5HTOA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1 (tetrameric ldh in an asymmetric unit)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
302
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
molecule keywords L-lactate dehydrogenase
total genus 113
structure length 302
sequence length 313
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5htoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5htoA02
3GHHA 2Y1EA 4DREA 5FI5A 3I4FA 4CQLB 1RKXA 3ZDFA 4HADA 3L4SO 1ZK2A 4EI2A 4ZICA 4PZCA 4URFA 2ZKLA 4PG5A 3DC2A 5C7OO 3VOSA 4WJZA 2W98A 4WPGA 3K2EA 4TZTA 3DAPA 3I9OA 3ZWXA 1GAEO 3RJ5A 4J1SA 4ESOA 3IC5A 5CDTA 3FCOA 5IZCC 4PG6A 2ILTA 2I3AA 3A28A 3BMOA 4AJEA 5HS6A 4OKNA 1Q1NA 4A27A 3UGKA 5A06A 4YAEA 2YHIB 5TF4A 4Z9YA 4CM3A 5I7EA 5A1TA 5JDIA 4YBZA 1Y7TA 2E48A 1GYQA 4CL3A 1CIVA 1T25A 3UXYA 1KVUA 4YJFB 4WLUA 1IHYA 3A1NA 4YA6A 2I9PA 1YQDA 1LBEA 4KUHA 1PJTA 4J4BA 3ADOA 3KO8A 2VN8A 3JQEA 4CMIA 1CQJA 3JQ9A 4INAA 5KJCA 3JD2A 2BKAA 4L4XA 1I3MA 4CM4A 3UF0A 1LNQA 2CSUA 4I08A 3BXXA 1PEDA 4NK5A 1F0YA 1PSDA 2C2YA 4I9UA 2EJWA 1YH3A 3PQEA 3GG2A 3UN1A 1DC6A 3PZRA 4OL9A 1E3WA 3JYOA 5G4KA 3RD5A 2P5UA 4E5NA 5I7VA 1WWKA 5B4TA 2D4AA 5CFZA 1Y81A 3TZCA 3CKYA 3GN2A 1EUDA 3PQDA 3ZH2A 1N9GA 4BO8A 3EVTA 4GAEA 4YACA 4S3MA 4BIIA 3HQ4O 3R3JA 4KWHA 5J23A 3NUGA 1E1MA 1LJ8A 1Z82A 2PH3A 4U6QA 3RFXA 1HZJA 1EFKA 1PQPA 4OQZA 4P22A 4WCFB 5AXDA 5B37A 4DTIA 2YDYA 1H9AA 4GKVA 2Y93A 1AHIA 4BO7A 1LTHR 3OECA 4HWKA 1LA2A 4XCVA 5G0UA 3ZHBA 3EY4A 1UDAA 3WTBA 5L7WA 2DUWA 5BQFA 1E5QA 4XDYA 5T64A 3KHUA 4H7PA 3JQGA 2I66A 1EDOA 1ZKMA 4HY3A 3U4IA 1BW9B 1VRWA 3ASUA 4ND1A 3PP8A 1TVEA 1DRWA 2YUTA 3DZJA 1R15A 2G17A 3QY9A 3ZI0A 1WMAA 3PQFA 3H2ZA 2YJZA 4BO3A 1E1LA 4CMAA 3I9LA 4ALIA 2VTDA 8ADHA 3AM4A 2I99A 5DT9A 1KC1A 1X1EA 1DIHA 1B8VA 2BI8A 2C2XA 3PWSA 2Y1CA 3F3SA 3OMLA 1WPQA 3EYWA 1T26A 1SOVA 1U5CA 4FD3A 2VUTA 3RCBA 1X0VA 5A04A 3K2BA 1BXGB 3DHYA 4FJ0A 5EIOA 1ZCJA 5L3ZA 4G2NA 5DNAA 1IULA 1B15A 3FWZA 5CDSA 3E6AA 2VHXA 2PKRA 1ZK3A 3B70A 3U4DA 4BNNA 1B14A 4ID9A 5AXAA 5B4UA 5KJEA 2Y67A 4QQRA 4JROA 3KETA 2CVZA 4H3VA 1GQQA 5GZ6A 2HDHA 2P9EA 4ND3A 3VKUA 4YAIA 4BO5A 5EERA 3TN7A 1LRLA 4DRYA 4E5PA 2EEZA 5IZCA 4BO9A 2CDAA 3I5MA 2GZ3A 3F6YA 2DU8A 2I5PO 3PHIA 4ITUA 3H9JA 5A3VA 3K96A 5JYEA 5L7TA 5IDYA 1KEWA 2QYTA 3FBTA 4KTTE 5DULA 1A5ZA 5TS3A 3WBBA 3D3WA 3G1TA 4M55A 3UVEA 2X58A 1MXFA 4GWGA 3QVTA 4HV4A 1EZ4A 1M6WA 5L7YA 3JYLA 3VPGA 3UUWA 4MINA 4DLAA 5GZ1A 3CINA 1C3VA 5BNFA 2D1YA 3L6OO 1T2CA 2YV2A 4IJUA 3JD3A 3WSWA 1HE5A 5THQA 1EUCA 1XYGA 4S1VA 4CLXA 2GF2A 3DAFA 2IXAA 4WOJA 4FN4A 4I5DA 3KSUA 4B4OA 2AE1A 3EZYA 3S2GA 1V8BA 3LDHA 4RPHA 4HXYA 5GMOA 4BNWA 4DIBA 5IXYA 3C7AA 1IZ9A 3NJ4A 5DF1A 4RJTA 2WYVA 3PYLA 3RU9A 3U4HA 4J9VA 3GT0A 1BXKA 4L4SA 4R1NA 4M87A 3UAGA 1Z74A 4RQTA 3GGPA 4ONEA 3VZPA 2BF7A 1RM5A 3GLQA 5JCJD 2W2LA 3GMSA 3RFTA 1XCBA 1LDGA 3C8MA 4JBHA 2AA3A 3FRJA 4BQRA 3DBRA 3OM9A 1MC4A 1ZJYA 3D4PA 1KEVA 1AN9A 1J4AA 1TT5B 2UDPA 3OIGA 3U62A 4CLOA 3QV1A 4MP6A 4J7CA 4EJ0A 1HEUA 1GZ4A 1O5IA 3L4BC 4TKLA 5TJHA 3E8XA 1NBOA 4IS2A 3PWZA 1R4NA 1DHTA 2HCTA 3O4RA 3ONDA 4Q3EA 1R4MB 4YDRA 2GNAA 4CQLA 1GPDG 3TZHA 1EQ2A 4YPOA 1NWCA 4I5GA 3C24A 1WMBA 1X15A 4IGFA 5JCXA 4JBIA 3IOYA 4W4TA 1F06A 1T4BA 2FZWA 3BMNA 1HXHA 2D59A 2GPTA 3UKOA 4AJPA 3H9QA 1YL6A 4J49A 3WICA 4QECA 1ZBQA 2NV6A 2Q1UA 1HTBA 4MVJP 4QFCA 2OP1A 2WTBA 4YT4A 2PGLA 1X14A 4RDHA 4BOYA 1O6ZA 3PYMA 3QRWA 4XQCA 3DBHB 1P0FA 3GRPA 2J3JA 3DFUA 3DHNA 3WOHA 4PCVA 2B4RO 4RF5A 3K9QO 1R0LA 3T7EA 4BNYA 1RJWA 1WNTA 3WJAA 3AI1A 5KKAA 3ANLA 3HDJA 3JD1A 3PLNA 1D4FA 1CJCA 3DFZA 2WJPA 3QP9A 4MKRA 4ZJUA 2Y99A 5F5NA 3SJ7A 2X9GA 1Y5RA 1QYCA 2AQHA 3AW9A 4NNJA 1ZXLA 3OJEA 5IAAA 1E1NA 4LCJA 3W4JA 1C0KA 5TGDA 3VDRA 4YB8A 2W4QA 4J0EA 1DBVO 1NQTA 3ENKA 3ZWNA 2W2KB 5A5EA 2Q50A 1M6HA 1VI2A 1PTJA 2GN8A 1QLHA 3OEWA 2QW8A 4LW8A 3UCXA 2OO5A 1WLYA 3WR5A 1E3EA 3AOEC 1QG6A 1PL6A 4AJOA 4CJXA 3PPIA 2BRUA 2R00C 4KQXA 4OJNA 1O94A 3ZWYA 3MOGA 3VC7A 2D2IA 3NV9A 5CEFA 1D1TA 4D3FA 1E6WA 3QIVA 3CZRA 5KCZA 3F5SA 3LVFO 1TEHA 3AUAA 1LC3A 4FJ2A 3CMCO 3WWZA 4CUKA 2PR2A 4QTZA 3CPSA 1GU7A 3STHA 3SVTA 2EKLA 1ZNQO 2H6EA 2OMEA 4YTEA 3VPHA 5L4NA 2Y0CA 4XA8A 1YDWA 4PG7A 3KYDB 2RBEA 3E9QA 1I32A 4KZPA 3VH1A 1JDJA 5DCUA 3S2EA 1MC5A 3GZNA 3ONFA 4CM9D 4EYEA 2NQ8A 3LT0A 4FIZA 4MIYA 3X2FA 3OJLA 1LLCA 5HRUA 3JQDA 2BFAA 4BGIA 1E3WB 4CMHA 2V7PA 3PI7A 2EKPA 1UUFA 2PNFA 3CH6A 1A7KA 1V3VA 4D7AA 2PZKA 3ROKA 3L9WA 3GRKA 4F46A 3N7UA 5KVVA 4ROSA 4D45A 4BGEA 1SEVA 4U6SA 2G76A 5FEUA 2IODA 4BO0A 5JSFA 4Y98A 5COBA 3MTGA 2VZ8A 3GN1A 2X5JO 1A7AA 1AE1A 4RCVA 4Y8VA 2NVWA 4IDBA 3GK3A 1UAYA 1ZXBA 2A4KA 1VL6A 1PZEA 1NAHA 2W2LD 5DP2A 4RPJA 1D1SA 4CLDA 1EFLA 1UR5A 4R41A 4EZBA 3Q11A 3BMQA 3JQBA 4NFYA 4FBGA 3MJSA 2IDZA 5DN9A 3ZWBA 2ZJ1A 4FCCA 4R3NA 2IE0A 4PLYA 2OFPA 4HX5A 5CAEA 4RPLA 3DZGA 3PVZA 4OAQA 3NKLA 5I9NA 2VWPA 1GQYA 4TVBA 1C1DB 1NQAO 4ZU3A 5ICMA 5G4KB 1ONPA 1I2BA 2JHGA 4N7RA 1HDRA 3NX4A 2AEMA 2NUAA 5IF3A 1NPYA 4Z9XA 4R54A 1QP8A 1P1FA 2DT5A 3DOCA 1HRDA 3TFOA 3OQ1A 4YEDA 3QWAA 2CVOA 3ZU2A 1PS9A 1C1DA 3O38A 