5HTOA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1 (tetrameric ldh in an asymmetric unit)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
302
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
molecule keywords L-lactate dehydrogenase
total genus 113
structure length 302
sequence length 313
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5htoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5htoA02
1G1AA 2GERA 1EK5A 3FPCA 4OQYA 4YRDA 3SJUA 4U6SA 3EZYA 3LZ6A 4ND4A 1DC6A 3W8EA 1OMOA 4DUPA 1FXSA 4MINA 5KTKA 1LJ8A 1AE1A 1WW8A 4B4OA 1DRVA 2Q1SA 3DC2A 3QWHA 1VKNA 4I08A 4YA6A 1DXYA 3U9LA 3W4JA 1SPXA 1VC2A 3GNSA 3QV1A 1QV7A 3AY3A 4N7RA 4TVBA 1DBVO 1UP4A 1SC6A 5TJ9A 4GSLA 4U0JA 4HY3A 1AN9A 3I83A 3WX0A 4GLOA 4CPDA 1EUCA 3JD4A 1CDOA 2QRKA 4D79A 1FDWA 2C07A 3GH3A 2X23A 3S2EA 1HE3A 2GASA 2EIHA 2VHWA 4PZDA 4B7CA 4RQUA 3RI3A 1CEQA 4YAEA 4A26A 3EDMA 3DBRB 2IXBA 2YV1A 3WMXA 3JQEA 4FR5A 4G81A 1GY8A 3B1KA 4XR9A 1NVMB 3HQ4O 4BVAA 4FDAA 2NQ8A 4O1MA 4FJ2A 2Q1UA 4P4GA 5AXDA 2JAPA 3PHGA 4U7WA 1E7RA 3ZHZA 4CQMA 1E3EA 2J5KA 1U3UA 5TX7A 3PFFA 1PEDA 1GQ2A 1KYQA 1I2ZA 1UR5A 3SXPA 2FN7A 3UF0A 1SOVA 2O3SA 3FNFA 4NFSA 3EW7A 1PJ2A 3AUUA 2E6UX 5A5FA 2ZB3A 5I7VA 1LUAA 3FR8A 3N58A 3V1TC 1Y5MA 4MVJD 3DO5A 4Y6RA 4D44A 5FEUA 1N7GA 1O89A 1Q0HA 2Q4BA 2H6EA 3CPSA 4CM1A 2ZQYA 3E8XA 1ONNA 2VHYA 5FI5A 2DBZA 4GQAA 3RU7A 1PR3A 3NGLA 1M75A 2EV9A 2YJZA 4YJHA 2HJRA 4WEOA 4FOSA 2JD1A 1HE4A 2VUTA 3C8MA 4I5GA 3U4CA 3VC7A 4ZJUA 2OHXA 4ND5A 2FPIA 5JBIA 2NTVA 3HE3A 1Z73A 2NVWA 4WCFC 2EG9A 1KERA 4YBZA 3RWBA 2JCYA 1X0VA 4W9NA 1SMKA 4RLHA 4I5DA 3RBXA 4I9NA 2TMDA 4HADA 4RO0A 4IJWA 4KUEA 5CEJA 2JD0A 1TVEA 1U4OA 4ZN6A 1HLPA 3M1LA 3BHIA 4OMUA 4CLRB 1PJQA 3V8BA 4AL4A 4XYEA 3MJEA 3GOHA 2PNFA 4PN3A 4PGFA 4KWIA 5L40A 3UAGA 2PFGA 3FNHA 3HFSA 4UULA 1K5HA 4AVYA 4L75A 1X13A 1E7WA 1LNQA 2H9IA 1DEHA 5ILGA 4OXKA 1PIWA 4Z0TA 2XXJA 3JQ9A 3WIDA 1Q1NA 4FC7A 3DQPA 4WOJA 3NUGA 5F3RA 3EYWA 4XDYA 1CWUA 4KDEA 4XQGA 2ZJ0A 3CKYA 5HRUA 1PS9A 4TRRA 4NDNE 4ND2A 4FGWA 3K9QO 1Y6JA 3W8FA 3SLKA 2DPHA 2P5UA 3MTJA 1G6KA 4CM4B 1EK6A 4FFOA 4OSPA 1V3UA 1R16A 3U4DA 4XJSA 3OJFA 1M67A 1H6DA 1I10A 1F12A 1S7CA 1U3VA 1VPDA 1ZH8A 4L8VA 4OJNA 3TFOA 1VRWA 3V2HA 1U7TA 4OO3A 2R00A 1DSSG 1P45A 1K6XA 1RWBA 3IDSA 4BIIA 5CHEA 1B8PA 1V3VA 3R0IA 1EBUA 4QUKA 4TKLA 4E32A 4LMRA 2GN9A 1ISIA 1YS4A 2YV3A 2YHIB 4RVUA 2J6IA 5JDCA 3L4BC 1GV0A 8ADHA 4DA9A 4D41A 3H8VA 1SB8A 1ZVMA 2DBVO 3D5TA 4NK5A 5EN4A 3S55A 2B4TO 3WTBA 5JDIC 1GPJA 1GZ6A 2FZWA 1QV6A 5JC1A 1SOWA 3KLPX 7MDHA 1TI7A 2NU6A 2PA3A 1GDHA 1ONPA 2X4GA 5DOVA 3D4OA 3DZIA 4JJIA 3FR7A 4A73A 3G1TA 1J0XO 2BH9A 4PRLA 1V6AA 1YQXA 1U5CA 2Q49A 3VZQA 1DB3A 4IJKA 3TRIA 2CFCA 2GO1A 2WD7A 3NV9A 4MVJG 3PJEA 3VH4A 5JMWA 1R0KA 2JFFA 2AXQA 2Z95A 4ZVVA 3C7CB 4GKVA 1A4IA 4WE3A 4MIEA 4ZD6A 4DLLA 4E31A 1YONA 4LK3A 1YQDA 2XXBA 2RBEA 3CIFA 3DAFA 1ORRA 3I5MA 4KQXA 4ZRNA 3H5AA 1ONOA 4DLBA 3S2FA 2DTXA 3O9ZA 2QHXA 2VN8A 3RKUA 3OA0A 1JAYA 2H5LA 4PG7A 4CMJA 2X5OA 1OAAA 1TT7A 4GLLA 5JY6A 3VKUA 2D4AA 3WICA 1ULSA 2CF5A 2Q99A 3V1UA 4BGEA 1GUYA 4LVUA 1EDOA 4RF5A 4G2NA 1F14A 3DBRA 4NU5A 3I6QA 4YT4A 1KY4A 4LGVA 4BGVA 3LYLA 4R1SA 1NNUA 3KXDA 3DZJA 2Y0CA 3AUAA 3WYCA 4CM8B 4DYVA 1QLHA 2JCXA 3GVXA 2O4CA 5DF1A 5L4NA 1JKJA 3O8QA 3OEWA 1BGVA 4X54A 4OOEA 3U4HA 5L4LA 3WLFA 3DTYA 4LN1A 1PGPA 5F1KA 3I9NA 3ZNPA 5IZCC 4BNFA 3ZU3A 4HFMA 1FJHA 4R5HA 1KVTA 4UVHA 5TQVA 1I2CA 3D7LA 3IJRA 4A10A 1YGYA 3PIDA 4AJIA 2NACA 3DEYX 1I32A 3AFMA 1LC3A 3EY4A 3L9WA 2NU8A 4CV2A 4FQ8A 3RD5A 3VH1A 1HETA 4BO6A 3JYLA 3QWAA 3JQBA 4XX0A 5T8KC 2VHZA 5DP2A 1ZK4A 1DFGA 3K30A 4YDRA 2IZ0A 1J49A 4CODB 1GD1O 1IE3A 3KVOA 4BV8A 4G65A 1DHRA 3K96A 1UXGA 1K2WA 1JW9B 2YV2A 1B16A 4ND1A 3WGOA 2J8ZA 1QG6A 4IQGA 4CMKA 4YRAA 4BGIA 4PIVA 2VZ8A 1N1EA 1E92A 1X0XA 4BNUA 3KYDB 2X1HA 4AJ4A 4WASA 1U28A 3P7MA 5CP8A 5ILOA 3GNQA 2IYOA 3TJRA 2E4AA 3WMWA 4E4YA 3M2TA 1VJTA 1Z82A 3ZV4A 2IODA 1KETA 2VYNA 1KC3A 1DJNA 2C2YA 3BTSA 5TF4A 4EUEA 3HWRA 3QE3A 1P1HA 1ZO8A 1NTOA 3QWIA 1FF9A 5G0SA 4E5NA 5A1TA 4BKOA 3ONEA 3GGOA 1Y5RA 4JX8A 3ZU5A 2DFVA 4Y67A 3WOHA 1MXFA 2NSDA 2YFHA 3RUAA 3VTFA 3ZH2A 2RAFA 2Z1NA 3JQAA 3O38A 4W7HA 3FBTA 3RC2A 3LLSA 3WSVA 4B3JA 2Y68A 2PZKA 4WNCA 1W73A 3HB5X 2IZ1A 3CE6A 3MZ0A 4HNGA 5MGBA 4TRNA 1H2BA 3AOEA 3R3SA 4J9UE 4CJXA 3LT4A 4DPKA 2EHDA 3PQDA 4U0KA 3BMQA 5TGDA 1GEGA 3RUDA 5CFZA 2OMEA 4NZ9A 3DOCA 4HFRA 3JYOA 3JQBC 1HL3A 5AOVA 4MKRA 2I3AA 2PD6A 4CMIA 5A9TA 4B3HA 2ZTMA 3DFZA 4D0RA 4DC0A 1MFPA 2OBYA 1KEUA 4N5NA 1HZZA 3IKVA 3KLMX 1PGOA 5KJ1A 4XRRA 3DL2A 3G3EA 3NDRA 4NJMA 1FK8A 5T57A 2NU9A 3ZWPA 5COQA 5IZCA 2EJVA 5ITVA 4BNKA 2OBNA 3MJSA 1V9LA 2JHGA 4NR0A 4J6FA 1NAHA 3A1NA 3ZI0A 3H9JA 3TOXA 5G0UA 2E82A 5B37A 4BNWA 4RVFA 3RFTA 2DC1A 1KEWA 4IPTA 2W4QA 1N92A 2XF8A 5CDYA 4D46A 5T64A 3IKTA 2Z1MA 3ZW9A 2GD1O 1R0SA 4TRJA 1EE9A 3WR5A 1NXQA 3DBLB 4BV9A 4IQ0A 5JAZA 4M8SA 3LK7A 3ZNQA 3NDIA 5THQA 4CQLB 5G4LA 1BXZA 2Q1WA 5IN5A 5C37A 5I7FA 1I36A 2ZTUA 1UXHA 4WLEA 4J7UA 4DPMA 1XELA 2XAAA 1K6JA 5F1PA 4J4HA 2VRCD 3KZVA 3QY9A 3B1FA 4ZGWA 5KKCA 2O2YA 4UVEA 