5HTOA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1 (tetrameric ldh in an asymmetric unit)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
302
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
molecule keywords L-lactate dehydrogenase
total genus 113
structure length 302
sequence length 313
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5htoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5htoA02
1I3KA 1NBOA 3PP8A 4FIZA 1DIHA 3H9JA 3TL2A 4RL6A 1R15A 4CMIB 4IY1A 1LNQA 1Q7BA 1ZXLA 4DBVO 4GL4A 1UP6A 3GVHA 4W7HA 2Y1FA 3QQPA 3ENNA 1FK8A 5DNAA 3DZIA 2E82A 4CLRA 4Z0PA 4H3VA 4RVDA 4TQGA 1YQXA 2PGDA 1W73A 2AEMA 1SMKA 3E48A 1NPTO 4NPCA 4CLEA 1NX6A 1ZBQA 1AXEA 3H65A 4Z3DA 1C0PA 1PJ4A 3GDFA 3JD0A 4QSMA 1U3TA 3DBRA 3NJ4A 3R1IA 4WLFA 4FFNA 4BNVA 4KQXA 3UCEA 4A26A 4R1NA 1E3WA 3WGGA 3JQAB 1ONPA 1E92A 1GU7A 4K6CA 2WYWA 1GYPA 3DOOA 1HL3A 1XHLA 2I3AA 4WPGA 1S7CA 2X9VA 4NBUA 1EFKA 5I7EA 1Y5RA 2IZZA 4RVUA 4BO5A 3U3XA 4YQZA 3ITDA 2BFOA 3WJAA 4DIOA 2EW2A 2V65A 2YV1A 1VJ0A 2W2KA 4CL8A 4KTVE 4NBRA 2BH9A 4QECA 4DVJA 4A0SA 4R5MA 1YKFA 3GZNA 3FR7A 4JP3A 1VSVA 5JNLA 1LX6A 5ITVA 3SBOA 1LDYA 2LDXA 1Z45A 4CMIA 5ER9A 1WMAA 2D0IA 4IDEA 4GSLA 1B14A 2CF5A 1JLLA 3F47A 1M75A 3GMSA 4KQWA 2DVMA 1IZ9A 4ALMA 1XGKA 3H5NA 1Y8QB 1P31A 4UVHA 4DLLA 1KVRA 1ZFNA 3K6JA 5CEFA 5FEUA 4PIVA 3TSCA 3C24A 3P5SA 5GZ3A 3KSZO 3AFMA 1DFHA 4ND4A 1IULA 1LXCA 2VN8A 3AY3A 2E49A 4NMHA 1DRWA 2NQ8A 2VYVD 4FJ2A 1T2AA 1HE2A 3VDQA 2YZ7A 1BVRA 4Y6RA 3G1UA 1M76A 1D1SA 3KEOA 4MVJM 1MP0A 3E8XA 1LDGA 3LT2A 2VZ0A 1Q0LA 2DTEA 5K9ZA 4P22A 4XQCA 1AXGA 1PR3A 2OFPA 3BA1A 3ZWCA 5I7FA 1SCUA 4GVLA 3WGTA 2QRJA 3WSVA 1Z74A 1H94A 1LLUA 4M1QA 5B37A 4A7PA 1PS9A 3GNSA 5TGDA 3VPSA 4BL5A 1HKUA 1MXFA 5FI5A 5IF3A 1BGVA 3ANNA 5THKA 4D46A 1K5HA 5JC8A 1E7QA 2AE1A 1KVSA 4CLRB 1QMGA 3GPIA 1T26A 4I9NA 3E1KA 4IDDA 3VH3A 3GC6A 5LDGA 3QLJA 2QRKA 2NM0A 1SOWA 3I6QA 5EESA 1P0FA 2H1SA 3E9NA 3EYWA 4J1TA 5TT1A 1WDKA 4CQLA 2C7VA 3MJVA 5CDUA 3ABIA 3OH8A 2BMAA 