 1SCAA 2NAFA 3QH4A 5AVOA 4E0BA 3DFZA 4N5LA 2JKZA 1CJVC 3E6AA 1K63A 1W5SA 3VNUA 2C04A 2PFGA 2QTTA 1FLAA 1LX7A 3UB3A 1N1EA 2B82A 3E84A 3HXTA 5L51A 5IRCD 4JLNA 3F8TA 3PVZA 3WFJA 2XKAA 1RRGA 3FB4A 1E2LA 4H60A 1R0YA 2XQJA 3DQPA 2H51A 3C98A 3CNLA 3DVRX 1SVLA 3FDZB 4IAOA 4FNOA 1E20A 4JL8A 4MVJG 3V6MA 2PMBA 2PZGA 1N2IA 3PLRA 4B6EA 1KOJA 2C4NA 1GPYA 3IQXA 4ZOAA 5KJ6A 1N92A 1GSOA 3D6TB 3M2TA 2C2KA 3E8XA 4HAYA 2YZNA 3R6GA 1ZGJA 3I6QA 3PFNA 3D3KA 3OLXA 1D07A 4ZVPA 2GJSA 4YRCA 5B36A 2QQEA 2QRMA 4K3UA 4F85A 1KZ9A 2D5LA 3KQWA 1GGVA 3WBFA 1WTAA 4TGLA 1U1FA 2JNWA 3AHCA 3CRZA 4WFKA 1OJLA 4Z4QA 1NW4A 2DERA 1JXOA 4C6SA 1U81A 1Z7EA 2C54A 3KM0A 3H2BA 5GVRA 2EYUA 3CISA 3F46A 5CURA 4CQLB 2BI4A 1ZDMA 2CXRA 4FYJA 5JXWA 4QTTB 1Y3BE 4L0QA 1K8YB 3EZ6A 3LNTA 5AKKA 1LPMA 2JJMA 3Q85A 3WWZA 2DFDA 2FZCA 4N6OA 4XFDA 4YUZA 1OH7A 3GFOA 3QKRA 2ZP1A 1X77A 5K4GA 4O4JA 1WSWA 3PV0A 2QRNA 2ZROA 3LL4A 3EXG1 3PUZA 1JHUA 4LDRA 5FJIA 3RRJA 3SC4A 2ZJ3A 4F5ZA 4AUMA 3V4RA 4JOQA 3GJSA 4MQ4A 4TTJA 1B0ZA 1SIOA 2OCLA 3HP1A 4QARA 5FBZA 3T7DA 4FGKA 3QBDA 4BJHB 1ODCA 1BEUB 2H11A 5I7SA 3EVZA 4P3YA 2A0KA 5C7YA 3ITNA 3P96A 5CEEA 1P7ZA 5K3FB 2FXVA 1AQUA 3DVSX 1ZGBA 3GH3A 3GMDA 5KTRA 3FETA 3WSVA 2C4VA 5BSFA 1KVRA 2H8GA 3ZK9A 2XKJE 2G04A 1BH2A 3HUUA 2E4WA 4GNKA 3WL3A 4G5QA 1SVOA 1WUYA 1UC4B 1BX1A 1YAHA 5FV4A 3I05A 1B8NA 3BA6A 2Q3CA 4N5DA 2WM2A 2Y4OA 1SQSA 4MPPA 3ZC3A 4AZSA 4I7EA 4A2PA 4D9MA 1UM9A 2CNWD 2P62A 4EL0A 4LFCB 1CE8B 5BN3B 3QPBA 4GZ3A 1T8SA 2AQ8A 1GZ5A 1H3FA 2BSXA 1YONA 2C8LA 4JNKA 2PG3A 3NV7A 4TL7A 3JQ6A 3GAFA 3P5SA 4ED9A 4UCFA 2XLCA 2Y1GA 5I7UA 4Y9TA 4EQ6A 4J3FA 4JI0B 2QRLA 2JFUA 5HE9A 3PD1A 4D44A 1P60A 4D0LB 1OWOA 2XEXA 4Z4CA 2H4ZA 1KAMA 2NP6A 2A0WA 4K40A 4WCVA 3ZZ0A 2JCXA 3TX6A 5LBUA 