4R9RA 5CG1A 2IEDA 4FGSA 4XB2A 1Q7CA 3WJ7A 4O1MA 4EBFA 4DQVA 4P4LA 4DMLA 4LVCA 1PWZA 1U3WA 3PHHA 2GASA 1DB3A 4II2A 4ALLA 4DBVO 5TT0A 2WD8A 1E5LA 1B16A 2P2SA 1JVBA 1K0UA 3ADPA 4XDZA 2HK9A 3BMCA 4FFMA 5KVQA 5THKA 5C37A 4JP3A 1IE3A 4QSMA 1PJ3A 4JK3A 4U8GA 5HA5A 1SB8A 2VWGA 5TNXA 3S2FA 2BLLA 1UXIA 1Z7EA 3R3SA 5TRTA 1PJCA 2VTEA 1C14A 3O8QA 4O59O 1I8TA 5EPOA 3VDQA 3QW2A 3TZKA 3FPCA 3QSGA 2NQTA 3WWYA 4NU6A 3GEMA 1P44A 5MDHA 5JAMA 5KKCA 4MKZA 3JTMA 2QZZA 4IQGA 1VL0A 2AG8A 4IMPA 3DZIA 3OJOA 5HWSA 5KOIA 2GZ2A 5GZ3A 4BKRA 3GFGA 4I9HA 3LQFA 4J2OA 1DFGA 2JD1A 1O9BA 2HK8A 4FS3A 4FJ1A 4XJSA 5LDGA 1U2DA 3F5QA 2B4TO 3ROPA 1ADCA 3ZN2A 5ITWA 4R51A 1R4MA 2XF8A 4XR4A 5G0WA 2WD7B 4E3ZA 3QWHA 1NNUA 2AG5A 1H6DA 3JQ7B 4GH5A 4OXNA 4YT8A 2X8LA 4YJDA 5COQA 3MWDB 4AICA 1NR1A 4OIMA 4ND5A 4LK3A 3WNVA 1P1RA 4MPDA 2JFHA 5BSGA 3SEFA 4R69A 3CSDA 3UCEA 1TI7A 3HDHA 2VUUA 1MFPA 3JQ8B 3ULKA 2EP5A 1K89A 3IJRA 3X2EA 1GQ2A 2VHVA 3JQ7A 7ADHA 3QHAA 1O0SA 3GHYA 1IYZA 4XD2A 4DQXA 3L6EA 1UP7A 1RM0A 3ZHZA 3EVNA 1GL3A 1YL7A 3RUFA 1I3LA 3AM5A 1VM6A 1U28A 4AVYA 2JCVA 4N5NA 4U7WA 1YB4A 4MIOA 4XRRA 4UUMA 1HSOA 1P1JA 4Z3DA 3RC9A 4Y6RA 1O89A 4WNCA 2OXIA 4M89A 3HFSA 3NRCA 4YJFA 3WGZA 4RZIA 2ZTLA 3C1OA 4QT0A 4RVSA 4PLTA 3WMWA 4Z0TA 1PS0A 2HRZA 5AVOA 3GPIA 4PLHA 2XXJA 2X0IA 1M76A 3BMOB 3DZKA 4WCDA 3BYZA 3IJPA 4K6CA 5IZ4A 3I83A 2ZQYA 3QLJA 3IKTA 1NWHA 3GUYA 3V2GA 3H5NA 4CQMB 2LDBA 3EMKA 2D0IA 2HMVA 1H5QA 2X0RA 4BHTA 6LDHA 4CLRA 1JW9B 2RH4A 3P19A 1PZHA 1HDGO 1LSUA 4AJ2A 4D42A 2FSVA 1BHSA 4UEJA 1LQUA 1ONOA 2HU2A 1Y1PA 2RHRA 2RHCA 4RPKA 2R2GA 4ZQFA 3DO5A 3H3FA 5ENVA 5JNLA 4JIGA 5JMPA 2OORA 2Q1WA 3PDJA 1CQIA 1OMOA 3PTZA 2O7SA 3ZWAA 4CLEA 1HDZA 2VRCA 3HE3A 4NR0A 4UUNA 4AJIA 1YOVA 3GOHA 3JQGB 3DQPA 4IDFA 4LRTB 3WTCA 3IL2A 4P4NA 4WLNA 3Q2IA 4R1TA 5HTOA 4MP3A 3WYCA 5ADHA 4Z6KA 7MDHA 1EDZA 3D5TA 4Q3DA 5DBFA 4E0BA 3LF1A 1E7MA 2IYPA 1CRWG 2QZ9A 1BG6A 4YQZA 3GNSA 4IM7A 4AJLA 2J3KA 2PWZA 1BXGA 5AYVA 2NU7A 2AEJA 3TZQA 1LRJA 4TVOA 1IZ0A 1U2GA 1NP3A 5T5QA 4WLVA 4HFMA 2Q3EA 2H5LA 4PLVA 3M1AA 1WDLA 3JQBC 2E6UX 3RSHA 4TRNA 1T2DA 2PZLA 4MVJF 1R6DA 3I1JA 2H9IA 3KYCA 5A9SB 1BVUA 1YE3A 1PJQA 2EWMA 4NHEA 1OOEA 4XQ9A 1LLQA 3OEYA 2OBNA 2NACA 1HF3A 4JCOA 5A3JA 3I23A 3JQ6A 3BHIA 4HFNA 5JBIA 5AOVA 4ZQGA 4UVHA 3B6ZA 1SCUA 4BKUA 1BW9A 1ISMA 3FNHA 1LQTA 1FDUA 3F9IA 4J1TA 4IQ8A 2GR9A 2Y0DA 1WXDA 4XQEA 1FDSA 1HSZA 3K30A 8LDHA 5H83A 4B3JA 4AFNA 3VTZA 3TOZA 1DO8A 4MVJI 1NPDA 2O48X 5BT9A 4TQGA 4MVJE 1GZ6A 5JO0A 5FFFA 2VOEA 4AJ1A 1XEAA 4R3WA 1D8AA 1DC5A 1EE9A 1GYRA 3ZCXA 4ZRMA 2C82A 1B0AA 1E3JA 4N5LA 1J6UA 2FPPA 2Y68A 3E9MA 2CZCA 2IYOA 5BSFA 3ETDA 2G5CA 3OSUA 1CEQA 1DJNA 2TMGA 3GMDA 1KVQA 4PGFA 4UVEA 5T8KA 3E48A 5KJFA 5B12A 4L75A 3TJRA 1SAYA 2WEKA 3DHEA 3OHSX 4JP2A 1LSOA 3LU1A 5K6AC 1MA0A 3GGOA 4J90A 4IJWA 4R1UA 1PGJA 2FHSA 4OHUA 1ISJA 2GUGA 3KYDA 4TWRA 4R5MA 1LC0A 4YWJA 4P8RA 1R37A 4JGBA 5G0SA 3ZZNA 2J5KA 1GV0A 2PD3A 1CF2O 4DC0A 3FN4A 5H81A 4K6FA 1YKFA 2D5CA 2P4HX 5I9MA 3O8QB 3P2OA 4E2ZA 5K9ZA 4W99A 3WGQA 2F00A 5DZSA 3OIDA 4EITA 5JC8A 4UVDA 2Q2WA 4Y6SA 2HMSA 2ET6A 4J2HA 4ZA2A 3G1UA 3WFJA 1ONNA 4KP7A 1CDOA 1ULSA 2VYNA 4PIVA 5JS6A 5B1YA 2VZ0A 3D4OA 5CDGA 3PHLA 1VJ1A 5JY6A 3Q9UA 1HZZA 3GG9A 3UHAA 1QKIA 4OXYA 3WFIA 2UYYA 1FJHA 3TPCA 1UZLA 1JWBB 3UFXA 4BV8A 4CV3A 2JCXA 2B0JA 1ISGA 3S55A 4CMBA 3W4IA 1EVYA 2DVMA 3C7DB 3D3WB 3KBOA 1E77A 3W6ZA 4WOKA 4DXHA 5A9TA 1WDMA 1E92A 3SBOA 1GEEA 4YRBA 2PH5A 3FNEA 5CG2A 3PFFA 3RASA 1YBVA 3O26A 4ZGWA 1PR9A 1Y9EA 3KVOA 3JQAB 3V1YA 5F1PA 4JBGA 4PZDA 5L53A 4BNXA 1FF9A 3WLFA 3ASVA 4FFOA 3KEOA 5IDWA 1Q0HA 4BO4A 1BDBA 4HBGA 4XIYA 2P4QA 2PK3A 1X7HA 3TDKA 1IL0A 2B5WA 1PZFA 4TSKA 1EEHA 3RKRA 3KEQA 3AUSA 4PG8A 1XWFA 4PRLA 3VH4A 2VCYA 1YBAA 2SCUA 3NYWA 1IUKA 3DZFA 3GY0A 3WNQA 4E2WA 1FXSA 3RWBA 2RAFA 4C4OA 4ZVVA 4UUPA 5DCYA 1UH5A 3MOIA 4M8SA 3INRA 5LC1A 2ZB8A 1MXHA 1PL7A 1Y5MA 2NNLD 3PK0A 1F14A 2DPHA 4NJMA 2W90A 1E0DA 1OI7A 1P1IA 3QJ5A 4LMPA 2Q49A 3VPSA 2PD6A 4A10A 3GVHA 4CPDA 3RC1A 1PJ4A 1K6IA 2WWRA 2NVBA 4PLCA 2HJRA 2XPCA 4E2XA 4OQYA 4EW6A 3LZ6A 4R01A 3AY6A 4RLHA 4GX0A 3U0BA 1PJ2A 3WQRA 4D3SA 2VRBA 3FNGA 4NBTA 3OJFA 4CMGA 2WMDA 3ZWVA 1LRKA 4BNZA 1DXYA 2Q2VA 2ZYGA 4AL4A 3AJRA 3N74A 2BD0A 3G3EA 4GLOA 3HWRA 2QRKA 1NXQA 3GVPA 4GX2A 4BMVA 3ZU5A 4IDDA 1KYQA 4LSWA 1BRMA 2LDXA 1B3BA 3E5RA 4DA9A 4DMMA 1GCOA 1N1EA 5JDIC 4DQUA 4BNVA 4A5OA 5CEEA 4N18A 1MGOA 3AI2A 4RVGA 3HN7A 2DPGA 1DPGA 5L4LA 1XG5A 4BO6A 1PS8A 4LMRA 4U0KA 1QSGA 3S2IA 5L40A 3VVCA 4GSLA 2NM0A 5IJZA 4WLFA 2DTEA 2I76A 5G4LA 3U3XA 2O23A 4A7PA 2NVUB 4J6FA 4XJTA 4E5KA 2GERA 4Q39A 1YQGA 3IS3A 4WE3A 5C3MA 3ZHYA 1ID1A 1PX0A 4E5MA 1GR0A 3OH8A 3KYCB 2AHRA 5A9SA 3HZZA 3ZW8A 2EG9A 1NX6A 2I65A 4ZQHA 1HE4A 3NGLA 4YAGA 1JA9A 4QX6A 4KOAA 2CFCA 1YONA 4E12A 4OSPA 4ALNA 5L9AA 4B79A 3WLEA 4XYLA 3PJFA 1DEHA 1UZMA 3E1KA 3LK7A 2HJSA 1M67A 1DLJA 2EV9A 5C7LO 3FSRA 3N58A 2BELA 3ORFA 2EGHA 3ONEA 4CMEA 4EDFA 3QVXA 4OYRA 2C7VA 3NT4A 4JJGA 5EINA 3QE3A 3BIOA 1FMCA 4L73A 1F8GA 1S6YA 1U3TA 4UREA 3ZWOA 3DONA 4WEOA 1T2FA 4B3HA 3FD8A 3ZWPA 1HDXA 1DLIA 5BR7A 3MWEB 1KY4A 