4DPKA 3A4VA 4N18A 1CQIA 3ROQA 3W8FA 1DDOA 1YQGA 4I5EA 3VH4A 2POQX 3SX2A 1Y7TA 1C0KA 8ADHA 2ZCVA 3FTPA 4XRRA 4BNWA 1DJNA 5JMWA 1L7EA 3PJDA 1ZEJA 3MWDB 2B35A 2HU2A 2EG9A 3TFOA 4Q3NA 2IXBA 3AUAA 1LQUA 2V7PA 4HUJA 3F46A 5A04A 4NHEA 2CFCA 3PDJA 1GD1O 1PJQA 1MC4A 4XKJA 4CM4A 3VVBA 4EUFA 3DDNA 2AG5A 2E48A 1O5IA 2Q99A 3U0BA 1Y5MA 2JFFA 3IDSA 4PG6A 3NDIA 5JLAA 3WOHA 3QWBA 5HRUA 1ZCJA 3DBLB 4FQ8A 4KOAA 3EMKA 3UFXA 5G0UA 2I99A 4DYVA 4KZPA 3QVTA 4PLYA 3VVCA 1OMOA 3ZH2A 3PYMA 5H81A 5TLSA 1TVEA 4Z3KA 1PZEA 5BSFA 1A4IA 1ONNA 4R1TA 1DC3A 1ID1A 2JD2A 2IZ1A 1HDGO 1NR1A 4YBZA 3AY7A 4IINA 2EERA 1NNUA 3UOGA 4AJJA 3LC7O 3ANMA 4ESOA 2X4GA 3Q6IA 4IBOA 2D5CA 2DU8A 4RDHA 3DOCA 1PS0A 4ZN6A 3SJ7A 4U7WA 2Q2WA 3PGJA 5CDTA 1UP4A 5A02A 3MJCA 2Z5LA 4YRDA 5C3MA 4BNLA 2D3TA 4CMGA 2NVWA 3EC7A 3I3OA 5K6AA 3LLSA 3GVIA 2DKNA 4G65A 1ZKMA 5EMHA 3I6IA 4DXHA 4NFSA 4CJXA 1ZSYA 3I83A 4ZGWA 2FY8A 4FOOA 4LMPA 4KWHA 4D3DA 3GAFA 2HSDA 2P68A 3RROA 4N5MA 4L73A 5A06A 1HE5A 4BNXA 2DQ4A 1H6BA 4GX0A 4HFNA 1RJWA 2ZYDA 5LDHA 3DBLA 5IDXA 4PVDA 2YW9A 2EHDA 3JYPA 5CEJA 3CZRA 4CMBA 2J3IA 3QHAA 5C7LO 1UXGA 4YAKA 3GAZA 2Q46A 3WB9A 1C1XA 1UDCA 3BHIA 3PWZA 4FBGA 4PLFA 1U4OA 4WKGA 3VH1A 5AVOA 2FPPA 4NK4A 3AOEA 4TZKA 2RCYA 4FOSA 4ZQHA 3STHA 3U62A 4F6CA 1KETA 3CSDA 3PIIA 1DHTA 2HMTA 2Q1SA 3E6AA 4HADA 3E5RA 4YJGB 3NDRA 2J8ZA 3H6KA 4ZJUA 2BRUA 5T5QA 3TJRA 5L4NA 1BXKA 2NACA 4KUHA 3V2HA 2ZB7A 4DTIA 4WE3A 2DBZA 1ZK3A 3ROKA 3CZMA 1FDWA 2HK9A 2VUSA 1WLYA 5DT9A 4QFDA 4KWIA 1JAYA 3CEAA 3TQHA 4YVFA 2B4QA 3F9IA 3NUGA 1CETA 5BNIA 1ZEMA 1DC5A 4J0EA 1I0ZA 3V2UA 4BKQA 5L45A 4IXTA 1HLDA 3ZWNA 1ZK0A 5EQDA 4BGIA 1LQTA 2VUUA 2ZQZA 6ADHA 4AJPA 4RGBA 3TDKA 3GG9A 5IZCC 3FBGA 1F8FA 4H7PA 2G5CA 2I5PO 5FFFA 4FJ1A 3FCOA 3RC2A 4ALJA 1T2FA 4IZIA 2FSVA 3D3WB 1XELA 5CFZA 1S6YA 2WYUA 3C7CB 3VPXA 5A9TA 4E21A 4AJ1A 5TF4A 4BGUA 4BKOA 3LSYA 1H6CA 1T25A 4E5KA 3ZNPA 1SEPA 1O8CA 1KOLA 2DTDA 3DQPA 1ENOA 1RM3A 5CPBA 1ZH8A 1GUYA 1QYXA 1U3UA 3ASUA 5JE8A 3GLQA 4HFJA 2G1UA 2QHXA 4MKZA 