3R6DA 1TYZA 4OK6A 3SKYA 2IZ7A 4WNAB 3TXYA 1IY1A 1T8RA 3JW8A 5AW0A 5LUAA 2OK8A 1Z2DA 4XM1A 2BAGA 3U39A 4PLWA 3WKDA 4ZOQI 2YR0A 1H2XA 3RUHA 2P2GA 4L6IA 2DH5A 5CEFA 1G16A 4LE0A 3CKLA 1G8YA 3A9CA 4F8EA 2P6RA 2F8SA 4KPFC 1NSTA 3ZQ4A 2JFYA 1XSEA 3EEYA 4GBMA 2I29A 3FI0A 3SXUB 1NX6A 1VMAA 2D06A 3FDJA 4P7BA 1CB7A 2Y2VA 4I9GA 1WO8A 4EY7A 3UA4A 3N7UA 1CUHA 4UW9A 3RKUA 4MW5A 1JDJA 5JU6A 4YLEA 1PLJA 2XRFA 4YJFA 4A6EA 1V3TA 4ER5A 1T15A 2O7NA 1YQEA 3A3YA 3MOSA 2OD2A 2V45A 3JVVA 1NVFA 2G36A 4X0EA 4GM1A 2P67A 3G5TA 2VQEB 1O5OA 3G85A 1GT6A 3F74A 2J3QA 4ZVKA 5BQ5A 1KOGA 4PQRA 2XZLA 4AMZA 4FLFA 2DB3A 5ALVA 4R1SA 4P32A 1Y8ZA 5ALYA 2X8JB 3AF1A 1V7ZA 2IXAA 2ZS7A 1HOXA 2JLVA 1OREA 2DPGA 4O2AA 3EZ7A 1YVDA 3HH8A 1C1XB 3GLVA 3ICOA 3PHCA 5F7JA 2W58A 4IP0A 2BCGY 2EJTA 5AESA 3G1WA 3G79A 4JI5B 2YOHA 3HL0A 1XZQA 3TSCA 1J2UA 4HGOA 5MFZA 1R6AA 3BBPA 4P80A 4CT0A 3CG4A 2DUWA 2OZKA 4EK9A 1VSUA 2GJ4A 3HGQA 3VKFA 1Y1RA 2EZUA 3JV7A 4PONA 4Y6QA 4G0NA 4RVSA 1RXUA 3V3TA 7YASA 5JSUA 1UBUS 4RFVA 2ODQA 4ZXFA 2RHMA 4EYQA 2IXEA 3P9ZA 1HMYA 1RKUA 2QL6A 1E6EA 3ECAA 1TM5E 3MHPA 1DIRA 2C9YA 4HF7A 3K15A 3Q8KA 2OCPA 5FPSA 3GCWA 2A5YB 3GK3A 4IDPA 1Q14A 2LCIA 3AR4A 4TT3D 3AVTA 3GRPA 5ARCA 4HSGA 5AHWA 3JATA 2F1KA 1NNEA 4X24A 1Z29A 4OLFA 1RQGA 5DW3A 2GERA 1A9PA 2XUIA 4HJRA 4FNMA 3HFJA 3RTGA 4MLDA 4KPGA 4YGYA 2PXCA 3ZI4A 1VLJA 1BO6A 4IIBA 4D9NA 4E2XA 4OEHA 3BUSA 4Y1GA 3GLFA 3I04A 1E0DA 2PVPA 4NYIR 2YHUA 4F2GA 3G7NA 1WZUA 3HVHA 2OVFA 4PAGA 4UNPA 4ITRC 1T2VA 4D6YA 1ZL2A 4HBZA 4X44A 2J6IA 1DRUA 4G85A 4RSRA 1S3FA 4QULA 4OJMX 5EJ5A 2C2MA 2OR3A 4KXNA 1UZNA 4WTOA 2QMZA 2P5YA 3DDCA 2J8ZA 3G2IA 4B87A 2BKLA 2JZCA 1Y3DE 2VWHA 3DR5A 3OZ7A 4A0HA 2A1UB 3PC3A 4HCJA 2TMGA 2Z2YA 2ZVQX 4KTVE 4TWIA 2CSXA 3LOUA 1C7ZA 