3PXXA 4PRKA 2GO1A 3L4BA 1ENPA 4NG5A 4I8XA 2GDZA 3IUPA 1FK8A 3NDRA 5A02A 1U1IA 4PLFA 4L9RA 3OQBA 1G0NA 5JDCC 5KJ1A 5EESA 2JFGA 3QWIA 1IB6A 1KVRA 2JAHA 3PZBA 4IBOA 4RVFA 4WASA 2WYWA 4H15A 2BFPA 3RBVA 1HDOA 4BGVA 5F1KA 4B7CA 1G1AA 2JAPA 2O3JA 1QYVA 2VQ3A 4NZ9A 3S8MA 5KIAA 4NK4A 2DQ4A 2GN9A 2PV7A 3AY3A 2QRJA 4RLSA 3H6KA 4YJHB 1I2ZA 2BI7A 4PZEA 2Y66A 3CIFA 4FFPA 2NTVA 3MCVA 3JSAA 1H2BA 3L0DA 2WSBA 1NFRA 3QVSA 4NIMA 4KDEA 5DDIP 3WQSB 4EJ6A 3R0IA 4B8WA 4XB1A 1GUZA 2C7GA 1V35A 5KTKA 2X22A 2DBQA 2PGDA 4RO0A 4GL4A 1HE3A 5EQFA 4LCEA 4UAGA 4D41A 2IZ0A 3DMTA 5KJ6A 2VHWA 3DXFA 1Q0QA 4FDAA 1PQWA 4LISA 5CPFA 4R4JA 5ER9A 4OMUA 1NASA 3VZQA 2EIHA 2BH9A 2P5YA 3GNQA 2NTNA 4JLWA 4FR5A 1VPDA 5F3RA 3W8FA 4CMKA 3OA0A 4ZD6A 3GR6A 5TT1A 1D3AA 4IZHA 1C1XB 1YBMA 2PA3A 3EAGA 4WCFC 4DGSA 3IP3A 3P2YA 3GF4A 3GVIA 3WGYA 5JFOA 1H93A 1ZSYA 3V8BA 4F3YA 2Q45A 1EQUA 2IZ1A 1QRRA 1XHLA 1WW8A 4BO1A 4GMGA 1EBFA 1EVJA 4MVJD 2FMUA 4W9NC 4CM1A 1UZNA 3ENNA 5LDHA 1L7EA 2EW2A 1VC2A 4BV9A 2BHLA 5IDQA 4OKIA 4CMIB 4Y9DA 1ZSNA 1NQOA 1SEPA 4IIUA 4BNUA 2J5QA 3JCZA 2G82A 4YJGB 3U49A 4DVJA 5JO9A 3JYNA 2BGKA 3VH2A 1CERA 1E3LA 1UXKA 2R00A 2IZZA 4FOSA 2GRAA 1H2HA 1PR3A 1MV8A 1WZIA 1ZO8A 3PHJA 4OM8A 3OQ6A 1NTOA 3S1LA 3UOGA 2POQX 1E1KA 2DBRA 4HP8A 1GFSA 5JAZA 2GN6A 1IY8A 2Q4BA 3KB6A 3HFGA 3E03A 1SB9A 2VT2A 3EUWA 4KMSA 3TF5A 3D1LA 1E7RA 3RC7A 4FB5A 1U3UA 2NU9A 5HBRA 5ILGA 2Y1OA 3KUXA 1AHHA 3GA0A 4DPKA 3PEFA 5I9LA 5JE8A 3D5QA 3G49A 1QORA 2Z95A 3SJUA 4P38A 4D43A 2YHIA 2QQ5A 1KVSA 2C0CA 1DAOA 1IPEA 4EJMA 1AUPA 3DTTA 4RORA 1ZIDA 3P7MA 4GX1A 1WDKA 2ZTVA 4WKGA 2B35A 4EEZA 3OP4A 3ST7A 4LRSB 4ALJA 3FI9A 2PFGA 3UH1A 1T2EA 2VOJA 4A26A 1B7GO 2O7QA 3K8ZA 4K9DA 1EBUA 2C5EA 1NR7A 4BUCA 2VHZA 2EF1A 1RYDA 4W6ZA 3EK2A 1TT7A 4G5HA 4R5HA 1SNYA 3RBZA 1V3TA 3MEQA 1J49A 5I7FA 3WGOA 2YFQA 1YVEI 2C5AA 5H82A 1FDVA 3I6IA 5I7SA 2X9NA 1XLTA 3CTMA 5ES3A 5TSDA 3I52A 4BNTA 3NAQA 1YXMA 5EN4A 4MP8A 4E32A 4A0SA 4DC1A 3R1IA 1A71A 1QV6A 1ZEJA 1ZMTA 2Y1FA 3D0OA 1LDMA 2X6TA 1Y8QA 5U9CA 4D46A 1QR6A 3GZ4A 3TWOA 5G2OA 1ZW1A 4FOOA 5IN5A 2DKNA 1HDCA 4L0QA 3HNPA 4MDHA 1C0PA 4XYMA 1PQUA 1WP4A 1MLDA 3B20A 1ZK0A 2CD9A 2HRBA 2JCYA 4RZHA 1FDTA 4R68A 1M75A 2QHXA 2F1KA 1KC3A 4IXWA 4D3DA 4CM8A 3C7CB 4J7UA 5A05A 4B4UA 4BMNA 5IFLA 5L51A 3OFSA 3KXDA 4CR7A 1YRLA 1C1XA 5DOZA 1R0SA 3RUDA 1QXSA 1WAMA 2A92A 1Y6JA 1QLJA 3VPFA 1ISFA 1Y8QB 1VSUA 1W4ZA 4UEKA 3F46A 4W7HA 4ILKA 3WBFA 3AM3A 4ZQBA 2J6IA 2ZCUA 4AJ4A 4FPXA 2AMFA 3HJAA 3GUCA 4YXFA 3WYBA 3AU9A 1X1TA 2GYYA 2VWQA 2FR1A 3INTA 4GLLA 3GVXA 1Q7GA 1ZK1A 3SC6A 3ETGA 3AUUA 1JKIA 3WB9A 3A9WA 3U5TA 3GPDG 3ANMA 3VH3A 4BNJA 1D7OA 2O4CA 2WM3A 3G17A 4FQ8A 2AXQA 2JD0A 2ZB4A 2NSDA 3JYPA 4AG3A 3KSDO 4MVJA 3K73O 4QXMA 3TL2A 1QYWA 3WGIA 1NPTO 2WD7A 4J16A 4NMHA 4WECA 5IDXA 5JDCA 4QO8A 3PRJA 5K0ZA 5JC1A 3GFBA 3BA1A 4XZ3A 3OIFA 4RDIA 3PGJA 4NJMB 4DPMA 1JU9A 1VJ0A 1VSVA 1W73A 2TMDA 3WIEA 1LDEA 3SXPA 3FR7A 1UDCA 4XR9A 2PY6A 4YVFA 2CY0A 5C5IA 3GDOA 1NYTA 1P1KA 1PGNA 1HE2A 4CL8A 1NVTA 3BAZA 3CUKA 2C54A 3LSYA 2FN7A 4PFJA 4EEXA 5ICSA 5EL0A 5FWNA 2DFDA 1VE9A 5COAA 1H9BA 1KEUA 4G65A 1E7WA 3AY7A 3B1KA 2NADA 3BHMA 1U4SA 1DRVA 1RPNA 3HN2A 5EJ2A 4PLPA 1HYEA 3MJTA 5G0TA 4TZKA 2Q4EA 4HNHA 2GSDA 2AE2A 1B2LA 4K1LA 3TZ6A 1OFGA 3G0OA 1PGOA 4WNIA 4KTVE 4TKMA 1U9JA 4DIOA 5JAIA 3VZSA 1N7HA 3DB2A 3GH3A 1YOVB 4Q3CA 2HMTA 1X0XA 3V1TC 2FOIA 5HM8A 3SLGA 1G0OA 1XA0A 1DIRA 5F1OA 1H0KA 4MJLA 3NTOA 3R6DA 1DFHA 4A2CA 1H94A 4L74A 4PVDA 3I4CA 3I9NA 3KSZO 1HLPA 2AQKA 3GEGA 4OH1A 4CQMA 3NT5A 1W6UA 3RQSA 4BNIA 1R4NB 2FP4A 3F1KA 5T57A 1GPJA 2DC1A 3PJGA 4O5OA 3ZW9A 2JD2A 4D0SA 2RIRA 2P9GA 5EMHA 2VWHA 2PKQP 3OICA 4WCFA 1E6EA 4GGPA 5TC4A 5TX7A 1I24A 1ULUA 3ON5A 5CHEA 1P33A 1TB4A 1B8PA 2O3UA 2YY7A 2NVUA 1DAPA 4UUOA 3H9GA 3WGGA 5IG2A 2FSSA 5A9RA 4PVCA 4F45A 1LDNA 4E4YA 5FF9A 3ITDA 4IMRA 4NJOA 3PJDA 3VTFA 1BXZA 5TJ9A 4BNHA 3NDIA 4E5YA 4OOFA 3JV7A 3LLVA 5T8KC 1NFFA 5CEJA 1B8UA 2X23A 2V65A 4FFRA 6ADHA 3ROMA 2Q46A 1KERA 5DBIA 3RUCA 4TRMA 3CMMA 1I3KA 3KM0A 1ZSVA 3OETA 1W0CA 4RVHA 1LI4A 2FPGA 3ZWCA 3DDNA 2DBVO 1H6AA 5JCJA 1KY5A 1ISIA 1UDBA 5DBGA 2UV8A 1DJQA 3KLMX 3Q3CA 4PN3A 5L45A 3AOEA 1ADBA 1JN0A 3WMXA 4NBRA 3LT2A 4UVIA 2DFVA 4AJJA 4BNFA 2CMDA 3FBGA 3H4VA 4XGNA 3IKVA 4OGWA 4BB6A 1E7SA 4HKTA 4OO3A 4UEOA 3BTUA 3MJ4A 3V2UA 1F12A 1XR3A 1ADGA 5ITVA 3AK4A 2YDXA 1ZUD1 5U4QA 4J43A 4ALMA 4FC7A 1I36A 1E7QA 1ADFA 1XIVA 3M1LA 1UXJA 2V6BA 3Q9NA 1ZMOA 4ZN6A 1XSEA 2VYVD 1BMDA 2G0TA 4L4RA 1PJSA 2CF6A 4IS3A 2XOXA 1F8FA 4QUKA 4XX0A 4DWVA 1DRUA 2FPIA 1Q2XA 1KETA 2H1SA 1JKJA 4GWKA 1DC4A 2XAAA 2B69A 3JQ8A 4AJNA 1ISHA 1X7GA 1ORRA 1QMGA 4L76A 4ND2A 5I8ZA 4DIFA 2O50A 3NJ8A 2O4UX 3NDJA 4QO7A 2YV3A 3KOUA 3OA2A 3ETEA 5T67A 3V2HA 1K5HA 2EXXA 1YDEA 4XYGA 2ZK7A 1PIWA 1NVGA 1T1RA 4O63O 4IGEA 1AGNA 3CEAA 3HDYA 3VVBA 2RCYA 2VHYA 4C7KA 1P3DA 2YQ5A 1P0CA 1WZEA 3FR8A 1J0XO 1YB5A 3L07A 4WLEA 4AJKA 3PLRA 4CV0A 3PIIA 3RFVA 1GZ3A 3T4EA 3GAFA 3RAJA 3W8EA 3ICPA 3BHJA 3DBHA 2JL1A 3JD4A 2IEBA 5EQDA 4HFJA 1I30A 5ENDA 1U7HA 1A72A 1LLUA 3I9JA 1I3NA 1ARZA 2X5KO 4Q3BA 2RH8A 4GMFA 3PHGA 