4CMGA 1ENYA 4GMFA 3GDOA 4GGPA 1XWFA 1P0CA 1FDUA 1X7DA 2PWZA 4E21A 5FFFA 5G4KB 3FHLA 2C0CA 3G49A 4IM7A 1N9GA 4LW8A 1YB4A 3IUPA 4BNGA 1E1LA 2I66A 1GR0A 3AW9A 2WD8A 1WZEA 4JROA 1NWCA 4GX5A 4B7XA 3DBHB 3OJ0A 1KEVA 1XKQA 2YY7A 5TS3A 2QX7A 4IMPA 1A4UA 3S2IA 1T1SA 1OC2A 4MIOA 3VVCA 1ZIDA 3PQFA 4RDHA 1YB5A 4ZU3A 4OKIA 4EGFA 1JKFA 2Y1EA 5EMHA 5BNIA 3K31A 1O94A 4XR4A 4NI5A 5B12A 3KSUA 2NV6A 2RH8A 1E5LA 3WJAA 2WYVA 4EZBA 3M1AA 5L7WA 2JAHA 2DFDA 3DZHA 1VL6A 5IF3A 4K9DA 1E1MA 1YOVA 1ZEJA 3TPCA 4YT8A 1RJWA 1VKOA 3L9XA 4FFRA 1BXGB 4GMGA 3LT2A 1EQUA 1BDMA 2YZ7A 2ZQZA 1IOLA 2DUUA 3VDQA 4FFPA 1Y7TA 3DHYA 1P77A 1TT5A 2QIOA 3I4FA 1HDYA 3L0DA 4R16A 3W6UA 3CEAA 1HDZA 3E9NA 3JQGB 5DN9A 3H5RA 2X8LA 3GN2A 5KIAA 1NAIA 1EDZA 1TLTA 2D1YA 1A7AA 3P2OA 4Y8VA 5EERA 3U3XA 4K6FA 1RKXA 3ONDA 4E5MA 3ZWVA 5BSFA 1PQPA 1N1GA 4DIFA 4UVDA 3QQPA 5I7SA 4YJGA 1E3JA 2PH5A 1TEHA 2FZEA 3WTCA 3RBZA 4MKXA 1EEHA 3MJTA 3A9WA 4EEZA 1JA9A 2SCUA 4D3DA 1HKUA 1SAYA 5BT9A 4IXTA 5L53A 2W2KB 4DQXA 5ICSA 4PLPA 4GPD1 5EL0A 2ZKLA 1LSJA 1UXJA 3NJ4A 4RF4A 5DBFA 3OF2A 1O95A 3AI2A 3PXXA 5HS6A 2CSUA 2E37A 1VSVA 4J49A 4XCVA 5CG2A 1Q7GA 1T25A 2RHCA 3HJAA 3LQFA 5B4UA 3UFXA 4DC1A 2VRBA 3QJ5A 4YB8A 5FYDA 1A5ZA 3GUCA 4ALKA 1ISFA 3HDQA 3E5MA 3IMFA 2OGUA 1LRJA 3NEPX 3AI3A 1PJ3A 3ZDFA 1PQUA 4CLEA 3ZNNA 4CV3A 3AFNA 1B3RA 4WNIA 5L3ZA 2PKQP 3ETEA 4IS2A 4XKJA 2UYYA 5U9CA 1PZHA 4O59O 2ZB4A 3NYWA 2AA3A 5DCUA 4ZA2A 3TZCA 2QRLA 3WYBA 2VUUA 2BF7A 4QSMA 2QRJA 4FPXA 4L4RA 1IUKA 1GYRA 4NMHA 1GL3A 3A28A 1VI2A 2VZ9A 3L07A 4KDFA 3GF4A 3EZLA 3QVSA 2EKQA 1V3TA 1EBFA 1P9LA 3TQHA 4NPCA 2Y1OA 4GAEA 1GV1A 4ALIA 3D4PA 1LEHA 3H2SA 4HWKA 3BMNA 3Q9NA 3SLGA 1LDBA 1PL8A 2G5CA 2Q4EA 4JBIA 4CV0A 4NBTA 1OC4A 3KBOA 2DBQA 3GRKA 3AM4A 2JKVA 4PFJA 3WGYA 3ZU4A 4RF2A 4EI2A 3ZWXA 4AJHA 3RC1A 1G0NA 3OHSX 2HRBA 3Q11A 3QVWA 4A2CA 1G0OA 1DRUA 4JIGA 2JL1A 3U49A 4CUZA 4FW8A 2HMVA 1R4NA 4DQUA 1PL6A 2CZCA 5KNLA 3PLNA 4ID9A 3PYXA 1L7DA 3DFUA 3JQ9C 5C7IO 4AG3A 3I3OA 4XQEA 2GUGA 2RCYA 2A94A 1C1XB 5JCJD 4L9RA 1I0ZA 2Q2VA 4UEJA 4MVJM 4E5PA 3FNEA 3GEDA 5A06A 2OFPA 1ZNQO 3R6DA 2XOXA 1DHTA 1UDAA 4OXNA 4TZKA 3LSYA 4YR9A 1QYXA 1PL7A 1NHWA 3RUHA 4LSMA 4BNNA 4ALLA 1YL5A 4A5OA 5B1YA 1U8XX 4CR6A 3GG9A 2DM6A 3BHJA 1ZCJA 1CRWG 2QW8A 3NDJA 1NP3A 1T2CA 3O26A 1R15A 3PJFA 3QWFA 3DMYA 4Z3KA 3VPHA 3FRJA 3GVPA 5AYVA 3GZ4A 1PWXA 5DDIP 3MJVA 4R54A 3ITKA 4M86A 5L4SA 3PHJA 1E3IA 1W4ZA 4JQCA 2NTNA 4MKZA 4IUYA 5GZ6A 1HE2A 2Q46A 3RKRA 2WEKA 2QZ9A 4B4WA 1O0SA 3OJEA 3GA0A 3MOIA 5JAIA 3DB2A 3JQ8B 4YAIA 3AUSA 4XQ9A 1DC3A 2O23A 3CXRA 1LDYA 3DWFA 3SJ7A 2BFMA 2VT3A 1T4DA 2Q2QA 5GMOA 2VNAA 5F21A 3GR6A 1WLYA 3HZZA 3HG7A 4GWGA 4FSHA 3JD2A 3W8DA 2V7PA 1Z7EA 5G4KA 4GH5A 1RYEA 4J1TA 2ZB7A 1KIFA 5IZ4A 3VPFA 3PYLA 4K28A 1U9JA 4RLSA 5TNXA 1HYHA 3UW3A 2DU8A 1EVJA 1DIRA 2AG5A 3UXYA 4BGUA 4GKBA 3MJCA 1HDXA 4E3ZA 3ZWAA 4XYMA 3VH2A 4IZIA 4QO8A 3JQFC 4HFNA 3PLRA 1PJLA 2HK9A 3HHPA 3NTQA 1UP6A 3EVNA 4ESOA 3VHRA 2DVMA 4E2WA 4LCEA 3TL2A 4M55A 3JQAD 1K89A 4Q3DA 4EJ6A 4PG8A 4UUPA 3QWBA 4B8WA 3DXFA 4DBVO 2FPPA 4P38A 4BKPA 5A05A 1MXHA 3ZV5A 2B5WA 4RPGA 4YPOA 5JLAA 4ILKA 3C24A 3FWZA 4BS9A 3C1TA 4ZQFA 1F0YA 1DIAA 3C1AA 4BNJA 3HUDA 4D42A 5I7EA 3GLQA 2EP5A 4NG5A 2NUAA 2WJPA 2F00A 4NIMA 1NX6A 4WCDA 3G0OA 4D3SA 1YJ8A 2FSVA 4BNXA 4B79A 3EC7A 1JTVA 2HMUA 4HNHA 2CNBA 1L7EA 3FNGA 2VYVA 1IHXA 3TNLA 1I8TA 1PJBA 5CDTA 5A9SB 5COAA 1GTMA 1ZSVA 5A5EA 5IXYA 3C7DB 4Z0HO 3RQSA 1O6ZA 2DAPA 1NPYA 3BMQB 3ST7A 4GWKA 1GAEO 2BI8A 2Z5LA 4XEHA 2W2LD 1XA0A 5ADHA 3NJ8A 4Q3EA 3PVZA 5CG1A 1HTBA 1TA4A 3U5TA 1U5AA 1KOLA 3CMCO 1ZJYA 3WQSB 3PDJA 5AQ1A 3DHEA 3H9UA 8LDHA 2B4RO 1NPDA 1E77A 4DWVA 1E0DA 1A9YA 4MDHA 5HA5A 1YRLA 1T2FA 1P1KA 4CMEC 2GN4A 3AOGA 2ZCUA 2AEFA 1I3NA 1ULUA 3ROQA 4I9HA 3OIGA 4AJNA 4F45A 3GVIA 1BTOA 3T4EA 3R3JA 2DTEA 2D8AA 4IDFA 3GZNB 4AJEA 1AXGA 3GGGA 1CJCA 1N9GB 1GUZA 4FFNA 4WOKA 1ZKMA 1EE2A 3TZKA 2ZTLA 5BNFA 4BNTA 2PD4A 3HFGA 3BMOB 5DP1A 2J3KA 2WMDA 5A3VA 2X9VA 2NVUB 2GPTA 4RJTA 1GEEA 2WSBA 4PLZA 3CUKA 1I01A 1SEVA 3INGA 4J1QA 4MIYA 4IS3A 3BMNB 1I24A 1HF3A 4W82A 2ZK7A 4Y9DA 4BO4A 2BGLA 3PIIA 3GRPA 3HDJA 4J0EA 1AHHA 4CM3A 4YCAA 5K6AC 1X15A 4DMMA 4QX6A 5EPOA 1R37A 2HQ1A 4M1QA 1Z45A 2G0TA 1U7HA 2HDHA 5H83A 2C82A 4HKTA 1LRLA 3NT4A 1E7MA 2HCTA 3D1LA 4F6CA 3VKVA 2ZATA 2B0JA 3JQFA 1LDNA 3KEQA 4Y98A 5JY1A 3WNVA 4GGOA 4QFDA 4BNHA 1LDGA 3QHAA 3WWZA 5JXWA 4BUCA 1K3TA 3PK0A 1QXSA 4OAQA 4PVCA 1D4FA 4Q39A 3WGTA 3OQ6A 3PJGA 5EINA 1VJ0A 4S3MA 2NQTA 3CMMA 3FI9A 3H9QA 3F1KA 1H93A 5JAQA 1LLUA 2UAGA 1YOVB 3LT0A 3NTRA 3L77A 4EJ0A 4GI2A 4LISA 2PY6A 1DIBA 1GUFA 5BSHA 2BMAA 3WWYA 2VNSA 3D5QA 4JJFA 1XDWA 4R69A 4DXHA 3WG9A 5L51A 2HMWA 4RV9A 5LDHA 2P4HX 4BO0A 3QIVA 5JMPA 2VOEA 1LQUA 3UH1A 3AK4A 1QP8A 1PGNA 2HUNA 1C1DB 4TZTA 2Y1CA 2QQ5A 4M54A 3WQQA 1OFGA 3F47A 1XYGA 2P68A 2Y1GA 1E3WA 5DCWA 3GPIA 4I8XA 5CEEA 3ZU2A 5AXBA 1LSUA 9LDBA 3B20A 3Q2IA 4H7PA 4LCJA 4FD3A 5T6BA 2C2XA 2CDBA 1PX0A 2P9GA 1AGNA 3G1UA 2D5AA 3D3WA 4YVFA 5JCXA 1P33A 1I5RA 4PZEA 1IYZA 1XU7A 3KSDO 1HEUA 4MVJI 3NTOA 4JJGA 3RUEA 3K5PA 4ZQHA 4YTEA 2Q50A 3F4BA 1UXKA 1VE9A 