2G0TA 1QIJA 1OFTA 1XWIA 4KI7A 1F2TA 4CHGA 4IJVA 5A4KA 1RLMA 3ZWBA 1E7QA 4KQXA 4XIYA 5JZBA 2G63A 4HR7A 4D42A 3UMYA 3ZOZA 2SICE 4P98A 5JNLA 1RVDA 1OBOA 2W6CX 1CJBA 1EUCB 1H6DA 1ZP6A 2ARKA 5A5FA 3WNCA 4BUJA 3QVWA 2VCYA 4M6WA 4IHJF 2D0DA 3GOQA 3LIIA 2HA0A 1C1HA 2B5WA 3C7TA 1E2HA 1O94A 5DRYA 4JWKA 1MW8X 3ORFA 2PLWA 3IESA 4BTVA 3SM3A 4B32A 2L17A 4DSNA 1FDSA 4UVIA 1SB9A 2J7PD 2J46A 4RIEA 3BD7A 1U90A 3ANMA 4AD8A 4OD0A 1HGXA 2QXYA 3D2CA 4H1HA 3UK2A 4FFSA 5I8WA 3GBVA 4LSZA 221PA 3R74A 1Y5NA 2H54A 2RHHA 1VSTA 2GPYA 4M7RA 4A0GA 5L3QB 3BFJA 5LXTB 1WVGA 2V5VA 3PGLA 5DASA 4LQDA 2ZYGA 4XQGA 4JT8A 5EE9A 4HX5A 1Z7YA 5D84A 3QVLA 1M9NA 5DK6A 1E3TA 1Q6YA 1IOVA 1W0KA 2OXTA 5BNZA 4DR2B 1HI9A 4L78A 5HK8A 5LD2C 4FMCB 1ANKA 2Q3DA 2RIRA 1FUYB 3WGIA 2XNDA 1NYRA 4HHEA 2DEUA 1C1DA 1GNSA 4MTLA 1NQTA 4NMHA 5DHSA 2ZDQA 2VTBA 2G6BA 5C5EA 4POOA 2DHRA 4GXRA 1DAEA 1U5BA 5J2UF 1R0BA 2MMGA 3CZPA 4QYIA 5JC1A 3R9WA 3DONA 2WKPA 3VR6D 1IQ0A 1YZVA 4DYVA 1TUEA 4JODA 1J22A 1J25A 4IBOA 3AHFA 4TYMA 3A58B 4BUCA 1KP3A 1I2DA 3V2IA 4RE6A 3G2LA 3EGVA 3KALA 1FP7A 1OV6A 2JD0A 2NT4A 2OP0A 3AB7A 1QQTA 3IMCA 4KX3A 4MUGA 4RJTA 3AY7A 3I4CA 4KWHA 1X42A 3ESQA 4MGEA 1XEXB 1OBCA 2XHEA 5AKGA 2NZVG 3UUFA 2VR1A 1MU0A 2EFJA 1E7WA 1SR8A 1F2VA 3W4KA 1SPXA 2ZBDA 1W88B 2JHPA 1RIIA 4RHTA 2VBCA 4YB8A 3QX8A 2XADA 5HK9A 2C58A 1KMHB 3QXXA 4N3NA 4RZSA 5AOAA 4M0CA 4ZVLA 3TI7A 3U7EB 4IL5A 2O2DA 2JFGA 2IPXA 1QRRA 1MC1A 1WABA 2DQ4A 2YWRA 3E7WA 3LPMA 3PHJA 5COQA 4PS0A 3S6JA 4CMGA 4EB6B 1KZ7B 1WOMA 4RCZA 1F6DA 1Q0TA 4YMIA 4LSGA 3RQSA 3TNJA 4KSBA 2P7IA 2DUJA 3NH6A 1ZX1A 4Z99A 5LP6F 1Q6ZA 5TF0A 1EI9A 2B99A 2BIFA 2P4SA 3A4MA 3HM2A 3JWGA 1Z2CA 4FGLA 3E3MA 1G9XA 1SOAA 2GD0A 3OE1A 1E9RA 5J1SB 3G8BA 1OAOA 5B7QA 5KYXB 2IYSA 2WJHA 