2X9VA 1KS9A 4J1QA 4XRGA 4HFRA 5KWEA 4NI5A 4KQWA 2E37A 1WVGA 1MG0A 5A03A 3NGXA 1RWBA 1KBZA 3AFMA 1XQ1A 2HMWA 2IXBA 3IAHA 1FDWA 3KRTA 3AUTA 5U1PA 3SC4A 3DMYA 1EK5A 5IN4A 3FNFA 4CLHA 1U8XX 2O3QA 2EJVA 2X1HA 4U5QA 4JJIA 3OJ0A 5JAQA 4CR8A 3AI3A 4F6LA 1ZFNA 3DOJA 4XWYA 2FRDA 1NAIA 3DBLA 2WE7A 4PLGA 3GQVA 1BTOA 3GZNB 4YT2A 1V0JA 2Q1SA 1L7DA 4XYBA 1E6UA 2ZB7A 5ER6A 3AOGA 3MJCA 4YQYA 4EUFA 2X4GA 4B3IA 2Z1NA 1B3RA 4H16A 4J0FA 4NDNE 3D64A 1T24A 4E2YA 1BVRA 3COSA 1A9ZA 3RJ9A 1LX6A 4BB5A 4NFSA 1P9LA 1TT5A 4BKOA 3T4XA 1YB1A 3FTNA 2QG4A 4NBVA 1PWXA 1YWGO 4YT5A 3RUAA 3ZV6A 2HMUA 4CV2A 1GTMA 3LYLA 3QVOA 3F4BA 1MG5A 1XU9A 4RGBA 3LC2O 3H9EO 2QYSA 3ZV5A 4Q3NA 4B8ZA 4DPLA 9LDBA 4CM7A 1JAYA 1YQXA 2VYND 5AXCA 3WGTA 1CYDA 1K2WA 3C1TA 4RVUA 1Q0LA 1HT0A 4TRJA 1O95A 2I67A 4CM6A 4CODB 3ABIA 1A9YA 2AEFA 4DBZA 1E3SA 3ZV4A 1DC3A 4J1NA 1KIFA 3GDFA 2E4AA 4O6VA 3HDQA 4MVJG 2NU8A 2GLXA 2GD1O 4YJHA 2BFMA 1PJBA 4LSMA 1IHXA 3JQAA 1YJQA 1BDMA 4O0LA 4PLWA 4E21A 4YAJA 1HKUA 3BZUA 3JYQA 3C3XA 1YS4A 2Y1DA 4OSOA 4IJKA 3ROQA 1ZZEA 1ZEMA 2FZEA 4MO2A 2OGUA 3P5SA 3QVWA 3M2TA 1R0KA 2HSDA 5BNTA 4A73A 1GDHA 4CMJA 3W6UA 4RV9A 2OOSA 2I6TA 1MX3A 3HHPA 2V6MA 3OBBA 4I5EA 2PZMA 3GAZA 3F1LA 5JY1A 2IRWA 2J5RA 1A4UA 2J3HA 3UICA 4A03A 2P68A 2DBZA 4JJFA 5A5FA 4GPD1 5AXBA 1YGYA 2GN4A 1H6BA 3CXRA 3BMQB 3RUHA 2NWQA 3W8DA 1C0IA 2BGLA 1X7DA 4Q3AA 1LUAA 3DBVO 4YR9A 5B4VA 1V6AA 3BTSA 3KV3O 1Y9AA 3PWKA 5KVCA 2BFOA 2PZJA 3F4LA 1QYXA 2C29D 4NFHA 4CMCA 2AQ8A 1F17A 4BKQA 1HLDA 2FY8A 1KOLA 4FC6A 4YAKA 4M49A 5DP1A 2Q99A 5F5LA 1UP6A 3PIDA 4CM9A 3E9NA 4B7XA 1MFZA 1ENYA 2QX7A 3DTYA 2B37A 2WYUA 3Q6IA 1ZK4A 2QIOA 3JQCA 1XU7A 4XIJA 2DM6A 4Z0HO 3WG9A 1JLLA 2WE8A 1AXEA 5GY7A 4GVLA 2HK7A 2ZATA 3ZNNA 1HYHA 4LVUA 4W9NA 4XQGA 1LSJA 1EVIA 4NQZA 3ZV3A 2Q2QA 4YJGA 3SX2A 4M86A 1HWYA 2DTDA 2GGSA 2JFFA 3CZMA 2A9FA 2CDCA 5L4SA 2PTGA 2YV1A 2X7HA 4DLLA 1O8CA 1PL8A 4IDCA 1H6CA 2ZB3A 4DLBA 3IDSA 2ZJ0A 2ZCVA 2X5OA 5DOVA 4MKXA 3RUIA 3NT2A 2OP0A 2HQ1A 4B4WA 1BGVA 1N9GB 3A4VA 3H7AA 2EERA 3QWBA 1R66A 3C85A 3VKVA 4BKPA 3DBRB 4I9NA 1ZVMA 2VRCD 4NBUA 2V6GA 1T4DA 3RKUA 1UJMA 2O3SA 1SZJG 3D7LA 3RU7A 1A4IA 1XDWA 3RIHA 4BNLA 3ITKA 1ENOA 2NTJA 3UW3A 4E13A 3K6JA 4Y6PA 1HYGA 1R16A 1G6KA 4MVJH 1P31A 1EK6A 2HUNA 1I01A 3ZWWA 1VKOA 5ILOA 2YZ7A 2X0NA 3Q0EA 2HKIA 2ZYAA 4IJVA 2Q1TA 3KZVA 4NH4A 1I5RA 5G0VA 4IPTA 2FR8A 1VKNA 4IDGA 5C7IO 3VHRA 2P9CA 4M54A 2Y1GA 3HB5X 4OXKA 4II3A 4IZIA 1GUFA 1GYPA 3TOXA 3H9UA 4J9UE 1QV7A 3RROA 2PLAA 4E31A 2AQIA 4WEQA 3ZU3A 3OF2A 4BNMA 1B26A 4EUHA 4ZRNA 4YCAA 5FI3A 5JPIA 3HADA 1OAAA 1U5AA 2CDBA 3I9KA 2GCGA 4CM8B 1XQ6A 4UVGA 3NTQA 2D8AA 1P77A 4CUZA 4CM4B 4KDFA 2DLDA 3LT4A 3L77A 1OZAA 2YFHA 2OBYA 3JQFC 4WLOA 3WGHA 3DZBA 3DZHA 3HUDA 4BGUA 3KYBA 3DBLB 2O2SA 5MGBA 3PJEA 3D4NA 4GKBA 2C07A 4CMEC 4Q9NA 5AQ1A 3ZWMA 4MVJM 4N54A 4R1SA 3WSVA 5T6BA 4N5MA 4RF2A 2JJYA 2XXBA 3BMNB 4PLZA 3FF4A 2D5AA 1SO8A 2UUOA 4CLRB 4GSKA 1NHGA 3H5AA 1PGPA 1GD1O 4RQUA 4BO2A 1U3VA 4XYEA 2AW5A 1HDYA 3BTOA 3IQDB 4WUVA 1YJ8A 1DFIA 3MZ0A 3TSCA 1CETA 3PYXA 1LU9A 5L95A 3DOOA 1L1FA 1LDYA 4I5FA 3FWNA 5JMWA 2V6FA 2O3TA 2CVQA 4CM5A 3MTJA 4PG4A 4U0JA 2UVDA 4RVDA 5JLAA 2VYVA 1XELA 1BSVA 1SC6A 2ZQZA 1SMKA 5JYDA 1DSSG 1UAGA 4FFLA 4BS9A 4BVAA 4CUJA 4YYZA 3MJVA 3TQHA 1GUYA 1LDBA 4M1QA 2ZTUA 1TA4A 3I6QA 1LSSA 2J8ZA 2Y05A 4NPCA 4E30A 4IINA 3DEYX 1HETA 3LF2A 4KWIA 4P4GA 4X54A 1DHRA 4JX8A 2EKQA 1I0ZA 1VLLA 3B1JA 3H2SA 3QWFA 4BQPA 2PGJA 2ZIZA 4UULA 1RYEA 3KTDA 3I9MA 3ICCA 2VZ9A 4W7IA 1M2WA 1P45A 3L9XA 5IXSA 5BSEA 3C1AA 3O9ZA 1M66A 4RF3A 3O03A 1OC2A 2BGMA 2QRLA 1V3UA 5CDYA 4CLOB 3JQFA 4XEHA 2OHXA 3I3OA 5TQVA 3JQ9C 3U09A 1GADO 2EGGA 3HSKA 4GVXA 4AJHA 5BSHA 1N1GA 4CV1A 4IDEA 1AXGA 1JVSA 4J91A 1JAXA 4MOWA 2JHFA 1N5DA 3PFWO 4EUEA 2YYYA 3INGA 4D79A 2FWMX 3LT1A 3WYEA 1A27A 1U4OA 2B83A 1SBYA 1Y8RA 3CE6A 2DAPA 3M6IA 3RVDA 3T7CA 1U7TA 4GGOA 1HL3A 1Z75A 3K5PA 4K26A 4IUYA 3TRIA 1Q7BA 2B5VA 3U4CA 2EP7A 2C20A 4Z0PA 1TXGA 1Z7BA 3QQPA 3VPXA 3FHLA 4IIVA 1VL8A 4GQAA 3V5NA 3TNLA 2O3RA 2CF5A 1R12A 1IOLA 5JXWA 1V9LA 4BMSA 1S7CA 4GI2A 2PD4A 3UCFA 1T1SA 5DCWA 2P91A 5K6AA 2VUSA 1I33A 1EVZA 4LGVA 4NBWA 3WQQA 2R6JA 1J5PA 1ENZA 5JW6A 1PU2A 4ZQEA 1XKQA 4RPGA 3VAZA 3B1FA 3L6DA 4CQMD 4BNKA 4B7UA 1P74A 4R9SA 4JNKA 3MJEA 3D3EA 4WGGA 2W2KA 1K6JA 3H8VA 3G79A 3ZNOA 4DL9A 3DR3A 1KEPA 1Z45A 4W82A 3SLKA 3DWFA 1OC4A 2C59A 2FR0A 1JWAB 3H3JA 5CPBA 1DIAA 5KNLA 1RM3A 1UXGA 4FFNA 2UAGA 4IQ0A 3FTPA 3WS7A 4ALKA 1DIGA 3ANNA 4IXTA 1MUUA 3K31A 4B4VA 1K6XA 1NFQA 1LXCA 2Z5LA 1C0LA 1K3TA 3ZHXA 1NM5A 1EE2A 2W8ZA 4J3FA 5CP8A 1OBFO 4BNGA 1GEGA 3IMFA 2PKQO 1CWUA 1EMDA 3ZGYA 2B4QA 3EHEA 3RBXA 2H63A 4E33A 4RL6A 1IPFA 4YRAA 2CNBA 2EW8A 4R16A 4FSHA 1ML3A 4JQCA 4GX5A 4EGFA 3W4KA 3FPLA 2E82A 3GDGA 5A4DA 5FYDA 1I10A 3H5RA 1U8FO 1VJTA 3GC6A 3K92A 4RF4A 3AWDA 1Z73A 5BNIA 3TL3A 1E7YA 5TLSA 3KLPX 1SPXA 9LDTA 3W1VA 2OUIA 3EW7A 5F21A 2NU6A 3BMCB 1GCUA 2EHDA 3QA9A 4CR6A 3JD0A 4GBJA 3WXBA 2G1UA 1N2SA 1MP0A 1BWSA 3E5MA 1NHWA 4J7XA 3E18A 1DOHA 4L8VA 4TROA 4LN1A 1GV1A 3A14A 4Z9FA 4DUPA 4Y67A 1KVTA 2DUUA 2I3GA 2DTXA 1Y8RB 