1VJ1A 1SEPA 1UAGA 1ISGA 3WYEA 4OYRA 3O03A 1A9ZA 4L4SA 4XYGA 1YXMA 4QEDA 5KJEA 3DONA 1NQOA 4E2XA 2Q2WA 1I3KA 4RPLA 1YVEI 2HO5A 4YJFA 1XQ1A 4QTZA 4IIVA 1PS0A 1BSVA 1H2HA 1NHGA 2D2IA 2JFHA 3HADA 3L6EA 1IL0A 4EUFA 1ZXBA 4YT2A 1I2BA 3E03A 1U8FO 3E5RA 3JYQA 4E5YA 4I5EA 1P1RA 1Y8RB 2AG8A 4JLWA 2VHVA 5HTOA 3WGGA 3F3SA 4QT0A 1ZSYA 2OP0A 2BFAA 3PJDA 1M66A 1ZZEA 1E5QA 3LVFO 5ER9A 4XD2A 5L95A 1DDOA 3N7UA 1M6WA 1JKIA 5HBRA 4WLOA 3H4VA 3AUTA 4KP7A 4M89A 4W4TA 2IRWA 2DKNA 2I76A 2D5CA 3H65A 2VTDA 1V35A 4J4TA 3BTUA 3CH6A 3IP3A 3PZRA 5FWNA 1I3LA 1Y81A 4RVHA 2A9FA 3VDRA 1C1XA 1OZAA 3C3XA 2O2SA 3U62A 3T7CA 5GZ1A 1MFZA 3ZWWA 5ES3A 1Z6ZA 2IEDA 1B14A 4C7KA 2NVBA 5HS4A 1HZJA 1UDCA 1KVQA 4RPJA 4ALNA 2Y1FA 3ETGA 4XRGA 4NJOA 5A9SA 2J5QA 3F5SA 3MEQA 3PDUA 1RM5A 4R3NA 1AUPA 2OOSA 1H9AA 3IQDB 1QLJA 1NFRA 2P91A 5H81A 3VPGA 3ANMA 1ZUD1 1N5DA 2O48X 5TC4A 4JXKA 4BQRA 5K6AA 1HWYA 2YDXA 4Q3CA 3DBHA 3PPIA 3VPSA 3PWKA 3V5NA 1H6BA 3GN1A 1A71A 3D3EA 1LLDA 4WUVA 4ALJA 4Z0PA 1MC5A 1E6UA 2ZYDA 4ZQGA 1LU9A 2ZIZA 2P9EA 2X5KO 1IZ9A 4R5MA 4J16A 1N8KA 3JQ7A 5B4VA 1DO8A 2GLXA 1L1FA 2GNAA 3EMKA 2HMSA 3NGXA 3E1KA 2IE0A 3GVHA 2X7HA 1RM0A 4XIYA 3ULKA 5U4QA 4XWYA 3E82A 2DLDA 2EF1A 1DAOA 1BWSA 2D3TA 1I33A 5L7YA 2Q3EA 4R4JA 4OGWA 4A0SA 1HT0A 3E48A 4BNLA 4F46A 3JD1A 5C5IA 3ANLA 3R1IA 3H5NA 2FPGA 4CQMD 3TZQA 2CMDA 1ZSNA 3X2EA 2G1UA 2X0IA 3U0BA 2HK7A 4IDGA 4S1VA 4DPLA 5CPFA 4XDZA 2YDYA 4CUJA 3FD8A 1OI7A 1PTJA 1U3TA 2HKIA 4CM9A 2EW8A 4CM9D 4DBZA 5BSGA 2ZTVA 5EQDA 1QSGA 2AHRA 3Q1LA 1JVBA 3VZRA 3KETA 3Q6IA 2VQ3A 1IZ0A 1J4AA 4YQZA 3BA1A 3VZPA 1QYWA 3IP1A 3O8QB 4FBGA 3S8MA 1B3BA 3JD0A 1XR3A 2HJSA 3MWDB 1VL0A 2BHLA 5ER6A 1RPNA 4TSKA 4IINA 3MTGA 1XEAA 4PRKA 1U2DA 4DQVA 1QKIA 1SBYA 1NVGA 1Z74A 3OFSA 3OECA 4J2OA 3W4IA 3GC6A 4AJPA 3RC7A 2GSDA 1WMBA 3EAGA 1U3WA 3ETDA 3PEFA 1C1DA 1XG5A 2OORA 3DMTC 4XA8A 1ZK3A 2GZ2A 2YQ4A 5IFLA 3QRWA 4IDAA 5TSDA 5HWSA 1QYDA 2GCGA 3BYZA 4BHTA 5IDWA 4Z9YA 2XPCA 1ENZA 4WK6A 3RROA 4L0QA 1HYEA 3F4LA 2C5EA 3GFBA 1D1TA 1XGKA 1LSSA 4MOWA 2EW2A 1O5IA 1KY5A 4WLUA 4RORA 3DZGA 1MB4A 2HU2A 4PVDA 3SC6A 3C7AA 1YB1A 3DTTA 3KOUA 4YAKA 2UV8A 4WEQA 1T26A 1M76A 4UREA 1E3LA 4Z9FA 4CV1A 3FBGA 3F1LA 1LLCA 1BW9A 1WNTA 4OIMA 3L6DA 1EFKA 6ADHA 4NK4A 1YH3A 2O7SA 4YQYA 4HX5A 1MGOA 1EZ4A 1U4SA 4P4LA 3H3FA 3GK3A 2C59A 1MX3A 2ZYGA 1QYCA 2IEBA 3NT2A 3I9JA 4AJ2A 3F6YA 2X86A 3IOYA 4DIBA 1UDBA 3GEMA 2B4QA 4ZHSA 1Q7CA 1P31A 3BAZA 3SEFA 3U4IA 1DJQA 3IJPA 5DNAA 1EMDA 2C7VA 1IY8A 3NAQA 1QORA 5KJCA 3W1VA 2FHSA 4CLXA 1NM5A 3WGQA 4O0LA 1MA0A 4CMEA 4I1IA 3SC4A 3ZWOA 5BSEA 5C7OO 2C20A 1HSOA 2P2SA 4UAGA 2CVZA 4IDCA 3LF1A 4YJDA 4R51A 4CL8A 1BVUA 5A9RA 3I1JA 2AQIA 2PZMA 5DZSA 5IXSA 3AY6A 2WD7B 3AWDA 1NYTA 3MJ4A 5T67A 4E2ZA 3ZHBA 4IJUA 5JC8A 2R00C 4W6ZA 3I23A 4KOAA 1MG0A 1O9BA 1Z7BA 1LA2A 2X0NA 3GAZA 4IMRA 1R6DA 4GX2A 4K1LA 4UVIA 4B7UA 5IJZA 1UZNA 1EFLA 1WDKA 5I8ZA 3QVXA 5COBA 3GGPA 2B35A 3RC9A 2DUWA 2OL4A 1RM4A 1S6YA 3RASA 3QVOA 1EVZA 2CDAA 2C5AA 4YACA 3PI7A 3TN7A 4XYBA 1IULA 2PLAA 2RH4A 5IDXA 4WLNA 2VT2A 3KRTA 1ADFA 4BO5A 3IC5A 2HRZA 1C0PA 3ASVA 4J1NA 5B4TA 2Y67A 2I3GA 2HK8A 3JQDA 3KUXA 1MUUA 2D59A 5EJ2A 4RPKA 5DOZA 3LC1O 3CINA 4UUMA 4K26A 2PGJA 2AE1A 1HDOA 1XIVA 4AICA 2E48A 2PKQO 2VWHA 1HDCA 2VWQA 2CY0A 4GSKA 3KB6A 1ZK2A 3WQRA 4R1NA 1DAPA 2GN6A 3CZMA 4J9VA 2EGGA 4U6QA 3WGZA 1GQQA 1ZW1A 4J7XA 9LDTA 2QYTA 1X1TA 2J3JA 4AJOA 3I9LA 2CDCA 4BO2A 1ZEMA 4D3FA 4FCCA 1WDMA 2YYYA 4KTTE 2FOIA 4BNIA 3GAFA 2I9PA 4N18A 5T8KA 4DL9A 2NTJA 5C7LO 3K2EA 4W9NC 4XYLA 3B1JA 3JD3A 2JFGA 2J5RA 4E2YA 1B15A 2AE2A 2CF6A 4PCVA 4YAJA 1GZ4A 3CTMA 4J7CA 3S1LA 4L76A 1A7KA 1MV8A 4DIOA 1E1KA 1D1SA 1AXEA 3OQBA 3WB9A 4BO7A 1NQAO 1E7QA 2HAEA 1VSUA 2B36A 3H9EO 1GU7A 1K0UA 2I99A 3OQ1A 4TMFA 2X9GA 4BMVA 2EGHA 7ADHA 3ORFA 3GY0A 1WAMA 2ZYAA 1Y1PA 2YUTA 3PWZA 2UUOA 2FP4A 4WPGA 4Q3BA 4MP3A 3WBFA 1J6UA 4UVGA 3RFXA 1DOHA 3WXBA 3PP8A 2AQHA 1E3SA 1MP0A 3GPDG 3VTZA 4J91A 2R2GA 4YJFB 4O63O 4BNZA 5DT9A 1BRMA 2DTDA 4PG4A 5AVOA 3TZHA 4XJTA 3NRCA 1RYDA 3T7EA 1A27A 5CAEA 1V8BA 3PTZA 2NU7A 4PLTA 1M2WA 1IHYA 2X9NA 2HMTA 3P2YA 4TVOA 3TFQA 1R4MB 2O3UA 3LC7O 3HDHA 4YT5A 2BD0A 2FWMX 3UOGA 1H9BA 2O7QA 1VL8A 1NPTO 3UKOA 4G5HA 4M87A 3GHHA 4KWHA 1UAYA 4NQZA 1H6CA 1X14A 1DIHA 3PQEA 1WVGA 3RU9A 3HN2A 3Q9UA 4MP6A 4R1TA 1MC4A 2E49A 3JQGA 3KYBA 4R01A 1JAXA 4UEOA 4PLYA 4IDDA 5KVVA 1BW9B 1LXCA 2VWGA 4JGBA 4DREA 1Z75A 4H15A 3NKLA 2YQ5A 3QP9A 5JAMA 1LDMA 4RPHA 1Y8RA 4D7AA 1XLTA 4H3VA 3VH3A 1DPGA 2QZZA 4RVDA 4BB5A 1RM3A 2PTGA 3RJ9A 4E6PA 4AJLA 4YJGB 5KJFA 1R66A 3L4BA 3OJOA 2VOJA 1F06A 1GZ3A 4WLFA 4IDBA 1EVYA 3EK2A 4JBHA 3RAJA 2C29D 4N5MA 4CMAA 2VCYA 2WWRA 1NR7A 1HLDA 4R9RA 4RGBA 4CUKA 2UUPA 5JDCC 4QO7A 4CR7A 4BO3A 4CMIB 4HUJA 4N5LA 1LI4A 4E33A 5L45A 4CM7A 1EUDA 1F8GA 1JDJA 3AY7A 3U09A 4O5OA 5GZ3A 3QSGA 3I52A 5A03A 4XB1A 5TT0A 4CLOB 2CVQA 3UHAA 4CM8A 3E18A 1SCUA 2YW9A 5HM8A 3KO8A 2IZZA 1YL7A 5IAAA 3OSUA 2FRDA 2H1SA 3HSKA 4MVJF 1JQBA 1PJCA 4BO8A 2CD9A 1B0AA 2O4UX 3OEYA 2V6GA 3WSWA 5JO9A 3ASUA 3D64A 5A02A 2G17A 1KS9A 1C0IA 2FMUA 1LRKA 1Y9AA 2X5JO 1LC0A 1ID1A 3F9IA 