1ECGA 1YZKA 2G71A 1ISIA 2QTLA 1G98A 1E5DA 3EFEA 3K35A 4JYMA 4GE3A 5DDIP 2ZT7A 4G4JA 4MQFB 3U3KA 3JZIA 1HDYA 2YCLA 1YU6A 2FSSA 5L45A 1OQAA 1C0EA 1H85A 1GPLA 1AOXA 3HSKA 3LM8A 4YQYA 4B4KA 3PI7A 1T3TA 4MYHA 5TSDA 1HT2E 3DEJA 2IUSA 4EPYA 1N8KA 5C3MA 4G0YA 3UAGA 1ATZA 1OXTA 5AKYA 4DFDA 4YRNA 5MFPA 2B69A 3I6MA 3FG9A 1G8GA 2J33A 4J49A 1E9VA 3E82A 4FDLA 4OP1A 5E4TA 3QVSA 2NXEA 2O05A 1D09A 3D7LA 4HATA 4HK4A 4KGDA 4WEOA 2HJ9A 1DXHA 1FF9A 3I1FA 2PHZA 3F4BA 3HLYA 3MTQA 4E1BA 1KFEB 5BRAA 1JEYA 3I1IA 4J03A 4CETA 3GMTA 3OT1B 4XIGS 5ALDA 3AVXA 1W44A 3FLBA 4BEWA 2UZ0A 2R7NA 4Z1OA 2J48A 2F2TA 1N0UA 3WK9A 2G1AA 4G0MA 1K6MA 4QHTA 5IUNC 3ZZNA 2IEDA 2OBXA 1RMTA 3C6KA 2XD4A 4UD2A 2J09A 4BYMA 2NVUA 3MTDA 4PC3A 1U28C 1D0IA 1YD7A 1HO3A 2I34A 1DBQA 3D8RA 2PZ8A 5CT4A 3E9EA 1CB0A 2N42A 5L7TA 2Q5QA 2FHPA 1RW4A 2VPZA 2J32A 1Q0QA 1V43A 4P31A 3RSGA 1AS3A 2Z6VA 2R44A 1QHXA 2ZIFA 1OAAA 3D4NA 3FAKA 3VR5H 3ZU4A 4IVRA 1ODIA 2ERYA 4ZAVA 2VP2A 4C2BA 1JG2A 3ZV7A 5KC8A 2Y05A 3M9LA 4I4CA 4C04A 4C22A 2FJ0A 2ISSD 4B3IA 2ZYVX 2L42A 1IY9A 1WB4A 3RWMB 2QL7A 2W83A 1DX4A 1QP8A 3KU1A 4M1QA 1N8TA 4NFHA 3N6VA 4ABYA 1KC3A 2IODA 1KYQA 1MAAA 1CPYA 4F4CA 5KOYA 5HJ5A 3R5KA 3N0VA 4IUCS 2I0FA 2MJLA 3DFFA 2O2CA 4M2LA 2VXCA 1V8PA 4BY9E 1QORA 3N6RA 3W7AA 4YAGA 2WVAA 5AQ1A 4C7MA 1NW6A 4D8YA 3EWIA 4FGSA 4EMBA 2B83A 3CX8A 3UPTA 5FEMA 1FPQA 2D5BA 2GK4A 5I7FA 4YDHB 4JLSA 3DHWC 4IVNA 1AZLA 5DTEA 1S9DA 2X3UA 5CPBA 3R3VA 2QDXA 2LV8A 1SBIA 3GGOA 4BMSA 4Z9YA 1AHHA 1U9CA 5I9TA 3SC2B 4FWBA 3OOEA 3AI1A 2PT9A 4JVNA 5EVJA 3SYKA 1RE0A 4DREA 3ANNA 3TUZC 3V4FA 1FYXA 3COVA 2VHYA 1TVKB 4CLRA 1CQXA 3T7KA 5CFMA 1ABBA 4MYRA 2O50A 2Y92A 2P8JA 3G0GA 5TLSA 2Q8NA 2FW6A 3SVZA 4YMSA 4YONB 5CBPA 3JYPA 3VPFA 3ZBTA 3INRA 1BWQA 