1JTVA 2ZTMA 3GNTA 2OZPA 4OOEA 1T2AA 3ZU4A 3AU8A 1N7GA 2JKVA 5HS4A 3U9LA 3V1UA 3RI3A 1LLDA 1X13A 4DYVA 2E49A 4QFDA 4Z3KA 3PGXA 2WDZA 3A06A 3ZNQA 1RM4A 1YO6A 2NLOA 3WDSA 3EZLA 1ZJZA 2VNAA 1NQ5A 2HAEA 3EGOA 4C7JA 1XGKA 2BMAA 4XGIA 2Y0EA 3TFQA 5KVSA 5TIIA 3WX0A 4D0RA 4F6CA 3GGGA 2YW9A 1EUZA 4J4HA 5I8WA 3LC1O 3LC7O 5LCXA 4J4TA 1W8DA 1TLTA 4ZHSA 3NEPX 1GY8A 1SOWA 4XGKA 3IP1A 3H65A 1I2CA 4TRRA 4JN6B 1PGQA 3F47A 4XKJA 4BL5A 3NTRA 1N92A 3DL2A 2GZ1A 2J3IA 2YQ4A 3EDMA 3PDUA 1MB4A 3IUSA 4E6PA 4IY1A 2Z1MA 3E82A 3JQAD 1N8KA 2VT3A 4FGWA 4I1IA 2X0JA 4JXKA 1NVMB 4KUGA 4ND4A 1PJLA 1YL5A 3WIDA 3HG7A 1LEHA 3AFNA 4HUJA 2A94A 3DMTC 2ZYDA 4MIEA 4QEDA 3Q2KA 1JQBA 3DAGA 2D3TA 1P1HA 5CDUA 4DYDA 2HO5A 3RC2A 2HLPA 3ZNPA 1ZH8A 2X86A 2O2YA 4HNGA 1JKFA 3BTVA 4K28A 4YRDA 4D44A 1DDOA 3M2PA 3EC7A 3LLSA 4IDAA 2B36A 1UP4A 4KUEA 2A35A 2YHUA 4NU5A 1Z6ZA 3VZRA 1DIBA 1UXHA 4WK6A 3HB4X 1PZGA 2UUPA 2VNSA 4TMFA 3IIEA 2OL4A 4FW8A 3GEDA 1E3IA 3RUEA 4G81A 2CUKA 3GVCA 3Q1LA 1QYDA
chains in the Genus database with same CATH superfamily
2Y1EA 3VJKA 4FBLA 4HDNA 4V24A 1RLIA 1H66A 1IQUA 2EQBA 4DV7B 2J9ZB 4IIXA 1YSCA 3SHFA 2QN3A 3FDZA 4MQEB 4AMZA 4PG5A 2OLEA 5IX8A 5EUCA 3A36A 4TYPA 1N5KA 2WJJA 2Q1XA 3NWEA 5BVHB 1G59A 1YQ9A 2HOQA 1D7AA 1F20A 1XZDA 1E59A 1IDOA 3CF2A 2O52A 1IAQA 1GAEO 1FU7A 2J4CA 4FDMA 1W88B 4GR5A 4BMDA 1WW3A 4IX9A 1EAMA 4JOSA 3H8WA 4PEVA 4PPYA 4CCSA 1XX6A 1RTTA 2ILTA 2VLIA 4YRCA 3VI3B 1YVDA 3QMPA 4NZZA 3UGKA 4V2IA 4A27A 2C2GA 2YHIB 1ZINA 1E9DA 4HDKB 4EO9A 1GPLA 2C2KA 3ESXA 4Z9YA 3B5EA 2HRCA 1NF3A 2DWQA 2O9JA 4YBZA 1ZM7A 3ZD8A 2ODPA 1JJ7A 4LVNA 2FMIA 4CL3A 4E14A 3UXYA 2EG5A 1T43A 4BMPB 1IQ0A 1KVUA 1ZHHA 4PAQA 1WPXA 1IHYA 1OJLA 3A1NA 2WM2A 3PPVA 1Z34A 3BL6A 3LUJA 1YQDA 1THTA 2I9PA 2ZZMA 2QUZA 4KUHA 3HK2A 5CIWA 3NWJA 1Y4SA 3ADOA 3FB1A 3IILA 3KO8A 3JQEA 3PPWA 3QUSA 1CQJA 4KX5A 3K8QA 4EG8A 3LT5A 4INAA 1FU8A 2XSZA 5DSXA 1RU3A 5KJCA 2MSDB 3T3HA 1W8IA 1U90A 4L4XA 1EX9A 4GRIA 3ZHRA 4QDTA 4KSYA 1LNQA 2CSUA 1VMEA 3HJHA 1M8PA 4I08A 4NK5A 2XUGA 1Z37A 1F0YA 3THSA 3QUAA 5EGNA 1TA0A 2B8JA 4LQLA 2ZBQA 3BWBA 1WSBA 3GG2A 2EJTA 3EVGA 4G07A 2FH5B 4RACA 1RPZA 1WHTB 1D0SA 2P9JA 4CRWB 3OCWA 4QTYA 3TOVA 4N03A 3U4GA 3PFCA 1OKKA 3RD5A 4LDPA 4AI6A 2G1KA 1LF5A 2O2IA 3V4OA 4MPJA 1VHLA 2D4AA 3TR6A 1SUDA 1NBWB 1EUDA 3HCCA 1PYGA 1SD1A 3PQDA 3ZH2A 2KLBA 4BO8A 2OC4A 3P20A 1WOMA 2BJVA 4GAEA 1K6EA 4FT2A 4YACA 4DGSA 1QQ7A 3QI7A 4FXOA 1A2OA 2J4DA 4P54A 1FNDA 1BX0A 4U6QA 3JXEA 3RFXA 4MS1A 4ZXFA 4EW2A 1HZJA 2WHEA 4WKNA 5AXDA 5M04A 2HPAA 1U02A 2VJQA 3IBSA 3GXBA 2VNHA 2QN2A 1AHIA 3TQTA 3HEMA 1LA2A 4TTQA 3WKCA 3PE3A 4B4KA 2QJFA 3EY4A 3NORA 4HQFA 4JMLA 4XARA 3WTBA 5L7WA 2DJ5A 3G7UA 3B82A 2P9TA 3F3MA 2DUWA 2GCOB 4ANFA 3KSAC 4ETIA 4O33A 1DWQA 1JYSA 2FB9A 2PZAA 3PQ7A 4KIFA 1HQDA 1AKEA 2IYTA 2TMKA 3JQGA 4UBLA 1FNCA 1NU8A 1GJRA 1U6KA 2XCIA 3GO4A 2NU8B 1GITA 1KKLA 1OXTA 4OHKA 4NV0A 4ND1A 3VKWA 4COKA 4C30A 5CFPA 1TVEA 3CN7A 4P9NA 4S1OA 3AB8A 2DSNA 1EKXA 4KGVA 1XP5A 1R15A 3AJ8A 4HDQB 4N3AA 1FTNA 1F8UA 1OFUX 1PR5A 3QEJA 1CVLA 4RADA 2JJ8A 3OM8A 5HK9A 3IQHX 3AVUA 1F1BA 1P73A 2IP2A 5CTJA 1RAEA 3AFGA 3DULA 2JBAA 4ALIA 1VDZA 4XX0B 5AJWA 8ADHA 2G9VA 2I99A 4ZCIA 5T4FA 2G5PA 2ORYA 4AS3A 3Q7EA 1X1EA 3S2SA 1B8VA 2PSEA 2Y2UA 2Z2KA 1IZZA 4OBBA 4O2BB 5JNTA 4FGKA 2WJWA 5JJBA 1NI4A 1WPQA 3MS7A 4XLZA 4ZHQB 4CL2A 2PKCA 5HCNA 2IPAB 1M1UA 5JSYA 5JRJA 1HG0A 4EY4A 3WO0A 5DKFA 3IQWA 3GRYA 1FX0B 2IHJA 2PWYA 3OZXA 1JQ3A 3DHYA 1ZCJA 4I55B 3RTDA 3HGMA 3FWZA 3QEMA 4KDRA 2YKGA 1A98A 1BE1A 3EMVA 4JJKA 2FPWA 2PKRA 2XSZD 2YHBA 1ZK3A 3DBIA 1CUSA 3GCWA 1MKYA 4MIKA 4YLYA 1S3GA 4PNPA 4R9UC 5AM5A 3U4DA 4BNNA 2ZUTA 4Q16A 3HLKA 3BREA 1ZESA 3LZCA 1K8QA 1JKXA 3DGFC 5KOJA 4FWTA 2HNAA 3L1HA 2CVZA 3IJ5A 4H3VA 4IDHA 5GZ6A 2R1VA 2HDHA 2ODTX 3R75A 3TW8A 4EBBA 3BT7A 4KXFB 3LKBA 4P80A 4BE7B 5CYPA 1MAUA 4QXPA 2GT1A 4E46A 4F2DA 3KX2A 1WPGA 3F71A 4TPKA 4DRYA 2GBFA 4RPCA 1THGA 3JATA 2XYHA 5CA1F 1LI7A 1NI4B 1YZLA 2FX2A 2RG7A 5C34B 2IU3A 5SY6A 3TSYA 4C01A 4DV1B 1QTIA 4AY4A 1OB5A 1PE0A 5E9AA 4B3TB 4DNXA 2FGKA 3F6YA 3HB7A 3TTXA 5DB4A 1YACA 5DGXA 1BU8A 1NQVA 5A3VA 3K96A 5JYEA 5A62A 4NJEB 5IDYA 3IEXA 2GXQA 4Z9BA 1USIA 4EFNA 4U5XA 4ZOCA 4QKQA 1CKEA 1CXZA 1WCYA 4Z51A 1F0NA 2XYQA 1Y9DA 2ZJAA 3L49A 1WXGA 4RMJA 3KQYA 4CW7A 2OGZA 1UPAA 3AV0B 1F2VA 1PJRA 3NYQA 4P2GA 1OYOA 5CT8A 4D4JA 1Q84A 4L8YA 3WIOA 1M6WA 1VLQA 3TZEA 3OCCA 3UUWA 4US1R 4BYGA 4DLAA 4NCNA 1GA6A 2QROA 2B98A 3K15A 2CXUA 5IKEA 1UWLA 4FM9A 5EJEA 2GKGA 3JD3A 4X9XA 5K4AA 3NCHA 1FUIA 1PT6A 4G85A 3P9KA 1HE5A 2GPSA 2BTOA 2F9MA 1QOPB 3H87A 2EX1A 3L7IA 2E55A 3BERA 2IXGA 1Y37A 2WTEA 1TYBE 3P9IA 1AT1A 2IS2A 4AP5A 2L0XA 1R8YA 4OHWA 5FLEX 2HUPA 3I4LA 3LDHA 3NBYC 1T9HA 3OZBA 1BROA 4DIBA 1Z88A 1J21A 1IZ9A 3JZFA 5FNZA 4IGAA 2WHQA 3U4HA 1ORHA 1BXKA 4TTIA 3BSYA 3UAGA 2ZAIA 1Z74A 4RQTA 4ONEA 3VZPA 1FJ2A 2FW8A 1J0CA 4PU0A 3WYNA 2YWHA 3L0ZA 4K9SA 1U8TA 2W2LA 3H7IA 7REQB 3F3YA 4D4MA 1LDGA 3NHPA 3T3IA 3X1DA 3RRNA 1D0VA 2NUBA 5HDQA 3DBRA 1A9OA 3OM9A 4R84A 4TTSA 3DLPX 2C4MA 4XVQA 3IE1A 1JLHA 3PC4A 1KEVA 4HSGA 1J4AA 4KFTA 1UZAA 