1JN0A 1HDGO 2NWQA 5I9LA 1Y8QB 2BLLA 2BFPA 2UDPA 3ITDA 3PGXA 1C14A 2EXXA 1ADBA 3BZUA 4RF3A 2IXAA 5ICMA 1YDWA 2VYVD 4BNMA 1WWKA 3ZWMA 4PLGA 3LC2O 1DRWA 1YBMA 1EUZA 3DDNA 4KMSA 2Y66A 1CYDA 4IQ8A 2Y05A 4FJ1A 3K8ZA 2LDXA 4FFMA 1KVRA 4XGNA 3PHLA 3AU8A 1JU9A 1PQWA 4FS3A 3VZSA 1PGQA 3DZFA 4FFLA 4DMLA 1AHIA 5IG2A 2V6FA 4DVJA 1MG5A 1UH5A 3OP4A 3A4VA 3ROMA 5EESA 1DC5A 3ONFA 3I9MA 2AEMA 1P3DA 2PH3A 4EJMA 4TWRA 4UUNA 1JWAB 4YRBA 4WCFA 5DBIA 2GR9A 3JYPA 3K73O 4IIUA 3V2UA 4EDFA 4BKRA 4QQRA 3AM5A 2WE8A 4BO9A 1IPFA 1WPQA 1PZFA 4CM5A 3WFIA 3ROPA 4J2HA 2Q1TA 3NT5A 1DLJA 4PG5A 3UCEA 1ZK1A 3WGIA 1YDEA 1LTHR 4CMCA 2WYUA 4XIJA 3W4KA 1SO8A 4CM6A 3GDFA 5KVCA 4KUGA 4XQCA 1LQTA 5G0WA 1C0KA 3SX2A 5IDQA 3PRJA 2VWPA 3K2BA 1B8UA 4Q3AA 3ZV3A 3SVTA 4BKUA 3FF4A 1GCUA 3AJRA 1PJ4A 3UN1A 3ENNA 1GQYA 4LVCA 1P74A 5LDGA 1BXGA 3EGOA 4TRMA 2VZ0A 5F5NA 3HNPA 4HXYA 4BO1A 2PK3A 5FF9A 1DC4A 4HFJA 2NADA 3EHEA 4OQZA 4J4BA 3JQCA 4XGKA 3PWSA 1UUFA 5TT1A 2GZ1A 1DFIA 3ZHYA 4YEDA 2WM3A 3LLVA 3RVDA 4U5QA 5ITWA 3KM0A 3PHHA 4EITA 2Y1DA 3BTOA 5EIOA 1EVIA 1WDLA 5MDHA 4FN4A 1PJTA 3KSZO 2VRCA 1E7YA 1HDRA 4KTVE 4PLFA 5BR7A 4Z6KA 4LRTB 1NVTA 5JFOA 3WFJA 1WXDA 4Z9XA 4RZHA 3PFWO 2JJYA 2AQKA 3MCVA 3FTPA 1T2AA 1ISMA 1PZGA 2EKLA 4RDIA 2BELA 2GN8A 3H3JA 4RVGA 4J3FA 3SBOA 5JW6A 2O3TA 4W99A 3OBBA 4IY1A 4M49A 3ICPA 2BRUA 5I9MA 1ADGA 3OMLA 3BHMA 2BI7A 2CUKA 2X6TA 3RJ5A 4XGIA 2ZB8A 4PZCA 4MVJE 3FCOA 2JCVA 4MVJH 1V0JA 1A72A 1ZXLA 2GGSA 5L9AA 4CQLA 5FI3A 4NBUA 1E6WA 3IIEA 4NJMB 1DFHA 5KJ6A 1GYPA 3HB4X 3DR3A 4J1SA 4TROA 3UVEA 4INAA 4AJ1A 1PR9A 4TQGA 2V6BA 3RFVA 2B5VA 3UCFA 1ZK0A 3L4SO 5BQFA 2PZLA 4IGFA 1OBFO 1PJSA 2WE7A 1BMDA 3GT0A 2ILTA 4HV4A 2DQ4A 1ZMOA 1H5QA 3M6IA 1LX6A 1B2LA 1R4MA 2EEZA 1X7GA 3JYNA 3WDSA 3V1YA 5CDSA 2DBRA 2FY8A 1HYGA 2GRAA 5F1OA 4NFHA 3I9OA 4CLHA 3N74A 3D0OA 4GBJA 4ZQBA 4A03A 4II3A 4B3IA 4KUHA 4R9SA 3HN7A 3UUWA 1YBAA 1E1NA 4BMNA 3IS3A 2OXIA 2QG4A 4CM4A 1KEPA 5TRTA 3PGJA 1CF2O 1YO6A 2AQ8A 4OM8A 5ENVA 2I6TA 5LC1A 3I9KA 4UUOA 1VM6A 2PD3A 2AMFA 1Q7BA 4P8RA 4MO2A 1ML3A 4CMBA 1ENPA 3RIHA 3GMSA 4FB5A 2P9CA 3ANNA 3ZW8A 3WGHA 1LLQA 5GY7A 5JCJA 4KZPA 1PS8A 1VLLA 4LRSB 5KKAA 3ZWNA 1DIGA 4C7JA 4O6VA 3ZNOA 1R4NB 3WLEA 1D8AA 5KWEA 5BNTA 4NFYA 4E12A 3A06A 3WNQA 1I30A 1PU2A 3BMCA 3DZBA 3HDYA 3ROKA 1YBVA 3IL2A 1P1IA 2C54A 4BNYA 1T24A 1B7GO 1NQTA 2I67A 3P5SA 3QW2A 3DHNA 1P0FA 1T2EA 1X7HA 4CLOA 3E6AA 3W6ZA 2QYSA 3G79A 3Q0EA 3JTMA 2NVUA 1HSZA 3KYCA 4ZICA 4F6LA 4TKMA 1XCBA 4CR8A 1BDBA 1GCOA 3DAPA 3JQ8A 4RQTA 5G0TA 4OL9A 1M6HA 4L74A 4QECA 1TB4A 1ISJA 3KHUA 5J23A 1CETA 1K6IA 1QR6A 3I6IA 4DGSA 4PLHA 3GMDA 3INRA 3RSHA 4II2A 2Y99A 2PKRA 2Q45A 2CVOA 4ROSA 4OKNA 1KC1A 2C7GA 3TSCA 4HBGA 2Y93A 2DT5A 4BQPA 1FDTA 4MP8A 1TT5B 4IGEA 4B4UA 1WMAA 5JE8A 4DTIA 1O8CA 4R1UA 1N2SA 4P22A 3F46A 3OIFA 3EUWA 4I9UA 2OZPA 4E5KA 2P5YA 2I65A 2W98A 4ND3A 5CDGA 3DMTA 5H82A 1LDEA 1U2GA 1XU9A 3ON5A 4OXYA 1T1RA 3CZRA 1JLLA 2ZCVA 1UJMA 1D7OA 3LF2A 1LBEA 2HSDA 4WGGA 3PHIA 4E0BA 4OH1A 4YJHB 4CQMB 1J5PA 2A35A 1CQIA 2BGMA 1Y9EA 5I9NA 3DBVO 4J90A 2W2KA 3MWEB 4WCFB 5ENDA 1OOEA 3JV7A 3QLJA 2O3JA 4U8GA 4D43A 5JS6A 3EVTA 4A27A 3B70A 3PYMA 3VVBA 2EERA 1ISHA 3K92A 1PGJA 4MVJA 4PLCA 4XB2A 1R12A 4NNJA 4DYDA 1W0CA 2YHUA 3RUFA 4EYEA 2R6JA 1NFQA 2G82A 3UICA 2POQX 1E6EA 1UXIA 4B4VA 4BOYA 4YXFA 4AJKA 1YL6A 3ZWBA 4AJJA 4RZIA 2B83A 3TL3A 1H94A 5JYEA 3OM9A 1T2DA 2ZJ1A 1FMCA 3QVTA 5TJHA 2VYND 3VOSA 2TMGA 2IYPA 1FDVA 1ZJZA 3BTVA 3RUIA 4MPDA 2GDZA 3E9QA 1B26A 4IBOA 3OA2A 4JN6B 1C0LA 3DOJA 1XSEA 3KV3O 4MJLA 3F5QA 1ENOA 2VTEA 3TWOA 2PZJA 3RBVA 4BMSA 2NNLD 1F17A 1W8DA 3IAHA 4GX1A 1SB9A 2FR8A 2VUSA 4FIZA 3Q3CA 1WZIA 1NQ5A 4P4NA 3Q2KA 4R3WA 3NX4A 2FR1A 3QA9A 1KBZA 2WTBA 4Y6SA 3H7AA 3WBBA 1ZMTA 1E3WB 3KEOA 5I8WA 3DOOA 4URFA 2X0RA 3H6KA 3LT1A 3FSRA 3IUSA 3S2GA 1R0LA 3GUYA 3X2FA 1FDSA 2YFQA 2EWMA 3T4XA 4RVSA 2AW5A 3ENKA 2NM0A 1MLDA 5JNLA 2F1KA 2J3HA 4QXMA 5JDIA 1LSOA 3TOZA 2EP7A 3OIDA 4OSOA 2W8ZA 3FPLA 3LDHA 1PZEA 2WDZA 2UVDA 4JCOA 5JPIA 1PWZA 4HP8A 1P1JA 1WP4A 1NR1A 4W7IA 3INTA 1HXHA 4LSWA 3D4NA 2LDBA 4ONEA 4LMPA 2J3IA 4MVJP 1JWBB 1PSDA 3OICA 3C85A 3GFGA 2V65A 1NWHA 5F5LA 4ITUA 1W6UA 3JCZA 5JSFA 1CQJA 3ZWCA 2RIRA 2JD2A 3ZWYA 3TZ6A 5KVSA 2GZ3A 2V6MA 3AM3A 3DZKA 4DLAA 2BGKA 4JNKA 4J0FA 4WECA 4R68A 2PGDA 1Q0QA 3PZBA 2RHRA 3WIEA 1XQ6A 4KQWA 2O3QA 3GDGA 3JSAA 3RCBA 3TDKA 4FOOA 4NBWA 2EKPA 3ICCA 2OO5A 1Y8QA 3B6ZA 4ALMA 4IZHA 3DAGA 2OUIA 4JBGA 1XHLA 1NASA 5AXCA 3GHYA 1IPEA 4EW6A 1NFFA 3GVCA 3FWNA 4FC6A 4RL6A 5U1PA 4CL3A 5IN4A 3STHA 5L7TA 3DBLA 1B8VA 3L6OO 1D3AA 4FGSA 5KOIA 2D0IA 1NBOA 4E30A 1YE3A 4DRYA 3V2GA 5AXAA 4YYZA 4PG6A 1HRDA 3AI1A 3KYCB 4BB6A 1KVUA 2W90A 4JK3A 4IDEA 1P44A 5CPBA 4Y6PA 1T4BA 4UEKA 4WKGA 4JP2A 2VHXA 1X1EA 4WJZA 2W2LA 1CERA 2FSSA 2JHFA 4H16A 4YAGA 2H63A 3AU9A 4L73A 4NBRA 5IDYA 1Q2XA 1SNYA 5DULA 3UGKA 2NLOA 3TF5A 3BMCB 5C3MA 3ZCXA 1YJQA 4A7PA 2FR0A 5TIIA 3C1OA 1YKFA 1TXGA 3FTNA 2X0JA 3ZZNA 3WS7A 2PGLA 4D0SA 2PR2A 3JQ7B 4F3YA 5KVQA 2BFOA 4OOFA 4D45A 5G2OA 3BXXA 3GNTA 2DPGA 3ABIA 3H9GA 5THKA 3FN4A 4R41A 2BKAA 4BL5A 1JVSA 3ADPA 3P19A 