1E7SA 3EFOB 3P9KA 4UM9D 3ZZMA 1Z5GA 4OXIA 1D4OA 4MKRA 4B3RB 3A4IA 4PV7A 2P2CA 3DNMA 4ILKA 1FRFS 4LDPA 5ANRB 1DAFA 1CV2A 1QX3A 4C3UA 3O0TA 4ANFA 4MCIA 1GQYA 2IGTA 3UTDA 1OFUX 4ZAWA 2XNSA 4BXOB 4DLKA 5IK2D 3BSYA 3G1TA 1FMFA 1G66A 1ISSA 2RGRA 3HCOA 3BC1A 4DY6A 4UXJA 2Q5CA 3NHAA 1NN0A 2A3RA 4BASA 1XKQA 4AULA 1MT3A 2SKDA 1GWNA 1D6MA 3K5HA 5F51A 3MWDA 4BV9A 3BSFA 2BGIA 1I30A 2RIPA 1X74A 4GX5A 5EJ7A 3UCEA 3LS2A 2JIQA 4JNCA 3A9UA 2DFKB 2NO4A 3KUCA 1UINA 3H5LA 4QA9A 5JR3A 3F0TA 3KEMA 3PX3A 4QQRA 3WRXA 1U3GA 4CKXA 1ID8A 2JLWA 5FFMA 2D7JA 1D1SA 2CLIB 3THSA 2PZKA 2DY0A 1IBCA 1X2EA 2ODAA 1C9YA 5B2EA 1JHMA 1VB5A 3DZJA 1NHGA 3HYCA 1XVIA 3AF5A 3A1NA 1G21E 4PPYA 1PJ4A 2YVKA 4YP5A 4KQHA 4Q21A 1V95A 4BVBA 4RL4A 3C8UA 5CCDA 5G3YA 1RMYA 5J3JA 1KK0A 2AMVA 3BREA 4DCGA 1SFRA 2HWXA 1DC5A 3A9RA 1XAHA 3Q3JB 3G8DA 2OV6A 3TRKA 5B6IA 2C77A 2DVMA 2OORA 3GD5A 1BDHA 2O5VA 4MVJP 4CDMA 1T4DA 1GNTA 1O5IA 2D62A 3CUEF 4MULA 3HVRA 3PZRA 3PR1A 4Y6OA 5CEJA 1TEHA 4GXNA 1QVRA 3M4JA 4NWIA 1KI8A 3TVDA 5KOJA 2I2AA 4KPEC 2C2HA 3GLIE 3AVYA 4A10A 2V7QD 1TAHA 4RY8A 1BXGA 2RKWA 2NYVA 4MUFA 1ZUNB 2AQKA 2JGDA 4KO4S 4L07A 2YW2A 1GLVA 1QYWA 5CFQA 2X0RA 2R1VA 3EPLA 1KI9A 2AEMA 5JCJD 5ELMA 2QRPA 2X77A 3SX4A 3TVTA 5B3KA 2RH9B 3DAFA 3DPSA 1M1UA 1JR3E 3RRYA 3VTKA 3CUSA 1RHRA 4M0MA 2QROA 3R4VA 4M1TA 5B1HA 4P54A 2O8FA 3KDSE 1YQDA 3MIIA 5FPPA 3ROPA 3AR3A 4BRSA 1JKMA 2WWHA 3D6VA 3H8SA 2NTEA 3PGKA 1L8QA 1VL5A 4IVPA 5GOTA 3AP2A 1NJSA 3BRQA 4YREA 5IWCA 1Z0KA 3M89A 1FJGB 4KP7A 1YHNA 2JLBA 1UIRA 3ODPA 2CEKA 2V6JA 1SRRA 2X22A 4LNUA 1FCJA 2EG9A 3WIVA 4OQYA 3PGXA 2QL9A 2EFHB 3E2PA 3G2KA 2P9GA 3RFTA 1TLLA 1QZZA 4MVWA 4QJ5A 3O7MA 4WBSA 5PGMA 3V7WA 4A8JB 4FE4A 3DBLB 3AM3A 3C3JA 1TM1E 4D0GA 3ZKWA 5EJGA 4EHNA 2XB8A 