1YIAA 3NEJA 4OLHA 4TXJA 2GZAA 4N47A 5CW2A 221PA 3TUJC 3U62A 1I4WA 4XJVA 2ZGVA 5JZBA 2GAAA 1ABBA 1MDBA 1HEUA 2OE2A 2CCKA 3MG9A 3F2IA 1EB9A 2Y8EA 1OIWA 4FDLA 1LLFA 1W75A 3E8XA 3NH6A 5EPUA 5CB0A 1JH9A 1QTQA 5TQJA 4DRXA 1UMDB 3ONDA 2ZZNA 4FZJA 5E38A 4UASA 5A3RA 1N0UA 2J59A 2OYSA 5D84A 5K3BA 3TZHA 4TWIA 5HIMA 1W76A 1NWCA 2IY7A 4P83A 3LCJA 5FWXB 3WJ1A 1D2EA 2UUBB 5JCXA 3CNOA 2IIBA 3P9NA 4DUGA 1T4BA 1J8DA 3NTUA 2FZWA 1KP3A 4JASB 4IAOA 4Q3OA 2VHUA 3ZE1B 1SK8A 2D59A 3ZW7A 1E5XA 4OAPA 4LWQA 1O6GA 5JSHA 3V9AA 2VNJA 1XLVA 3IDZA 4YLGA 4D2IA 1AKMA 1HTBA 3U7IA 5E4JA 5IXJA 3OKFA 3BDVA 2G36A 1X14A 3AHCA 1P5RA 1TMKA 1UEJA 1O6ZA 3PYMA 3FDFA 4G86A 3DBHB 4XQCA 1TA9A 2LD4A 2Z3WA 3GRPA 3G9XA 4I3FA 3HGTA 2J3JA 1XPJA 1W30A 3AG5A 5AK3A 4N48A 1ZX1A 2A8YA 2RHMA 5TVKA 3WJAA 1WNTA 4JX9A 3EX7C 4RE5A 4AZ3B 3F6CA 1H4SA 1XV5A 3HDJA 1N78A 1KAQA 2VZEA 3RRMA 1SBHA 1M0WA 1U80A 4QBIA 5KVAA 3LTEA 4WIAA 2XRFA 5J2UB 4Q4HB 4RCYA 5CFMA 1QHIA 4W1PA 4UTOA 3SXJA 5IAAA 1QE0A 1ZXLA 3OJEA 4LQCA 2BOVA 3AGQA 2FNAA 1QR2A 3CGWA 4UCWA 3CNBA 4IO0A 1JDSA 2Q6IA 4YB8A 1LD3A 3T9EA 1EZ1A 2XCOA 3ENKA 5JVDF 1PTJA 2EGUA 2RGXA 1SBZA 4Z4FA 3EXFB 4BMZA 2QW8A 5A7GA 3LOPA 2IEGA 2OO5A 2QLJA 2X13A 4AUNA 3WR5A 3SQWA 3OQOA 1QG6A 1PL6A 2QX8A 3ORSA 4R3UC 4CJXA 4IIYA 4E11A 1WHSA 1TOAA 4CTJA 1CJTC 3D7SA 3N7TA 4KQXA 4JR2A 4OJNA 4DANA 4ZI7F 4JC0A 3MOGA 4P3NA 4QUHA 2JFQA 2XNJA 2XWQA 4V0ME 3VC7A 5KQSA 1A4XA 1XNGA 4MV0A 1D1TA 3LY9A 5CEFA 3FCSB 4GBMA 4AWAA 3HUTA 2Q5QA 3QIVA 2OYRA 5EJ7A 5KCZA 3S4YA 5LUAA 2GUWA 3LVFO 1NW7A 1TEHA 3QQ5A 4FJ2A 3GPCA 1RYNA 5EP4A 4RZUA 1Q0UA 2PR2A 3OFJA 3WWZA 1C9YA 3TGPA 2VDLB 4HZUB 4JL8A 1MZVA 2WF9A 2HFKA 1XL1A 1GU7A 4P4SB 3ZKWB 1ZNQO 2OMEA 4YTEA 3PKJA 4BWYA 5I45A 4U7DA 4AC9A 1ZY2A 4KPFC 1KJWA 2H06A 2HADA 3AHEA 1E0JA 2JAOA 1UINA 3BL8A 4PYKA 1YDWA 4HGRA 1K1EA 1UF9A 2ODWA 2GAIA 1M2GA 4N3GA 4OQPA 1N3BA 4KZPA 3LQKA 3UHJA 3E84A 2R751 3RGWS 5IW8A 3FFTA 4QU9A 1RZRD 3ERCA 4B4DA 3ONFA 3FWHA 3I39X 4CM9D 4EYEA 2NQ8A 3L7OA 4FI3C 2QSUA 3X2FA 3OJLA 2MDTA 3V6LA 3TD6A 1NNEA 3MT8A 3HV0A 1E3WB 4BGIA 1N6OA 5AKKA 1E0KA 1VL2A 3PI7A 1TO6A 2ZRCA 4P0TA 5KTSA 3EXEA 1E4YA 4IUBS 1QOZA 3L8DA 2I03A 1ODSA 1Y8ZA 1Z9BA 4GXTA 5JSKA 3T9FA 4D7AA 1L5HB 1Q21A 3D8RA 3ICQB 1SOMA 2L2QA 3DVSX 5IH3A 5I7HA 5IAOA 1P0MA 3N7UA 3PDIA 5KVVA 2NV2B 4D45A 2IVFA 3DE4X 3I12A 1QHGA 3L8GA 4CF4A 3O1HB 3MQ2A 4CDMA 2VSQA 4JXZA 4UTPA 1QRAA 1ZU5A 1A77A 1A7AA 1AE1A 1P2SA 1WTAA 2X5JO 1P8AA 3HCBA 4K6GA 3B3GA 4Y8VA 5DLDA 4IDBA 4ZTBA 1CUCA 3WLRA 4A8JC 2M6KA 4B09A 1UAYA 3FFBA 5JS7A 4FFDA 2CHEA 1W47A 2Y4NA 4C20A 1HI9A 1R8QA 1PZEA 3W3AD 2BM8A 2ZIFA 4YRKA 4R41A 1AH2A 1U2RA 3ROFA 3GNLA 1QPZA 3MJSA 4MW9A 5DN9A 4XVHA 4PE5B 4PLYA 5CNMA 5FUXA 2OFPA 5F98A 4HX5A 5CAEA 1COZA 1B43A 3I2YX 1O5OA 1SULA 3AKCA 1K7FB 3K32A 3KHKA 3NXKA 3IDOA 3PVZA 2VWPA 4OAQA 4UE3S 1C1DB 1JPUA 5B1EA 3KPYA 4FYYA 1S3IA 2WPDA 4LY3A 3SS7X 2JHGA 4CVNA 1FVFA 1W87A 3SDBA 3WB0A 4EHBA 2IU0A 3FHCB 2CUNA 1HDRA 3KAPA 3WLTA 3ZCRA 4ARVA 4EKDA 3T7SA 1E9CA 2MJLA 2J46A 1MDFA 5JQGA 1P1FA 1VXOA 3ADDA 2QPOA 4F7DA 3DOCA 3N8DA 3IKMB 3TW8B 3TFOA 1U7PA 1ZYUA 2FWNA 4AKTA 2G06A 4YJ2F 3ZU2A 1MORA 5ESWA 2HF8A 2W2XA 2IEDA 2W2OA 2XMCA 3OZDA 4O1MA 1DJLA 1E2KA 4YNBA 3WMRA 4LSZA 9GPBA 1QGUB 5F2KA 4LVCA 4Q1CA 1U3WA 4HTFB 3B6MA 2GASA 1JHUA 1YDFA 3AB3A 4II2A 1V25A 2FQ1A 1W581 3SJZA 3VZDA 4DBVO 5IUNC 1E5LA 4WZBA 5D3MA 4YQFA 3H1TA 4J0KA 4XDZA 4CIVA 2HK9A 5KVQA 3QX8A 4RKQA 5C37A 3P9CA 1DXQA 1IE3A 1RJ9B 4M1EA 2FFHA 3UATA 4F9GA 5HA5A 3PNLA 1SB8A 2C5BA 2FLKA 2LCFA 1Q17A 2BLLA 2ORIA 1Z7EA 4F04A 1PP4A 3C6KA 1ACJA 1C14A 1XDSA 1ZUNB 2W71A 5DNVA 1XMPA 5AVZA 1XROA 3EDOA 4NHOA 2YUIA 5AVUA 1X3SA 3QSGA 1JQDA 1P44A 3GEMA 4ABTA 5F33A 3VO8A 5DK6A 1J0BA 2AG8A 3D3JA 1UBMS 2GX6A 2VJYA 3PFKA 2WRZA 2CLFB 1UOPA 2NTYC 1PWHA 3PB3A 4G1CA 4ZO7A 4JQZA 5GZ3A 1I7QB 4UD6A 1FFXB 2GN2A 3D8UA 5E6SB 3Q7TA 3AVXA 1O9BA 1XLUA 1R9GA 3IKJA 3QVVA 3AR7A 5LDGA 3PNPA 3UK2A 1K8YB 1W6RA 1EFUA 4MV3A 2ZAOA 5ALZA 3EWNA 4PBRA 3V4VB 1AVTA 1HURA 2WSLA 3G7SA 3ZN2A 3THYA 1FIUA 4R51A 1WB9A 1R4MA 3A1TA 2VSFA 4XR4A 1EPUA 1WEHA 3P45A 1M1YE 3M34A 3QWHA 4HDNB 4S12A 2AG5A 1I2MA 4ENSA 5JEEA 1H6DA 3FB4A 3FVVA 3LL7A 3D1VA 4OXNA 4UBKA 2OOKA 2X8LA 4PPFA 3T9CA 3MWDB 4WZAE 2EFDB 4YP7A 1BWRA 4B46A 4IDOA 5I01A 3VC1A 1UKYA 1NVEA 3DNFA 3N0VA 1P1RA 1XNHA 3FX2A 4MPDA 1OIVA 4KN6A 1OXSC 5EZYA 4ZYWA 721PA 2IH5A 3CSDA 2GBGA 2VHTA 1KMHA 3SI7A 2IS1A 1MFPA 3JALB 2R8XA 4ZVKA 4AECA 3E5NA 3GLHA 1JR3E 3T5MA 4QEKA 7ADHA 3GHYA 1KQNA 4XD2A 4DQXA 2PX6A 2OMKA 1UP7A 3L6EA 5EWMA 3ZHZA 3VAYA 1ESDA 1G3RA 4MQFB 2R66A 2YJ5A 1XDUA 3CFYA 4N5NA 1PWEA 3W77A 1YB4A 4IWYA 4UUMA 3TVYA 2QLFA 3M5CA 4W1RA 5JXGA 5I7OA 3RC9A 4OHCA 1O89A 1R5BA 2WIKA 3AETB 1K06A 3FVQA 2OXIA 4ARIA 3OFND 2HB6A 3N86A 4LKRA 3GEPA 1AF7A 2JJMA 3NETA 3DFKA 3EOAI 2ZTLA 1NP6A 4Q7LA 3MCWA 1LPNA 3NP7A 2PMFA 2CMKA 2CCJA 1PJ8A 3GPIA 5DTIA 4PLHA 4Q4AA 4Q1VA 2HD4A 4IH4A 1PT9A 2XXJA 3ETJA 3S28A 1YQQA 1Y5IA 1FDIA 2X0IA 3BMOB 3DZKA 3BYZA 2NXJA 3KYIB 3MBIA 4W8GA 3OUUA 3ZU6A 4DWJA 2MOKA 5L6MB 1P4HA 5IZ4A 1VSQA 5DLYA 1EDEA 1EFVA 4X24A 2XNDA 