4B8ZA 3D3WB 1GYQA 4IJVA 1YWGO 5DCYA 1QYVA 2Y0EA 3MOGA 5T5QA 2WYWA 3ZV6A 3UCXA 1CIVA 2B37A 4NHEA 1I3MA 4CMHA 5A3JA 4CLRA 1BHSA 1UZMA 4GVLA 1E7SA 4CLDA 1QMGA 1BVRA 4GL4A 3WJ7A 3ZN2A 6LDHA 1DLIA 2X58A 1GADO 4EEXA 5G0VA 2Y0DA 1N7HA 1P1FA 3JQ6A 4C4OA 1ADCA 3I4CA 5CDUA 3G17A 4WLVA 3AOEC 4GVXA 3CSDA 4PLVA 3VAZA 3GEGA 4RCVA 2O50A 1BG6A 5K9ZA 2OP1A 4Z3DA 1QRRA 5A04A 2A92A 5JYDA 5CEFA 3JQAB 5JO0A 4NH4A 2IDZA 2X22A 5KCZA 2PV7A 4BKQA 3ZGYA 3KYDA 4AFNA 2AEJA 3VPXA 1ZBQA 4I5FA 4E13A 1F8FA 3K6JA 3GZNA 4BNVA 2O3RA 3A14A 1YQGA 1ZFNA 4IXWA 4XZ3A 1EQ2A 2ET6A 2HLPA 3ADOA 1HE5A 3M2PA 3O4RA 3GQVA 4Q3NA 4YWJA 1H0KA 4NU6A 4Q9NA 1ARZA 3BMOA 5A4DA 4ZRMA 3E9MA 4J43A 4QFCA 3OH8A 3RUCA 1Q0LA 2A4KA 5LCXA 4EBFA 1SZJG 4PLWA 5K0ZA 3COSA 5TLSA 1UZLA 3GG2A 5DBGA 2GF2A 2GYYA 2P4QA 3BIOA 2G76A 2YHIA 4FJ0A 1IB6A 1U1IA 3LU1A 1UP7A 2I5PO 4EUHA 2EJWA 3OJLA 3OETA 4GX0A 1BXKA 1GFSA 4OHUA 4ZQEA 4JP3A 2B69A 1C3VA 1H6AA 5EQFA 1KVSA 3KTDA 4N54A 4K6CA 3ZHXA 3H2ZA 4L4XA 4NBVA 1GPDG
chains in the Genus database with same CATH superfamily
1AUQA 4KGVA 3FPCA 4OQYA 4YRDA 4IR7A 5FX2A 3EZYA 3LZ6A 5EP2A 3W8EA 4O3MA 4REMA 3IV9A 2VDUE 1FXSA 2OV8A 2WOOA 3GLVA 3IH5A 4MINA 4RMJA 3SM3A 5KYUB 2BMVA 5K3CA 2R4QA 4D8UA 5K7SA 2KYRA 3Q5EA 4B4OA 3QWHA 1YZ3A 2Q1SA 1VKNA 4A8HA 4RHCA 1FU8A 2ZAIA 1NY6A 3E81A 4CT4B 1BYIA 3W4JA 1TM3E 3QV1A 3GNSA 1QP4A 4OBWA 4N7RA 4TVBA 1DBVO 1TVMA 3EVAA 4U9IS 2QN8A 4AP5A 1CYEA 3IA7A 3G5UA 4KJZA 4WY5A 3HVJA 1JNXX 4ZJYA 1W25A 3LMKA 1EJBA 3OTHA 3VMFA 1YS2X 3GWZA 3BORA 3BXHA 1AQ6A 1RQ7A 4BZQA 5B3LA 4D79A 2CLDX 3THXA 2ZJ8A 1P80A 5CIYA 1ZH6A 1PD1A 2C07A 4IJ5A 5IW8A 2IUSA 1HE3A 2GASA 2G9QA 5EYPA 4U9HS 4NNOA 2PWPA 1WD7A 3N8DA 1RAIA 2P67A 2YTZA 3OZ7A 3KTAB 3EDMA 5E8JA 1FVXA 2A9KA 4CU2A 2AKYA 4YAOA 1SM4A 2BCEA 3JQEA 3CXUA 1C2YA 2GF0A 4B87A 3B1KA 1NVMB 1K06A 5CYOA 1E8DA 2YXNA 2DFKB 3DW3X 3H87A 1KO4A 2ZOSA 4OLJA 3LCCA 5TQ2A 4J29A 2JGDA 1RCTE 4KWTA 5DTEA 3PHGA 3S29A 1UDWA 4HAYA 1L5WA 3G9UA 2PZGA 3NXKA 3I53A 3T7KA 4I3HA 4LOKA 5IS2A 4YUZA 1ZH4A 1E3EA 1U3UA 1XK6A 4ODIA 4FYYA 1XQVA 1L5LA 1O77A 1CQIB 5LQAA 5BSVA 4KRYA 2VA8A 3SXPA 3A0UA 3S7TA 2NN3C 3FNFA 3LC0A 5KAPA 5EQJB 5K3EA 3ZI4A 3ZWDA 4YROA 3EW7A 4D4HA 1T43A 3HSSA 2OAGA 2J6BA 4KODA 1U5BA 3DXYA 5IK2A 2PLRA 2VP9A 3SNKA 3WIOA 4LOHA 4E7OA 3UATA 2FPGB 2R9VA 4DN6A 4NV0A 1LUAA 3FR8A 2FKNA 3UHJA 3TPZA 1GVHA 2GOYA 1L7AA 2I1QA 2QVCA 5JSZB 5FLXA 3GJYA 4MUXA 3WLTA 4YRGA 1FSZA 3CT4A 2JAQA 5FEUA 2H6EA 3CPSA 5K20A 1YACA 4OK5A 2UXDB 4R8KA 3CNEA 2DBZA 2UXBB 5FXMA 2AYZA 1PR3A 1YDFA 3CLRD 5CIQA 3IQFA 2YJZA 4IX1A 4M9XA 4PO3X 4YJHA 1ZONA 4EKDA 3Q40A 1QYIA 1XTTA 4J8PA 4YMSA 3EC1A 3DAYA 4HEHA 2X1MA 3RSZA 4HWGA 2JD1A 3BEDA 3C8MA 3VC7A 4NWIA 1XBTA 5A4FS 1DKQA 3IRUA 3KE8A 4NG4A 1KERA 1XRRA 2J9ZB 2OCYC 4YBZA 1CJKC 1ELOA 2G9VA 2JCYA 4J94A 5EZYB 2YC2C 1X0VA 1NI5A 2I7VA 3OCCA 4W9NA 3ZDCA 4Q9IA 4QE3A 3F9CA 3EIEA 3U7JA 2PEZA 3R75A 2HPVA 1RWNA 2G83A 2TMDA 1Q11A 4R40A 5AM5A 1M74A 1U0TA 2GLUA 4GM4A 3RM3A 4DBLE 4ZOLF 3U2QA 5CEJA 1XAGA 2XCQA 1TVEA 1Z5GA 1ZY2A 5I5GA 4OMUA 3KZMA 1H8ED 1PJQA 2CYBA 2ZWMA 3B52X 4AL4A 2Z43A 4XM0A 4BFSA 5C5CA 4PN3A 1KQFA 2A3NA 3N6XA 1KJ9A 1IG0A 2V59A 3GBVA 4JI3B 1X7WA 3KHTA 1NBWB 2IXDA 1STOA 3M70A 5JIBA 1MAHA 3W5DA 2W6ZA 2Z4SA 1L3BA 1I4WA 2OV1A 1GR1A 4GPTA 5FQOA 1LNQA 2H9IA 1C9NA 2O8FA 5ILGA 4YRLA 3HI6A 3QNWA 3BJRA 1PIWA 1XZPA 2RI1A 1Q1NA 2OORC 4FC7A 5EKXA 5G1PA 4WOJA 3WIDA 2F8LA 4ZCTA 4XDYA 4XQGA 5IH7A 2VHJA 1YNSA 2BGWA 2P3LA 2G1KA 5AK6A 4IH4A 4L8LA 3IOCA 3P26A 1Z63A 1W6RA 1QMPA 1Y6JA 3LRTA 5ILQA 1PUXA 3R5SA 5BY2A 2DPHA 3C5HA 1D0VA 3LDAA 4A4DA 2YYSA 3HJCA 1VA4A 3MGGA 4IRMA 4E1VA 1CLEA 5FL7A 3Q7QA 1TZCA 4EELA 2QTAA 1CY1A 3AH8A 3OJFA 4GPIB 4ZFNA 4HDMB 3AONB 3KL4A 3FYCA 1M67A 3FYSA 3UB2A 2CFIA 1IY0A 1S7CA 4KIFA 4KVFA 3IFSA 2QUKA 1JPJA 4I55B 2OBXA 3S5JA 4O2BB 1A8HA 1A1VA 2Z9DA 1K6XA 4OH7A 1N2BA 4KK4A 3WGMA 3AV3A 3FUCA 2VBGA 3AUXA 4FMDB 4UASA 4NVRA 4E32A 5L3SB 2ZDHA 2GN9A 3HSYA 3BRQA 4KAFA 1CP3A 2F1HA 1KZGB 4RVUA 2L0XA 2VP0A 1S2NA 1X80A 1KU0A 2J6IA 2PIAA 3HR7A 4S1WA 4QICA 2K7FA 3RSCA 2D3WA 3N3BC 1GV0A 3KKMA 4DA9A 1W5EA 4D41A 3NVMB 1SB8A 3KELA 3S55A 3K9CA 1Z29A 2O2IA 2ZT7A 5JDIC 3FGOA 1SOWA 1J1ZA 3UJ8A 1TI7A 1SBNE 2GFQA 4X91A 1T1JA 2XI4A 5FUBA 1LI5A 1IUPA 1GDHA 1ONPA 1DX9A 3C6MA 2E89A 3FJ1A 1JJAA 2B5OA 3HU1A 3IT0A 4JLVA 4OQQA 3UWSA 1F4PA 3EQZA 1V6AA 2Q49A 4MAMA 3RV3A 3VZQA 1SVUA 2FWJA 4Q1DA 4DCTA 3KJGA 4KL8S 2CFCA 2IYFA 4MVJG 1GNVA 1I7LA 2GXQA 3TRIA 2Z3ZA 4EO4A 2HREA 5JMWA 2JFFA 3LDGA 4IRUB 4ZVVA 2Z95A 4B44A 5C80A 1NG9A 2AG1A 4HDNA 4WA7A 1A4IA 3RNLA 2WWFA 1C29B 4ZD6A 4DLLA 4D0GA 3IAEA 4B48A 2G1AA 4M0UA 5EA2A 3K2IA 4LK3A 2QXUA 2RBEA 5FADA 1KIAA 4DIMA 1AV7A 1E66A 2H5IA 1I7PA 1W9HA 2IPNA 3H5AA 1ONOA 3HJUA 1II8B 3FAZA 3ET5A 4JUDX 5EJ5A 3A6LA 3OESA 5EZ6B 2XUZA 5K3OA 1N7JA 2A9VA 1U2SA 2GEFA 2MYPA 2XQIA 3B13B 4EMUA 3OA0A 5BW5A 1JAYA 2H5LA 3QZUA 3F2VA 3OAAA 3CJTA 4M7RA 1Z22A 1ZAKA 3WICA 2JK0A 3C4VA 1KAOA 3URKA 2N42A 1U94A 3FE2A 3BJZA 4BGEA 1ILWA 4G97A 2DQKA 3KOYA 4MUNA 4F3CA 4QOSA 4RF5A 5EY5B 1F14A 3ZE0B 1F6DA 2A9QA 3HA3A 5AJZA 2AMJA 5AW1A 