1JA0A 3CF2A 3WE7A 7ABPA 2PD4A 2FSHA 1Q20A 2O57A 3Q6NA 1P61B 1CY4A 4JS0A 2C5HA 2XOKA 1DKLA 3KV3O 3TI9A 1TYBE 2AX4A 2WRZA 3L02A 3ZGZA 3BE8A 1PIWA 4HB2A 1A72A 3CJTA 2SBTA 1JEEA 1ZCAA 3ED5A 1XCOA 2JARA 5DGHA 3VH3A 5IXSA 1FRNA 2WYVA 3OOHA 1GGHA 4OB8A 4IIJA 3DE3X 4X8MA 5AVTA 3IOEA 2UUOA 3UWOA 5LVAA 1AO0A 1RIFA 2CNLA 4R7TA 2Q7XA 2ISQA 1LQTA 2CFRA 2ZJ6A 1KR2A 1S2LA 3A8TA 3CKMA 3EBOA 3Q41A 1W5EA 2O4UX 1YRQA 1R5BA 3E7PA 2CHEA 1LBEA 1PZFA 2DHDA 3A6HA 3JR3A 4K9DA 4LBVA 4U2DA 1SXIA 4GVXA 3KVVA 1W0JA 1JSCA 4GMXA 2QM0A 5CA0A 2Q5HA 2QD1A 2BBOA 5LN1A 1M2WA 3I2HA 4NE9A 4JYCA 5DNCA 2Z8XA 1NVVQ 1YK0A 5DNDA 3HKCB 1B42A 5CFNA 1KSFX 4G1VA 4ZZ3A 4HKTA 2GVZC 4HWTA 4LXXA 4XWYA 2KB0A 4W1SA 1TM3E 1RHQA 5TRTA 2GR9A 3BQNB 4I9UA 1T2AA 3LMKA 5KNCH 2ANBA 3NT2A 5BW6B 3FN4A 3SQOA 2IFTA 2QX4A 1UKEA 4FMBB 1F2UB 2MINA 3RABA 4M7OA 4PLHA 1NWHA 4CMIB 3JARA 4P3NA 3NIDB 3D0KA 5TS2A 3ZWWA 5C80A 3GJ7A 4E2ZA 2IQ5A 1HEUA 1DAOA 4HAWA 5DOZA 4C29A 5KVCA 1S7GA 2CYBA 4FGJA 3DOUA 1WP4A 5IC6A 5KJEA 4M88A 3H97A 4XB6B 3VZPA 1DV2A 1BVUA 1UWVA 2B0JA 3ETJA 4KC0A 4F3CA 2C57A 2HBZA 3AFOA 3MT8A 4OKSA 3WJAA 4CF5A 5B3LA 3NBQA 3FNIA 3PQ4A 3RM3A 5CFOA 3DVQX 1EIZA 1JDVA 4WFIA 5CX4A 2O8CA 1QFYA 2H8KA 4K9KA 4KQEA 2UDPA 3PXEA 1JJVA 3GGCA 1BW9B 3G23A 3JQGA 2FPIB 3LBFA 4B76A 1K2WA 4WBNB 3JYQA 5K8CA 3OZUA 1CG6A 2QUAA 3I5UA 5EKSA 4I9HA 3WHLA 3VM6A 1CJMA 4AZ3A 4FHEA 1XROA 1XDZA 3C24A 2PMFA 3QMMA 2C0QA 2Z30A 3GN1A 2MT9A 4JP8A 3AZPA 3AHIA 5A5EA 3U5TA 2V5UA 1PG2A 2Y1EA 3VHXA 2VZ0A 5H68A 5HMLA 3FPSA 1JJIA 2QXTA 2WMYA 3HY4A 1GL9B 1SBZA 4LEIA 4A91A 1R6UA 3SNHA 2GM5A 1PL6A 3ILVA 3TAXA 1C80A 3ZCXA 1XI2A 1O8CA 5IYZB 2PRZA 3I2GA 2XCIA 3QVMA 4UD6A 3H1BA 2EQ5A 4C08A 5HHTA 2H4YA 2A4KA 1F4VA 2JGMA 2IW3A 2V0CA 2ZJOA 3BJZA 