1DZ3A 1JE1A 1YZNA 2ZRLA 3AMVA 3ECSA 3FPJA 1LK0A 3A9RA 1NWHA 3CLSD 3GUYA 3QLJA 4LJ8A 4YHBA 1N6RA 5JRZA 4RETA 1JJFA 1H5QA 4BHTA 3MD0A 4FMDB 1S2NA 2HA0A 3LBFA 4GFDA 3RTEA 4F4HA 5BXQC 1IAVA 1YRQA 5F78A 3G8AA 1JYEA 3S7ZA 1E20A 1LSUA 2F3TA 3LIIA 4AJ2A 3AZQA 1EFRD 1AXRA 1F6DA 3FNIA 3WA6A 1JHXA 3AILA 3I8OA 3O8DA 2P6PA 1ONOA 2GM5A 3K5WA 3FJ1A 3Q87B 4UEJA 5SYAA 5KWIA 3W6OA 2CNKA 2XQVA 1ZCAA 2GOYA 2Q1WA 3PDJA 1CQIA 2VJMA 3PTZA 1KWGA 4LNUB 4HVAA 1HDZA 2BFNA 2VRCA 4NR0A 1AX9A 2ZUFA 1YOVA 2PH7A 4BTEA 4Q00A 4C4SA 5CR9A 5IASA 3WTCA 4LMAA 4P4NA 4A36A 2E0IA 2CV1A 4R1TA 2GCNA 3WKDA 3ZTTA 2F55A 3Q2OA 2C8VA 4MP3A 4MMXB 3CS3A 7MDHA 1PG0A 1RYZA 4IUDS 4DA0A 3LF1A 3HS3A 1AURA 2C7OA 1CRWG 4L8GA 1OLSA 3CF4A 3SX0A 3DG9A 3O94A 4QUJA 2QZ9A 1BG6A 3C3MA 4IDQA 2BW0A 1TMYA 4OMCA 1NXTA 4RYDA 4P7BA 2RDMA 4YJKA 4D9CA 4X0EA 1BXGA 4OP2A 1IUOA 2AEJA 5BW5A 1LRJA 4TVOA 2QBYB 1U2GA 2H3HA 5T5QA 1N6IA 1LW6E 2PMWB 1G5PA 2Q3EA 4TMYA 1Z47A 4D8VA 4PLVA 3CKMA 3M1AA 2FAXA 2GNOA 1IBLB 1T5TA 4TRNA 1L7VC 5REQA 3T52A 4EQZA 1NOIA 1SKYE 2PZLA 1Y4AE 4MVJF 1STOA 1NQWA 5AW7A 1CYEA 3KYCA 3Q3VA 1BVUA 1YE3A 2J3DA 4HS9A 1HT3A 2BEVA 3TBKA 4NHEA 1P0QA 2XB4A 3GFPA 3V8MA 2OBNA 4UAJA 1HDIA 3JQ6A 2UVQA 4UBNA 3FW1A 5AOVA 1D2AA 4ZQGA 5DX0A 1DAEA 4X61A 2QY6A 1R9MA 3CT4A 3R4VA 1BW9A 3VYRB 1E8NA 1L0BA 3TLZA 4B6PA 1LQTA 3DKVA 2DKOA 3G9QA 2WA2A 5CVCA 1ECGA 1SCKA 1UM9B 5ESXA 3LHSA 3FKJA 4M7RA 5FQOA 1HSZA 3LHFA 2DKFA 2XNHA 1WXHA 2Q2OA 5CVDA 1H8HD 1SK9A 2OD2A 4ARZA 4WK0B 3K9WA 4MQ5A 4MW5A 5T3YA 3AR4A 2O48X 5BT9A 1GPBA 3KTAB 1OFIA 1GZ6A 4O29A 4KO1S 1D8AA 4HB0A 1JKJB 1IEVA 2C82A 2ZEJA 5GPBA 1DINA 3FGOA 5EIFA 4URVR 1B0AA 1IB0A 3P9SA 1SXJD 1J6UA 2FPPA 4N5LA 5J47A 1FRZA 1DG9A 4F9FA 3VZCA 1ZRMA 4ZOAA 4CIBA 3R6LA 1XYVA 4MAFA 3FUWA 5BSFA 2G5CA 3OSUA 4MMYB 1QO0D 4CE6A 3K20A 1CEQA 2FFQA 1Q77A 2R2AA 1LSOA 2CZQA 3GXOA 2QL5A 4RIEA 4KAXA 1CHNA 3MM4A 2A78A 3W6PA 2I8LA 1PGJA 3H11B 3UUEA 3CNEA 5CB6A 1XZBA 1B2RA 5F73A 3OQNA 3Q3HA 4TWRA 1A69A 4ENTA 4P8RA 4JGBA 4RHYA 3K0KA 2R7MA 5G0SA 2J5KA 1ZKDA 4JJ7A 4L95C 2VKQA 2GJ4A 2BRUC 1B93A 2L82A 4FEYA 2WM8A 1CW2B 1HDEA 3E27A 5I9MA 4EECA 1IHUA 1ZI9A 1M1YB 5K9ZA 4GBGA 2HQOA 1RLJA 2F00A 4W99A 1G8FA 1OXUA 4AO8A 1ZC3A 2FWIA 4EITA 1AQJA 3OE5A 4EGJA 1M5RA 4TVSA 4U9HS 2Q2WA 3GAMA 1ZD4A 1LH0A 2ZJYA 2C3YA 2PCLA 3C3KA 1SJ9A 3ISTA 3BL5A 1QPBA 3F0TA 1ONNA 2VJAA 1CDOA 2HV8A 3DDWA 1NNI1 2PT5A 1JXQA 1P2FA 2JFWA 2X76A 3MCZA 1RYHA 5CDGA 3NHSA 1Z0AA 4AZSA 5E7JA 3Q9UA 1HZZA 4G0PA 4H4CA 1QKIA 1MH9A 4FDUA 4X3CA 2UYYA 3LPDA 5TMPA 2YWGA 2CXQA 4BV8A 2GEJA 1JWBB 1X38A 3CE9A 4P36A 2QM8A 3R74A 1GAJA 2OQ2A 4F7WA 5PGMA 3CX4A 4CMBA 1Q50A 5CLGA 3QSYA 1M6VB 1OGJA 5IHXA 2FSUA 3D3WB 2GAJA 3KBOA 3IMKA 5CT9A 1IK4A 3BCHA 4TLCA 3W6ZA 3G0BA 5E1OA 2A86A 3LFUA 2P3LA 4F93B 1OH8A 4D3ZA 2UUAB 5CXSA 3WP1B 1OLUA 4DLZA 3WAKA 1YI1A 1YHYA 3TOCA 4EUNA 1YDGA 1GOTA 3E3OA 3O26A 4Q93A 2DB3A 2CFSA 4UBIA 5FUWA 3OPNA 5C1PA 3DEKA 3EQ2A 3HMKA 2GMWA 4JUCA 4C2AA 2BVNA 3NHLA 2DHCA 3L05A 2NX2A 1JGTA 3ASVA 4FFOA 5JVDB 1HR0B 4D3YA 2FMFA 4ZVTA 3UV7A 4BXOA 1Q0HA 3P94A 4BO4A 2SCUB 4HBGA 4Z7JA 2P4QA 2PK3A 5EFZA 4D92A 3I1IA 4YRZA 1XKTA 1V71A 2I1WA 3TDKA 2B5WA 3WL8A 1PX2A 4OX9B 1EEHA 5EHXA 1QE3A 5FA6A 2PX2A 3FCYA 4Z4HA 3FYTA 3SM9A 4DJTA 1UBTS 3P9RA 4WY8A 1XMSA 1FVHA 2A88A 2Y1LA 3HYSA 4AYTA 4DCSA 3R3WA 5E7MA 1EDBA 1L3IA 1XWFA 2P0AA 3GLRA 1IY1A 1MOQA 4PRLA 4Q1AA 2W42A 4KK3A 5DNYB 1WE2A 1IUKA 1CS0A 3C3JA 3DZFA 3F78A 3OWXA 4G5OA 4HN9A 1Z39A 5JD4A 3AR2A 2PGAA 4B6JA 4K6MA 3HJRA 4BFSA 4YUAA 5LB2A 4JAVC 5IPFA 3TLJA 2XMRA 1WV0A 1NLFA 5BSWA 1MXHA 5BSGA 4JI8B 3D5EA 3WK8A 2HU8A 2W90A 3C5CA 4WADA 3GJRA 5H9WA 4RZQA 4JI0B 3SNKA 4LMPA 2JHAA 3N8GA 3N3BC 2PD6A 3DHVA 1BX3A 3KQHA 4IIGA 3GVHA 3UV3A 4AF6A 4LYHA 1G3QA 4UFNA 3MUEA 1RJFA 2CEKA 1EUDB 1ORVA 3O2JA 1T4CA 3T5AA 2PKXA 3A1UA 4RANA 5J1SB 5C51B 3QYAA 2HJRA 3CB2A 4E2XA 1SQ5A 4G84A 3AY6A 2C3UA 3E7XA 3U16A 4Q7EA 1UJNA 2FR8C 3A6DA 3IO3A 4D3SA 4EH1A 4GIBA 1KMIY 2K2QB 3T0FA 3JATB 4Z5XA 4KN5A 1J7KA 4WJKB 2HW8A 1TZMA 2VBFA 3VBEA 2XIQA 4OXIA 2OFWA 4KXVA 4BNZA 1DKQA 5ICMA 1MRZA 4AL4A 1D09A 3NVDA 1XMVA 3AJRA 1ZGZA 4JFRA 2H5EA 4MW2A 2BD0A 4WXMA 4GLOA 3TSOA 1MRSA 4JLBA 2O8BA 4RV5A 1SZPA 2DPXA 5H68A 2Q9AA 1NXQA 2Y3IA 3GVPA 3ZU5A 1XLWA 1UM8A 1BRMA 1US8B 3E4CA 1TL7C 3ZXXA 4DQUA 3V4PB 5I5GA 5ALQA 1ILWA 2FUKA 4BNVA 1O0CA 2CV0A 5CEEA 3PU6A 4JLNA 1AV7A 1MGOA 5EQTA 4TYQA 1YS9A 4V3BA 2GXAA 1T15A 4IEIA 4Q1FA 3AR3A 3NHWA 2EFJA 2FWRA 2UVPB 4KIGA 1IJBA 5K3FA 2A2ZA 3FCXA 1PS8A 1A5SB 4LXQA 2PL1A 3EZ2A 1N8TA 3AJ9A 4NZYA 5G41A 5IT4A 2NM0A 2GM4A 1G42A 1CQXA 1GDDA 5G4LA 3CC8A 3R6WA 3U3XA 1Q1BA 4A7PA 3ZZTA 2OB2A 2ZFUA 1YQGA 1CUUA 3IS3A 4WE3A 1CDZA 2PUFA 4KOEC 1NC3A 1XJ5A 2AHRA 4F3NA 3EEOA 5DEOA 1VPWA 2EG9A 1NX6A 2I65A 2OQVA 1H2AS 4DAEA 3EPHA 3TM4A 1N7JA 1E79A 2QD5A 2QS9A 3L1JA 3TEFA 3AUJB 4UCXA 4XYLA 2ECPA 4KXXA 4MV1A 1DEHA 3NNDA 3V8VA 3HR4A 2XE7A 4TTVA 4X93A 3LK7A 3IV6A 2CHVA 2HJSA 1EFAA 1M67A 1UIMA 1DLJA 1ND5A 1NXXA 1WBJB 3CZPA 3HSYA 4L9AA 2Q5CA 5C7LO 3PX7A 2L69A 1N5JA 3N58A 3QLVC 5ALVA 1PFYA 4N4AA 4EDFA 2IYZA 4WHMA 4X62B 1TMOA 