3I6QA 4YT4A 1KY4A 1YASA 4LGVA 1OXVA 2NSYA 3DZJA 4RZUA 3WYCA 1TF2A 3PKZA 4TYWA 3MLBA 4W8OA 1X3LA 4X90A 3OFVA 1QLHA 1QH9A 3SMVA 4BDSA 4XWWA 3OFKA 2F55A 2XNDD 1OB2A 5L4NA 2QEQA 3K9GA 1JKJA 2YJTD 1RXUA 3UJDA 4OOEA 4NS4A 5IARA 3U4HA 5L4LA 3DTYA 1K27A 3SQOA 5AK3A 1H1LB 4TLAA 1RKVA 3ANTA 3FVRA 3BDAA 3ZU3A 4HFMA 1IXZA 1FJHA 1NI4B 4UVHA 3UV3A 4D4MA 2FGKA 4JQSA 3LDUA 3AJDA 4HNRA 2F3RA 2YHAA 1PWEA 3PIDA 4HSGA 1D0SA 4YJKA 3L8DA 4X1KB 2NACA 3Q2OA 3DEYX 2VKTA 3AFMA 1LC3A 2FSUA 1OYYA 2OHJA 3RD5A 2SNIE 3DAHA 1T91A 3VXKA 4E3WA 3PNYA 1N2OA 4XX0A 4X66B 3P0FA 2VHZA 3HMKA 1ZMXA 4MR9B 1KAQA 5DEIA 3MT7A 4ZANA 3WXMA 4QT4A 4MA0A 2DWUA 1AD2A 1AZSC 1YUNA 2BFWA 5EIBC 1CIPA 1ETUA 3D8HA 1CDEA 1NMXA 3AHHA 2I3BA 1DVRA 3M83A 4B1FA 4K81B 2PIDA 2VF8A 4G65A 4BV8A 5CB4A 3EXHB 5B6PA 1ICEA 2IYZA 1B16A 1J2JA 1PR5A 1QZTA 3H16A 3R5TA 1NI3A 2QT1A 4IQGA 1ZR4A 1MDBA 3IAXA 5DH9A 4BGIA 4BMPB 1J21A 2R6HA 2ZIUB 2C5HA 1X0XA 3CPHA 2ZRKA 3K70B 1RVDA 2Q2NA 3TLCA 3OCUA 1N2GA 3CH4B 3FVTA 4FEAA 2IHKA 2FYTA 4Q82A 1OH8A 4GS5A 3M5WA 3UAZA 1MT3A 1AQYA 2ONKA 2E4AA 4YMTA 4KBGA 2E4VA 5BSMA 3H2GA 1LFAA 1N2CE 1T0HB 2AS0A 3O7MA 4MITA 2FWBA 3TRJA 2O8NA 1V4VA 2BEWA 2IODA 2OLKA 2PM8A 4ME6A 4XM2A 3ZK8A 5J4LA 1PNOA 2Z3VA 3HWRA 5K0SA 4Q16A 1PZMA 3F4KA 1C3JA 4IILA 5D1HA 3ONEA 3GGOA 5EC8A 2VUIB 4DJ5X 1ZIYA 1Z6TA 3I30X 1XVUA 1LK5A 2DFVA 1MVOA 2DFNA 5KKNB 1FNNA 2YFHA 2GFIA 2ZYVX 4YAFA 3KOWA 2RAFA 4OTZA 2QYHA 3O38A 4G5QA 3GFPA 4BX0A 2W42A 2JJQA 4AS1A 3QKWA 1IAQA 1G7CA 3G0BA 1D5CA 4RJJA 3E15A 1HM5A 4E22A 3UMVA 2PZKA 1KO5A 1HG1A 2IZ1A 2JGFA 3QXJA 2VLIA 3MZ0A 5CFLA 1EK0A 2IYTA 5IP5A 1G1MA 2N1MA 3D6MA 3AOEA 4K7JA 4CJXA 4GUAA 3SIRA 4DWOA 1CUUA 2WJZB 2EHDA 3P4YA 4H1UA 3BMQA 2PUGA 1XFAA 1V11A 1XEFA 3CUYA 1VDMA 3DOCA 4JP1A 4NZ9A 5L3RA 5EGNA 4C78A 1SXHA 4G0QA 3RAFC 5AOVA 1CNEA 2VATA 4MKRA 1SU4A 2EP8A 2GNPA 2I3AA 4GFDA 1K08A 2PD6A 5A9TA 1APBA 2ZTMA 5HE9A 4D0RA 1KQNA 4G1EB 5KYUA 4L5CA 3ER6A 4N5NA 1HZZA 4F3KA 3KLMX 4DV5B 4K6KA 1RR6A 2D2VA 1WSDA 3GGCA 5SV2A 3TD6A 1TAQA 3QOWA 4AICA 1GQRA 3A04A 2AVDA 4XFKA 1BEZA 2Q9AA 2UYCA 4JJEA 4MJXA 4ZZ0A 3HV2A 3GPBA 4TV8A 5K3DA 4BNKA 1TK2A 3NIGB 4YUAA 5ITVA 4J1TC 4LAFA 1A7JA 2JEYA 1Y6ZA 1W29A 3A1NA 3F98A 3L8FA 4GYKA 1D09A 3KKPA 1X7YB 3UWKA 1Y9ZA 1EP1B 3CRRA 3TOXA 2R8XA 4RVFA 3EA4A 4IPTA 3N39C 2VP2A 3OE1A 5HIMA 4WJKB 3UXEA 2DY1A 5T64A 5LLDA 3IKTA 3WYNA 2RHOA 3ZW9A 1R0SA 4ZJZA 1QHSA 1W88A 2ZVQX 4TRJA 3WR5A 2H17A 2WIJA 3A4LA 3SDZA 4BV9A 3A1CA 3NKFA 3TIVA 3LK7A 2ZT6A 3A4TA 2QUBA 3Q8XB 1H2RS 1SK9A 2Q1WA 4NCIA 4UQOA 2C5FA 1YZLA 5I7FA 3CWCA 3RHFA 1Y1QA 1QGDA 2ZTUA 2QTZA 4YJ2A 3MRVA 4HN4B 5K99A 3ZTTA 4DPMA 4PFSA 1RZRA 2QQFA 2XAAA 2O2ZA 2RHTA 5F1PA 3RK0A 3S5UA 4BE4A 1SUIA 3CZ5A 2GKOA 5L3QB 1JDNA 3DLCA 3DZDA 5EJAA 3ZZTA 4GMFA 1L4UA 2HCRA 1ZCAA 3UXMA 1XU4A 1TQHA 3LXXA 3VDMA 1CXZA 1P0CA 1B0ZA 4EG4A 5T7BA 3R9XB 1H0HA 1NV9A 2H1VA 4E21A 2QXYA 5HIJA 2V8BA 1UM9A 3LYAA 5BWNA 4TWAA 1G17A 4V0OA 3ZWKA 1BWPA 4NPAA 2JLWA 1RXEA 1GU0A 2W48A 2Z2XA 2I66A 2K7ZA 3ABSB 1QUFA 3GARA 1WZEA 3I8XA 4JROA 1HI9A 1Q74A 2HM7A 3AY0A 3BE8A 3FUUA 4B7XA 5KTOA 1XKQA 1UKYA 2QX7A 3E8SA 3S2IA 2FCRA 1T1SA 3VVCA 4PC6A 1N6KA 4WBNB 3RRFA 4ZYTA 1KK1A 2UVPA 4E5VA 4RH0A 4ZU3A 4P3OA 3WZLA 4CCWA 1JKFA 5DHTA 5BSKA 5J4YA 2Y1EA 5BNIA 3FMIA 1R5NA 1MTZA 4QU5A 1O94A 5BN5A 4Q48A 3H8WA 4JHLA 2ZPAA 2H2FA 2IY8A 2PV0A 2NV6A 5B30A 1FP1D 3SXUA 1P0QA 3M1AA 2W83A 4JT9A 4GZMA 2GPAA 3ZI7A 4LF8B 1IJEA 2I4LA 2PT7A 2PZ8A 2W6MA 1E1MA 1IAVA 2WWIA 3E7XA 4V03A 1CJSA 3SVZA 1S8AA 5IANA 2FQXA 4ARIA 5T3YA 1GQOA 1KEEB 3RVNA 1Z2EA 1PLLA 3CR3C 5I47A 1BDMA 1V1RB 1NI4A 1SVOA 5KNDH 5EIAA 3R6LA 2K6GA 4TKUA 9ATCA 4G3XA 1G59A 2GN2A 1KPGA 2DUUA 5HCIA 4EHFA 3FHJA 3VR6A 4A0HA 1ANKA 1Y7TA 4W6QA 1JIXA 1P77A 2E1RA 4R16A 2W6NA 1HDYA 5AI5A 3MIZA 5JZOA 3CEAA 3ZJUA 1HDZA 3JQGB 3GUHA 2PGIA 4CU5A 4NYIR 3HH8A 3H5RA 1V16B 2ZBRA 3CM0A 3X44A 5K8LA 2HQRA 3OZSA 5KIAA 4LF9B 1BWRA 1NAIA 2Q8PA 1OVMA 5EERA 3II6X 1R50A 2R1VA 4F9EA 2ZLBA 4E5MA 2GD2A 4RTPA 1WNFA 1N1GA 4DIFA 2HV9A 2B1RA 4UVDA 3QNMA 2WIBA 1ILEA 4YJGA 2PVSA 3F7TA 1TEHA 3GW8A 4N49A 4NV3A 4R2XA 4XARA 1QGYA 3U3RA 3MJTA 2QVYX 1O0BA 3F7NA 3PUXA 2SCUA 1SAYA 2OAQ1 4HNUA 3S1SA 4DJDC 1KJYA 1X77A 1KZ7B 5G1OA 4PTYA 5BV2P 4G1BA 3SR0A 4PSAA 2PXXA 1TZBA 1BDJA 4KQ6A 2WHRA 1UEXC 3DLBA 5KWVA 2ONYA 5IZCA 1M2FA 1MAWA 2RMKA 5DBFA 3U7IA 1M7GA 1AQJA 3HB0A 5HS6A 5EZ5A 3NHRA 1J9GA 1C3EA 1DMRA 3ESAA 3EULA 2E37A 3PDHA 4UBOA 4XCVA 1R74A 1YCDA 1Q7GA 2ARKA 4C6TB 5CG2A 1T36A 1XCJA 4F7WA 5AHRA 3E9EA 4DC1A 4L9WA 4TMKA 1A5ZA 3FHOA 5ALZA 1YA6A 3GUCA 4DQDA 3HCFA 3HDQA 3DQZA 3X1KA 1KYVA 3E5MA 1AUOA 4MWTA 2XWJI 3E1SA 1NDHA 1VL1A 4O2BA 4QL3A 2VPTA 1TLFA 3AI3A 3CVJA 4I6EA 4MUAA 4O4LB 4W5WA 3UB3A 5EHNA 2EFJA 3ZNNA 5L3ZA 4EABA 1Z7WA 2PKQP 3ETEA 4IS2A 3NM6B 1Q3HA 2UYYA 4GZ3A 1A04A 1JR3D 1VSQA 4Z5XA 1TTTA 2J41A 5AW0A 2YWDA 3GJZA 2AA3A 2F9FA 1GZUA 3NYWA 2IHYA 3OZIA 2FFAA 5A0FA 3TZCA 1ZHFA 1P7VA 2BMJA 1N32B 2P7IA 5EHXA 1MOSA 3ZYCA 2BF7A 1P5HA 4LXIA 4QSMA 1QTNA 2BC9A 5FKJA 5IDVA 1HFJA 1V3QE 4S12A 1FFYA 4OI1A 5F12A 3G0CA 1GL3A 3IAFA 1LS1A 3F3YA 1XD2A 3KDAA 