3GW8A 3T34A 3GJ8A 5FXMA 4DJJA 4Z7NB 1W8IA 2JIMA 3IOCA 3VU0A 3CPHA 4MPJA 5JY6A 1NYQA 2ZJ2A 4PC6A 3QMWA 5GONA 1N5DA 4ZT7A 1VE1A 3C45A 1RTTA 5GJCA 5LBIA 1MOQA 3ZQ6A 3ZNPA 2JI6A 4ZWNA 4BO9A 4R16A 2A5JA 2F4NA 4Q3KA 3HJAA 4QRHA 5EFZA 1KEPA 4NICA 1I9GA 3KYCA 2ZTSA 5EQTA 1RZRA 2QP4A 1CX9B 1F48A 3KWMA 3N2GB 2W6QA 2Q9CA 5CJ2A 2YVAA 2HO5A 3ZN2A 1U2DA 3VI4B 1BMFD 1CS0A 1TC1A 3I01M 1DL5A 2Q1SA 2RH5A 4FFLA 3T7EA 1F9EA 4HYQA 1CR1A 3HNOA 1X19A 3IT0A 5LIPA 3H1EA 1PNOA 1C8KA 1D2EA 4Q7JB 2K5UA 1L5NA 3S5UA 1NWCA 2PLAA 5A62A 4ZOCA 1U9IC 2BFEA 4PFSA 4V0MA 3HRHA 3VSEA 3QUQA 2WP0A 1RRFA 2R47A 1JBQA 1UJCA 5HFNA 2ZXUA 1U3WA 3DF7A 2UZ1B 1UZLA 1DO2A 3ND5A 1Y1SA 1TT5B 1QUEA 1Y4SA 5F5NA 2CDBA 2JIOA 1TNDA 3CU5A 2RGNC 3FCAA 3DCJA 2IS1A 4GGMX 1OPXA 4XJSA 2CL6X 4HEA1 4BRZA 4MRPA 1BEEA 1NBHA 2R62A 3PEEA 3MOGA 4RY2A 5HKKA 4X71A 4UHDA 4OYLA 4JGGA 3NASA 4EO4A 4O4LA 1E9SA 2BGMA 3WZMA 3BVPA 3UHAA 1H9AA 1GAEO 4ZT6A 4BWYA 4HLUA 1C50A 3NHLA 4N8DA 4PICA 4GL4A 2ST1A 4HPWA 1G5TA 3L5KA 1Z4NA 1K3FA 2XZPA 2QBYA 1CF2O 2I3ZA 2EKQA 1NTRA 1NU6A 2UVPA 3FY4A 4WZAA 2QR3A 5LUBA 3RS7A 1SC9A 3CUVA 3REQA 4DV3B 4EG5A 1N4DA 3EGWA 1T8YA 2DR3A 3W7VA 2EQBA 2DPMA 5HGJA 5BT9A 3MQFA 4OPMA 4L4SA 2QYHA 1TL7C 1BE0A 4P82A 4WL0A 3R8XA 3SC3A 3TBFA 4ENSA 4DYDA 3WP1B 3FH0A 2XQKA 1JB1A 3SXJA 1EKXA 4CV3A 3M9XA 3U4IA 2AOVA 1T1SA 2FPLA 2Q4DA 1NOJA 2JA2A 4BV8A 1UODA 5AVXA 3A6LA 3F6CA 3RTEA 2IQIA 3IT1A 4GKAA 4D9EA 4DRZA 2ZXEA 4JB8A 4OCZA 4CQJA 3T9FA 4CEIB 1JA9A 1USKA 2EX0A 2GN1A 2Z95A 3HJHA 3OJCA 5IVIA 1C1DB 3I5XA 1U8UA 4OXXA 4IDEA 1JDZA 4A2QA 5K0JA 1SU6A 1L8LA 3FFAA 4DC1A 3QE2A 4HDCA 3I23A 1YQTA 4HDSA 1CIPA 5HFAA 2XXAB 1UKCA 1ESEA 1L3CA 1Z36A 3ZE2B 7GPBA 4D3YA 4Z7JA 2C82A 5D87A 4P86A 5CNKA 2QW8A 1PK7A 3QXCA 5G40A 3T7IA