2C7VA 3K1AA 4ZI7A 3D1JA 1PUJA 3S2ZA 4O2AB 4OB8A 2HCJB 1DC8A 3QE3A 4KBYA 3RVNA 4CI0B 1LZKA 4L73A 4EJSA 1M0EA 1PAUA 3LO5A 4UREA 3T9DA 4RK1A 1FC0A 4B3HA 1I0LA 2F7SA 4MKHA 2WUEA 4CTOA 4QULA 4ARCA 3S1AA 3CRMA 3QNWA 2W6JD 3BGVA 5BR7A 4CEJA 1KY4A 2XTAA 1NJ1A 2AN1A 4UUQA 2ZE8A 2B2NA 3WE7A 1Z3IX 3LQ4A 3PGKA 3NJRA 3V8PA 4AO6A 1WU8A 2YMPA 3JZDA 4EG1A 3IUPA 1BJTA 1FTYA 3CEPB 4FBMA 3WVNA 4EUSA 1ICEA 1MR3F 2HFJA 2HU5A 2XQJA 1F1JA 4OQEA 2YCBA 1DAGA 1RQRA 3OT5A 1RKVA 4BMCA 4A5SA 3PDIB 1JBEA 2C4WA 2GVZC 2V3CC 1F2TB 3EJWA 1N33B 2PPLA 4RV4A 4NAHA 4WXHA 2JFGA 2CZGA 2QTHA 2D1QA 4HMPA 1KDYA 1X3LA 4UXHA 1M2VA 1T0UA 2YYSA 3LL4A 3PZBA 4LOKA 4QTUB 4RVFA 4BY9E 1RHJA 1QIIA 2BFPA 3QVGA 4H15A 3FKSD 1HDOA 1GZ7A 2H59A 4QYXA 3GZJA 2OXFA 2YRFA 1BN6A 1QIEA 4K86A 2B4KA 2MSWA 4DV5B 2O3JA 4I1VA 3M3PA 1N2BA 2DQ4A 2GN9A 4PAOA 1RI1A 3A3KA 2YR0A 1AA9A 3E3LA 2PV7A 3O74A 4U00A 2QRJA 1FOEB 2XGGA 3BWVA 3H6KA 3LLUA 3BULA 3KDAA 1NBME 1I2ZA 2JGKA 3EGWA 3SZOA 2DEUA 3LNTA 3AYXB 1EI9A 4FYJA 4UM7A 1QAQA 3QF4B 4FD2A 4QJBA 2NTVA 3VOTA 2LCQA 4P4SA 3WQSB 4QOHA 5J59A 4ILEA 1ULBA 3P0IA 4K40A 4C0KA 4BVKA 1P5ZB 2X1MA 1YFJA 3RSCA 3T5CA 5KCMA 4MRSA 2G1AA 1T1GA 4H6VA 4RO0A 4P7JA 3VAAA 5KYWB 1HE3A 3U0VA 3EEYA 2W70A 1MC8A 4DYHA 5DM4A 3DMTA 2BFEA 3B6IA 3DXFA 4CDRA 1IQPA 1Q0QA 4FDAA 4NE7A 3KT8A 5B3JC 4OAOA 3A2LA 4R4JA 2EIHA 3L8FA 4C1NA 1GKUB 1PK8A 2CJWA 3GNQA 4JLWA 4EHFA 1VPDA 1SKYB 3RYFB 3W8FA 1CNEA 1CD5A 3OA0A 4ZD6A 3GR6A 3R5KA 1Z5WA 3EAGA 3A6LA 2WTNA 3MS4A 3TIVA 4YV7A 2VF2A 5JFOA 2YWBA 2WV7A 4HMQA 1TKCA 2JGAA 3QYFA 1E3DA 4F3CA 1AHNA 5KNBD 4PZPA 4MUGA 4TKZA 1RXVA 1SKBA 4FFSA 1EVJA 1N2CA 2HLHA 5ALWA 1KR5A 4MVJD 2FMUA 2WU8A 1G9SA 1Q74A 2CXNA 1JAIA 1XCGB 2BHLA 2DHDA 4CMIB 1ZSNA 2NYRA 1NQOA 4I19A 4LTDA 4ZI5A 1IVNA 2C9CA 1ZIXA 2ZI4A 4DARA 5G1NA 4R0MA 1RHKA 1U31A 1U8YA 4YJGB 5CXXA 2FX3A 3LPNA 5T41A 4HRAA 3U49A 3WC4A 2HIHA 3W7VA 3JYNA 2F9FA 1CE8B 1L8XA 2VYQA 1FY2A 2R00A 3KVNA 4FOSA 1BHQ1 1Y42X 1XCLA 3FGNA 1K5DA 4OM8A 3R23A 4YH1A 5EEHA 5JV5A 4X20A 1IG3A 3S1LA 3GD7A 3CLVA 4B2PA 4DQ0A 6REQA 4HP8A 3AW8A 5JAZA 1YZ3A 1H3NA 5DX1A 3E03A 3KVVA 3LWZA 3D1LA 4Y9TA 2PO5A 1E7RA 1UFQA 3RC7A 5HZGA 1NE7A 5HBRA 3T7TA 1SELA 1VSTA 3NR2A 1TO1E 4OFXA 3ZOZA 3GA0A 3UAVA 1P1BA 4EENA 5JNUA 4ZRDA 1ZCBA 3UK1A 4NOLA 1CF9A 5DI3A 1X86B 5JE8A 4QDZA 4L3OA 1T0PA 2SBTA 2AOTA 2JH9A 1KVSA 3NO4A 1DAOA 1IPEA 2P62A 2ODQA 2ZSIA 4QQKA 1XDZA 2H2HA 3DTTA 4RORA 4Y2SA 2ZTVA 2IK8A 4D0GA 2P3OA 1W46A 4EHAA 3RR2A 2GH1A 3OP4A 2G40A 2R5FA 3SQDA 3W7BA 4A15A 3MRXA 4WDRA 2BPOA 3BUSA 5FUVA 3T95A 3RYTC 1SC1A 2XUHA 1VYTA 3Q1KA 1E5TA 1EBUA 1LBQA 1EXNA 1NR7A 2AWOA 1IXKA 3BSSA 2IEZA 5AVQA 1KPIA 4G5HA 3G23A 2DE0X 1D2RA 2FWJA 3MTEA 4FKBA 3ZLTA 1HBJA 1QANA 1S7GA 4ZVLA 5LIRA 3TZLA 3A1EA 5BQ5A 2YFQA 3VYWA 2C97A 2F1RA 1VMIA 2C5AA 2XBLA 1CUBA 4LAFA 4BN4A 3JYHA 2X9NA 1JH8A 1PDVA 2AG1A 3L4EA 5BSRA 3CTMA 4UTXA 5ES3A 5TSDA 3I52A 5EN4A 4C7BA 3A27A 1C7IA 3R1IA 4B84A 3FPSA 4G0OA 1NF2A 1XK7A 1XVTA 2D7CA 5GONA 5KEIA 2NXCA 2Y1FA 4AO7A 1XZPA 5TV2A 4R1PA 1Y0BA 4E22A 2Z43A 5DM70 4KPYA 2BBTA 1G7RA 4NZNA 5TMEA 1W44A 1WB5A 2QTVA 3TWOA 1ZW1A 4U2CA 4FOOA 3RO7A 5IKPA 2DKNA 4IF6A 3CLRC 5C4MA 1EIWA 2C5FA 3GI1A 4MDHA 2AMYA 1WP4A 4U4AA 3DT6A 1ZK0A 3TI9A 4OA5A 4D80A 3QVKA 4J7AA 1JFRA 2JCYA 4I4LA 3TNDA 2JEYA 3C3EA 4ZCRA 5B3LA 4RZHA 2GVDC 4RJJA 1LJUA 3LECA 4NYMR 4NZPA 4EWLA 3U9TA 4D4HA 1YCDA 3P9PA 4I2NA 4CFZA 4D3DA 3COJA 4XIGS 3KWLA 4EHIA 4CM8A 4J7UA 5A05A 4EDHA 4XUEA 1P7CA 1FXWF 1QX3A 1NUPA 3OFSA 3KXDA 4B4UA 5L51A 4MULA 3W1EA 1BFKA 4HCJA 2FF5A 5BMVF 1O9GA 2IYWA 2V9PA 2C4NA 1TVKB 4IUCS 4KKXB 4M9XA 5E9QA 1E66A 1QXSA 4F85A 1KDOA 4BLSA 2WWGA 2HA6A 5CM8B 1TUIA 3TQCA 1SVNA 1W4ZA 3HACA 4UEKA 3RIMA 1YRBA 3OAAA 1Y3DE 1DJOA 2F90A 3EZ6A 4ZQBA 2QDXA 3COVA 3URMA 4MKIA 3UT0A 5C0OE 4AJ4A 2AMFA 3ZI7A 4BQFA 1M8KA 2QDKA 1F7UA 1FSPA 1RTKA 4GLLA 1OY1A 3DDZX 2WKPA 3GVXA 4L72A 4YP6A 4G0WA 1Q7GA 3O90A 4M8NE 3A6ZA 3AUUA 1JKIA 2V7QA 3MJHA 3JVDA 4X3PA 5HKOA 1AQ6A 2OZLB 3LKZA 1Q6YA 5CNIA 3W2TA 1JIQA 2HSZA 3AVTA 3QVJA 4IQ4A 4FQ8A 4QAQA 4UMFA 3G17A 3T8YA 1QH1A 5HX7A 1EJ0A 1K63A 3V1KA 2R1ZA 1SCIA 1YB7A 3WB1A 4PQRA 1D4OA 2C4TA 3PGLA 3K73O 4F6RA 2ZRQA 2CLIB 2WD7A 1CBUA 4TT8A 5JRDS 1L8OA 3BFJA 2XYPA 4QO8A 3PRJA 3RSQA 1JDBB 3GFBA 5K0ZA 3PGJA 1J9ZA 3HI6A 4MS3A 4NJMB 3NHBA 1VJ0A 2Q8NA 4MHSA 1UK7A 3N53A 4RK7A 4UOQA 3TLEA 3WIEA 5LLSA 5GJBA 3DOHA 4K88A 5E0OA 2PY6A 3A1CA 1YZYA 4JH0A 1FE8A 2W6ZA 3LHDA 4MI9A 3WGJA 2A5DA 3ODGA 3LA8A 4UZSA 3BAZA 4G5RA 1U2DC 1NATA 1UOQA 1V48A 1Y7LA 2FN7A 5DHPA 4BEJA 4BEWA 4OMFG 2Z8XA 2B5OA 3D2LA 3RK0A 3BIJA 5FWNA 1XZAA 5COAA 2JRCA 2QN6A 4BLRA 1GXSA 2FP4B 3QMWA 1KEUA 5F7OA 1LS1A 3AY7A 3TLCA 5K5EA 2QZJA 1JV2B 1HYEA 1KKMA 4JP1A 1E98A 4NNPA 2AE2A 1B2LA 4GPTA 3HH8A 3KB8A 3U6BA 3IP6A 4K8OA 4BVJA 3W5UA 4P98A 1FMJA 5WRFA 1ORDA 2M98A 2QRVB 3AUKA 3HUUA 2RHGB 3DB2A 4OSEA 3KR1A 3WRVA 4A2WA 1YT5A 1YOVB 4MUAA 1C30A 5ED4A 1GTL1 4Q3CA 3PC7A 3OZ7A 3V1TC 4UEQA 2FOIA 5HM8A 1CJVC 5F1OA 4MRAA 2DWPA 3KKNA 3NTOA 3L01A 4CU2A 1O08A 1X74A 5JH7A 4ZGBA 2IYNA 3MAAC 4KMOA 4L74A 1FYEA 3E2MA 5EJ5A 4HPWA 5F7XA 2FPSA