1CJTC 5PGMA 2Y92A 4ZV7A 1AMUA 1M2OA 1XZHA 4QIHA 1P6QA 4MQFA 4NPCA 1VZ2A 4TWJA 3RHZA 1WULS 4UNSA 1JPUA 2PDAA 5ICFA 1BAPA 3BMNA 1NC3A 4EPVA 1ZN7A 3S7ZA 3GQBA 4A82A 4JBIA 4TTSA 1GT91 4NBTA 4C76A 5BN3B 2DBQA 4C6RA 5A5GA 3ZU4A 1T6YA 4UU7A 4TV8B 3M6WA 4UTVA 4YHBA 3BL6A 2WU0A 1VA5A 5DGCA 4QWMA 4L72A 1WU7A 4A2CA 5BORA 1G0OA 3KT0A 3MMPA 1P2UA 3UJNA 4F2HA 4NBSA 4CUZA 4QREA 1WKCA 2J45A 3C3JA 3DMGA 3MHPA 1Q21A 3CEPB 2RCYA 4GYJA 5E3JA 1NF9A 2QRUA 1C4OA 1DQYA 2CHQA 4L9RA 3RIEA 1ORHA 1G3MA 3B1WA 4IO1A 3J7AC 4E5PA 4S1OA 2OFPA 4HH1A 4ARZA 1UDAA 3MELA 3N28A 4OXNA 1QWOA 5HIKA 5C4IA 2JGMA 2N46A 4YR9A 1QYXA 1WMFA 1ULZA 2JIPA 4XUDA 3ICQB 5JSKA 1DV2A 4R0NA 5GJWC 1YL5A 1HH4A 3CRNA 2SBTA 5B1YA 1OIXA 5DLYA 2VJQA 4Q7MB 5ULLA 1KAGA 3ER8A 4P6VF 5ICEA 1KDTA 2ZSDA 3NDJA 4MVCA 1WX1A 1NP3A 3TSZA 5CCEA 2DWPA 1YKGA 1TJYA 3ICWA 4MDEA 1SURA 3HJHA 1G4AE 4X5OA 5KNBH 2VTKA 4Z3KA 2MSEB 3B85A 5DNDA 2FPSA 3HFJA 1BKSB 3IQZA 5AYVA 3T1NA 3VSDA 1JEYA 5A0TA 2FPLA 2XVMA 3MJVA 5H5JA 4AKEA 3F2IA 3ITKA 2GK7A 2PSHA 2QL9A 1XZQA 4MH0R 4A92A 2H16A 2ZWVA 2XA1A 4G0VA 2WLTA 2VZEA 3KC2A 4MKZA 1SZPA 2NUTA 4AX4A 2GYUA 2WEKA 3RKRA 4CE6A 5J47A 2XSZD 3F7MA 1FFAA 1O0SA 3K1TA 4X6XA 2C8LA 4O2BF 5LPNA 1ZA1A 2NZ2A 2P6RA 1NVVR 4WKOA 4B9AA 2FP3A 4YAIA 3T9AA 1NVUQ 5BN5B 4HYTA 3ND6A 1NMSA 3ANYB 1LBSA 1PV2A 2WAYA 3AKDA 1CDZA 2HGZA 3I6MA 5J59A 5GMOA 5F21A 3BHNA 3O1IC 2XTZA 1WLYA 5AK4A 1EK2A 1YIOA 4ETIA 1HNNA 4GE3A 4FSHA 4F2PA 5JBQA 2P3SA 4I19A 3VR4A 4Q93A 4ZT5A 1RYEA 2EARA 3SYTA 3H13A 2ZB7A 3I3SR 1IIBA 2JRLA 1KIFA 2JFZA 4G5YA 3O95A 1NL3A 3HEAA 2QTGA 4RA6A 5SYMA 1YOBA 2HPHA 1X7WB 2HWWA 3GAMA 4QUGA 4DV0B 1PAUA 1HURA 3AEZA 5AOCA 3UW3A 3K0FA 4TYQA 1V43A 3LPAA 3MJCA 3OSZA 1KR2A 4B6EA 1Q95A 1QK4A 4H3KB 4E3ZA 4XYMA 1VIAA 2BM8A 4WVLA 3VH2A 2WKPA 3OZEA 2C4VA 1G3RA 4YCBA 3L7IA 4ESOA 3A32A 4NCJA 4E5SA 4KPUB 3ANSA 1QVRA 2WTEA 2A5DA 4V0ME 1TUGA 3ISVA 4UBIA 3TL2A 2WVGA 4NV1A 4P3PA 3TQSA 3BM5A 4PANA 4E94A 3HP4A 1FCJA 2Z4TA 2VHCA 4KLNA 1KBQA 3DXFA 1RWXA 2FPPA 4H7HA 4HGYA 4MGKR 1XJ0A 4P38A 5A05A 5IM4F 3MT9A 3P96A 1GJRA 2N9UA 3S0JA 4RPGA 4KXMA 5JLAA 1CR2A 4KWEA 4YPOA 3I04M 3HBJA 5EUMA 1NXXA 1W9MA 3T7RA 4UE3S 3B5JA 2ILVA 2AZTA 3LKVA 2PYDA 4OREX 4Q9JA 1OFVA 3HUDA 3JWGA 2ZUEA 3AHCA 3GLQA 3JAWA 4AQYB 4GR5A 4NG5A 5CXQA 1IWPB 2FN4A 2MSKA 3FTFA 1ZU4A 1D6NA 4EYKA 2GJ8A 2SKCA 3RWOA 1VCNA 2XTJA 4HZUB 4JBXA 2D5LA 1CUXA 2ZUBA 4DMRA 3CW8X 3WLMA 2ZR9A 3F0TA 4FLMA 4PQGA 2VJLA 2HSEA 4CN9A 3DDZX 1KI1A 1V5GA 4RL4A 2W22A 3LNTA 2VYVA 1PVOA 4XVHA 1RHJA 1HFEL 1LZKA 4MW7A 4Q1EA 4CGYA 4EF4A 3BXZA 4RFVA 3EH1A 5PNTA 3DEJA 4ER5A 1Q6YA 5CDTA 5JH7F 2IS4A 4LBZA 5AVQA 2FSPA 3R0VA 2GCEA 4CDGA 3RQSA 1E4EB 2CHVA 1ESDA 1NW8A 2V6IA 1FUUA 3P2IA 2OGWA 4GWKA 4JDPA 5ECGC 2IW1A 3ST7A 1X74A 2BI8A 2Z5LA 3T9FA 1AMOA 3FJOA 2QN1A 3I04A 5KO2A 3FPFA 2J3QA 4X7MA 4MCIA 3T5CA 3HR4A 2BHNA 3TQQA 1XA0A 5B1EA 2F6RA 3NJ8A 4MRMA 4Q3EA 1SXGA 2BUAA 5JNVA 2GTHA 1U5AA 2ACKA 2C84A 1O3YA 5HCNA 4C88A 5KSZA 1MOZA 1ZJYA 3N07A 5CT9A 3WQSB 5FWYA 4DIDA 1RKBA 3FH0A 4YCSA 3H9UA 1UMCB 4CETA 3A1SA 1E77A 3BE4A 1E0DA 1DJMA 1J9EA 3AFGA 1MJGM 4XEUA 3PT5A 4ZTZB 1YRLA 3TSYA 1EWQA 3G6KA 5ESXA 3V4PB 4WI1A 1KQOA 1CUBA 2FUG1 2GN4A 2XH8A 3BG5A 5AQEA 4DIKA 5B7NA 3ADBA 3ROQA 3GJ3A 3KVRA 1H0RA 3OIGA 3UTDA 1YR6A 2FXVA 1ST2A 3GVIA 3PENA 2IS6A 3LWDA 4QBTA 2ZE8A 1CKEA 1Q77A 4Q47A 4AJEA 3TDMA 3TOVA 1WXIA 4ZCMA 4D4IA 4FFNA 4WOKA 5C32A 1EXNA 3DGEC 5BNFA 3NNNA 5AVJA 4LQCA 5DM0A 3RIGA 4WNAA 1NXTA 1T3LA 5DP1A 3K35A 5I4KA 3U3KA 4GHWA 4JI7B 2WMDA 2FW1A 2X9VA 1A82A 2WF5A 5CVDA 2NVUB 2CLIB 2GPTA 4AS3A 3AESB 3CUKA 2ZITA 5ALSA 4J1QA 1KP2A 2Y9PB 4UM5A 4OUDB 2D74A 3HDJA 2N1BA 2D1RA 4KFCA 1ZG3A 3KYIB 3ZD7A 3GT7A 3QF7A 4CM3A 4YCAA 3WYDA 4OQPA 1Z39A 2H2DA 4NY1A 1VGVA 4INJA 4OJYA 1E64A 1OCEA 4QX6A 4F4UA 2OKGA 1R37A 3NONA 4LDAA 2R7NA 3TW6A 3PXDA 4F4CA 5L45A 2PSSA 1XLUA 4TSFD 5AW8A 4P2GA 1LRLA 2BEVA 3NT4A 3D8UA 3KALA 2HCTA 3JWEA 5K2MA 1JLKA 4J16C 3VKVA 2EAUA 1LDNA 2A1TS 2BFBA 1GDDA 3KU1A 2R751 2GQ0A 5TGZA 1IJKA 5AIAA 4BIMA 4BNHA 3QHAA 3WWZA 2JCGA 3KJIA 1IXRC 3D7KA 2FPXA 7AT1A 3PK0A 1QXSA 4MUBA 4TMZA 4RE6A 2HJ9A 4RJKA 3AR5A 2ZRMA 3G2PA 3M49A 1DI0A 1H5NA 4WBNF 2JGRA 4Y9UA 4EOGA 2BFFB 2GJSA 2WM2A 4Z9BA 5C8YF 3R8FA 2J9FA 5FTKA 4S3MA 2ASEA 4YCDA 3CMMA 3AETA 1VBKA 5JWRA 1T3HA 1H93A 3F1KA 1INLA 2UAGA 2HXYA 2F48A 3EEBA 5I51A 4DCMA 3HB1A 4HRVA 4Q1VA 4RLFA 1NG1A 1QU3A 1JS1X 1YC5A 2W58A 3DWIA 1E0JA 1Q19A 3H8SA 5LZ8A 1TM4E 4ZYLA 2VNSA 3QEAZ 4ZQCB 3GD5A 4E03A 4JC5A 1QH1A 1XZLA 1XDWA 1DOAA 1PNVA 4R69A 1H2FA 3ZVNA 2C2BA 5LDHA 1NKSA 3B9BA 4BWVA 4R83A 2WILA 2Q29A 3NP9A 2G88A 1QGUB 4YY3B 4BBZA 1C1DB 3NRJA 1VPTA 5F1YA 3WNBA 1OFGA 2P68A 4JLSA 5DIZA 3N0WA 1E3WA 3DVSX 1EM8B 3QY0A 3LA8A 4JSYA 3OF3A 4XSGA 3PNSA 4TS9A 5IMBA 4FMDF 2MSDB 1TKCA 1ZCBA 4AZ0A 4DKJA 2D1SA 3B20A 4H7PA 4FD3A 4H7IA 2C2XA 4RFSB 3FKJA 1SHZA 3WBKA 4BRZA 2P9GA 3L6UA 1KK2A 13PKA 3A3PA 3T61A 3UHOA 5JVDF 2CNNA 2VSOA 2CVPA 3D3WA 4Q15A 3W7AA 4CCYB 1F4LA 2FF7A 1P33A 2JATA 2LZ0A 4PBSA 3KZCA 5FOQA 1H4SA 4LNUB 1I5RA 3G2MA 4YONB 1IYZA 1GU1A 1XU7A 2A1IA 2ZR7A 4RHYA 1N34B 4JJGA 2IYYA 3E9RA 5KC8A 3MTAA 4OU5A 5HFNA 4JXXA 2YBEA 4P82A 4CEHB 1UXKA 3HKEA 5M5BA 5D86A 1UAGA 3UWOA 1K8QA 1U8ZA 2TSYB 1KFBB 3RB8A 1AKTA 4L4SA 1TGYA 4UJ3A 3GCGA 5F23A 5KJEA 4W8GA 2C7PA 1V5FA 2ZS8A 3VBCA 1IOVA 2Q2WA 4LX8A 3NHYA 2AR9A 2Q3HA 1XZMA 2JFOA 3NATA 1WY5A 1YZFA 1C41A 1MOPA 2C3PA 2V7BA 1H2HA 1NHGA 2JFHA 1THMA 3HADA 3KG2A 5TPWA 3JARB 2HRQA 4J3NA 1I2BA 5EUBA 1U8FO 3FGZA 4EUFA 2RG7A 4E5YA 3T4PA 1Y8RB 1V95A 1SC3A 2B8EA 5HTOA 4PQYA 3OKCA 2W4IA 1ZL2A 2P3OA 4K6HA 2Y1XA 3PJDA 1KH2A 3H0KA 2OQIA 3NOVA 2P69A 3Q7SA 1DDOA 3N7UA 2W43A 3B6IA 1U0OC 5JRJA 2ZDQA 2ZIXA 4JL5A 5HBRA 4WLOA 3H4VA 4W5TA 2GEKA 4KP7A 1KK3A 1TTHA 3BCRA 1QP7A 5HM6A 4QATA 3V6MA 1R5BA 1Z6PA 4J4TA 5CU7A 3IP3A 1XNRB 2GVZC 1DAIA 4H6WA 3PZRA 2GHQA 5F7ZA 2TECE 3PUIA 1OFUA 2XKAA 5LA6F 5GZ1A 5KQSA 3GFVA 1RKQA 3KBBA 5BQXA 2FPMA 2OXRA 2PL5A 5LQDA 3OTQA 1P2FA 3CS3A 4LG1A 1LD3A 2PBLA 2NZXA 1UDCA 5LP6B 2A0FA 3OIUA 4UHBA 3DE2X 4ALNA 4AF6A 4HB3A 3NEAA 2W4MA 4HEA1 4M8KA 5HF9A 2Z3WA 3U7EB 4BAUA 1BROA 1NT2A 4XRGA 3C41J 3EEQA 5A9SA 3RTBA 4RK5A 1U9CA 3MEQA 2O8EB 1OA0A 2J7KA 1UM9B 4HEJA 4DCPA 2X4IA 1H9AA 1VRVA 4MHSA 1NFRA 1UPXA 2P91A 1L7XA 3VPGA 2QPAA 4EPRA 4BPRA 4BQRA 2JFYA 2RKOA 4EL5A 1TAUA 2ZRJA 5FH9A 3PPIA 1SVMA 4FHCA 3PWKA 4I1VA 4DANA 1U6KA 1M9NA 5E7IA 1MN6A 1QKKA 4F1KA 2Z08A 3TX6A 3BJMA 1NBEA 2G04A 3C0KA 4TL6A 3X1XA 5CH5A 1B00A 1F51E 2ZIZA 2P9EA 4X7BA 2D5IA 2O5RA 5B4VA 1DO8A 3AVVA 5SY6A 4D3ZA 2GLXA 2NUTB 4NBLA 1QANA 3E1KA 4U63A 5A7FA 2IE0A 3BGDA 2VTBA 1L9KA 4BLTA 4RSMA 5F9FA 1QHHB 3HO1A 5JV5A 5DNVA 3UJ6A 2WNHA 4QTYA 1U8TA 4H17A 1MH1A 3K4HA 4XWYA 1USWA 1Z0SA 1AV6A 2DLDA 3EIWA 1TF7A 3IQHX 4DILA 5K0EA 4DCUA 2YBDA 2PKYX 5FDFA 2Q3EA 5I4CA 1XQ9A 1C2TA 4OGWA 1HT0A 1EESA 3OZDA 4RDXA 3EXFB 2G6BA 2INGX 2FK8A 2PLFA 2YHSA 2W6ID 3TZQA 2Y0BA 2X0IA 2HK7A 1SHJA 3CLUD 2PKEA 4BPBA 5CPFA 1E63A 4NEQA 2QOEA 2BKUA 2EW8A 3CX3A 1Z36A 2ZTVA 1LTQA 5ES4B 4WZBE 1PUIA 5EQDA 5J2UA 2X5NA 2LD4A 2AHRA 5TB5A 4AMBA 4Z1MD 1JVBA 5DGIA 3VZRA 3UW1A 3KSAC 1D1PA 2AMLA 2J87A 3FETA 4Q9LA 1SIOA 1LBHA 3BA1A 1QPZA 3E0XA 1CY6A 1CQPA 4DSAA 4B3CA 5A3SA 4H27A 1JEAA 2C5LA 4GP7A 1JR3A 4GNRA 4MS1B 4BFCA 1P2VA 1HEYA 1L5HB 4HDRA 2GWHA 4WDRA 1XR3A 5TARA 1WSWA 3VR5H 2NP7A 1RPNA 1JU4A 4IINA 4QYSA 1NUHA 1R4ZA 1XEAA 3GL9A 3U3MA 2GLTA 2VNJA 1DRKA 1PX2A 5AUNB 3N8KA 2FFQA 4RA9B 2F9LA 3IPRA 1J5EB 5LA6B 2HNKA 1Z74A 2PMKA 1OREA 4DY6A 1UMBA 1LY1A 2O59A 2VFAA 1U8CB 2HJGA 3QXSA 4PFQA 2DHCA 4TWZA 3WRWA 4KEAA 1W5BA 2I22A 4C01A 2C9OA 2BI4A 3N6RA 1ZK3A 3B5IA 3QLVA 4RY2A 5TSDA 2IS2A 1T2UA 3GRFA 3QPVA 3OPXA 1KRWA 3T5AA 1CBUA 1TM7E 5IKMA 1U1CA 2XPCA 3AEQB 1Y6QA 1UDXA 3RS5A 3SYLA 1HYEA 1J06A 4TUYB 4ZT4A 3BWXA 4FFDA 1TYEB 2C5EA 4RMIA 3C16C 2CB0A 2DUMA 3IDZA 1LSSA 3DPIA 1M5RA 1O5IA 1V4BA 1M8PA 1FNMA 4R9NA 2GH1A 2YOFA 2Z9CA 4P81A 2XDWA 4RD2A 4RORA 3DZGA 1MB4A 4Y6QA 3VZBA 1D7AA 3UK2A 3RVBA 1NGSA 2ADOA 3A31A 3QENA 3KOUA 4WEQA 4FE3A 3ZOZA 4CL2A 1JHDA 1M76A 3E9YA 1AA6A 4CV1A 1FYWA 3F1LA 1LLCA 3HACA 4DKXA 4GL2A 2OM6A 4V2UA 1QP0A 2I1LA 4QYIA 4X3OA 4QRDA 2P41A 3I72A 2ZS7A 3UKJA 2ORIA 5BV8A 1BFKA 1EZ4A 1YHZA 4MWOA 4U39A 4UAJA 1QIHA 3AMVA 1TFRA 1W52X 1F38A 5F33A 4CDRA 1GT6A 1MX3A 1QYCA 2IEBA 3OZXA 4ABTA 1R6VA 1IK6A 1IDN1 1U1EA 3I9JA 3QLUC 4HK4A 3EHDA 4XVQA 3RFFA 3THYA 1MB0A 1MT0A 5IM4A 4DIBA 2XRMA 1FE8A 1W19A 4Z1MA 2ZRAA 3GEMA 4OHYA 4OHKA 2W6PA 1SXJB 4B6QA 3SEFA 1DJQA 1ZIOA 3B9PA 3F74A 1EMDA 2C7VA 1W0KA 2P11A 3GV0A 3NAQA 2B61A 4WZAB 5CVJA 2C9ZA 4RD6A 5EZSA 2D7CA 2PQ0A 3L0SA 3SBEA 1GL9B 4Q3LA 4CLXA 5JS7A 3HA2A 3KZKA 2QENA 2Q4RA 3SC4A 1R0CA 1O58A 3ZWOA 1SOAA 5BSEA 5C1IA 4HXFB 3H2BA 1HSOA 2JKZA 2P6MA 2XVYA 3K70D 2I6XA 5EWJA 5JJLA 2CYCA 3UGTA 3UPUA 1SC4A 2WKQA 3LKBA 2ZYIA 3DV0B 2O0JA 1VHDA 2JNWA 3O3OB 4YASA 3Q3IA 5DZSA 3ZZUA 5IUNC 5IXSA 1Q17A 4EGAA 3ZK9A 4LI3X 4YMGA 5DYNA 2ANCA 3FOZA 4OFBA 1MH9A 3CLSD 3MJ4A 1U2QA 4MUHA 4R8SA 4IJUA 5JC8A 2HDOA 4Q3KA 2R00C 5FORA 3AZPA 3ILYA 1TQ4A 5JU6A 2QX9A 4KOAA 2J0SA 2WWVD 1KZYC 4IMRA 4P3KA 2QTBA 2JF0A 4GX2A 4RELA 4B7UA 5JPDA 1PJAA 1WUKS 1I51A 3FZNA 2V7UA 3PEYA 5A0VA 4V3CA 2GBLA 1EFLA 1VSBA 1WDKA 1BQEA 1NW5A 1W44A 2XGMA 3FFTA 4QASA 3L5KA 5D3QA 3R7NA 5CBKA 2F7SA 1X7XA 2BEVB 2NT3A 3A6ZA 2P0EA 3H5TA 4HYQA 5COBA 5EE9A 1XTQA 3FB1A 3PHBE 2OL4A 4BQSA 3R6TA 3RASA 2W6OA 2QRVB 4M0MA 3B1XA 2C5AA 1OZ0A 2AR7A 2ATCA 3FPEA 2PLAA 5IDXA 3KRTA 1DAGA 1PR4A 4GMKA 1VRCA 4A8PA 1NU6A 3IC5A 1G8FA 3BT7A 4MULA 4M76B 4MRSA 3ASVA 3PC3A 3LBNA 2GTIA 1KFCB 1I0LA 3CSUA 1LB1B 3WA6A 2QD1A 4Y2UA 5JANA 2ODQA 2E5WA 1H3NA 2IKQA 2B98A 2JJ1D 2OCBA 3LC1O 1MENA 4KN5A 3TBHA 3BX1A 2CBGA 1T5SA 2PGJA 2P2ZA 5K8JB 1T0UA 2IYNA 2PT5A 4OGLA 4P7KA 1HDCA 1LZLA 4Z99A 4CI0B 2D0PB 4DLVA 2CY0A 3OPVA 3KB6A 2WTUA 1U02A 3PC8A 3SMQA 5I3ZA 3V6LA 2ONCA 3EVCA 4KGXA 3WGZA 2RGYA 3KZXA 4J7XA 4BZXA 5BVHA 3W5BA 1FLNA 2PCJA 5HKAA 1Y1RA 3O1JC 1KDZA 2BKXA 1S1CA 2JAUA 2FUG6 4P31A 3DKKA 4DYHA 4EKYA 5CVTA 1BHQ1 3H1GA 1GL7A 4FCCA 4R31A 4DV2B 4KR3A 3LHFA 2FOIA 1OIWA 4GMXA 4DL9A 2NTJA 4Q03A 3JD3A 3E5HA 4WL0A 4IG4A 2J5RA 4E2YA 1Z28A 1IM8A 2X7JA 4D4GA 4FYIA 3MJRA 1T5DX 1TO2E 2WA2A 4J7CA 3S1LA 1BMFD