5JY6A 3OETA 1I01A 2VYVA 3A1NA 1ISIA 4E30A 1DJQA 2W8ZA 5KWEA 3IKVA 3H2ZA 5EERA 3PYXA 1XU9A 4RVSA 4CR7A 4GVXA 3MJ4A 2ZK7A 1GZ3A 1GFSA 3D64A 4U0KA 4OKIA 3W4KA 4NBWA 2X0IA 1P77A 4IDAA 4E2ZA 4ZQEA 4IIVA 4MVJP 5ER6A 5TSDA 1QKIA 4E2YA 2UYYA 2TMDA 1MG5A 4PLWA 2OXIA 4IDGA 2FSSA 4PZDA 4RLSA 4RPJA 1RM0A 1UDBA 4CM6A 3FPCA 3ZWYA 1U1IA 2XF8A 4CMEC 3GHYA 2DPHA 1IHYA 1C1XB 4YAEA 4ND3A 3WWZA 5JAZA 3DEYX 3P7MA 3QVWA 4RVHA 1EK6A 2GN8A 4FFRA 1JVBA 4J1QA 5LCXA 2NWQA 1E3IA 3JV7A 4RJTA 4J49A 1U9JA 4B3HA 2WSBA 1B26A 1QG6A 3DHEA 1CQJA 5EINA 3ZU5A 1HDYA 1XCBA 3D3WA 4Y67A 3TL3A 3TPCA 4YQYA 4DPMA 2C7GA 1E1NA 1L1FA 1GUFA 1JKJA 3FNFA 1LSJA 3RFXA 4ZRMA 1PZGA 4Z9FA 3DBRB 4MVJA 9LDBA 3TFQA 2HRBA 2AQIA 2X23A 3JQAD 2B37A 2VQ3A 3JQAA 4O63O 3ZWPA 4R3WA 2AQHA 1LSOA 4CODB 4MVJD 1UZMA 4FFPA 3ZWWA 1HYEA 3RUEA 3NGLA 3T7EA 1H6AA 2EKLA 3C3XA 2PWZA 1YJQA 3L9WA 4E6PA 1R37A 3WNQA 2G82A 1P1FA 1GPDG 3WNVA 3MWEB 3PDUA 1DFIA 3GN1A 4J7UA 2W2KB 4BMSA 2P9EA 4CUJA 2AE2A 4L4SA 4K28A 1GL3A 1UXHA 1PJBA 5KKAA 1A7KA 1TT5A 2ZQYA 3U4HA 3ZNOA 1R12A 3WQRA 3PFFA 1Z73A 1NAHA 3UN1A 3DTYA 1I2BA 5A05A 4R9SA 3S2IA 1YGYA 2NTNA 2FZWA 2YV2A 3H9EO 4LRSB 1IPEA 4B4VA 3EUWA 1U2GA 2EV9A 3L77A 2EP7A 4TRNA 1YONA 1IHXA 1YS4A 4BHTA 3ANLA 5IN5A 3I1JA 2E4AA 5F1OA 4NU5A 1BG6A 1WXDA 3LF2A 5G0WA 3VTFA 3ZZNA 1DAOA 1JWAB 1Z6ZA 3W4JA 4YT2A 5KVCA 2GDZA 4OSPA 4GLOA 3ZV4A 1JW9B 1HYHA 3NT5A 3BTSA 5CAEA 3JSAA 1VI2A 3A14A 2C2XA 4Z0TA 2Y1EA 3RC1A 1VKOA 4BO7A 4YA6A 4WLVA 5ICMA 1P74A 4W7IA 3SXPA 1UXKA 1O6ZA 5HS6A 1SOVA 1I3NA 1Q7CA 2VOEA 3DFZA 4I8XA 5AOVA 1T4BA 4WLEA 3PPIA 2PGJA 5HA5A 4H15A 6LDHA 4UUMA 2VRCA 4M8SA 2PH3A 3F4BA 4HV4A 4XYMA 1AN9A 2GUGA 4B8ZA 4DQUA 1NR7A 1NAIA 1OBFO 4PZEA 2H63A 1H5QA 4OHUA 1SZJG 3CMMA 4R51A 3PWKA 4F45A 1PS8A 2PKQO 5BSGA 3WGQA 3GMDA 2C5EA 1IB6A 4Y98A 3ZV6A 4D0RA 3DBHA 4UVEA 3QIVA 2NNLD 2OO5A 1JTVA 1JU9A 3G3EA 2NQTA 3BTVA 3CMCO 1GZ4A 4XX0A 1TEHA 2CDCA 2XOXA 4GAEA 4JBHA 1RYDA 2AG8A 1GQQA 4MVJH 3D0OA 3VKVA 5H82A 4AJIA 4MVJG 5L40A 2FR0A 5JDIA 1SNYA 3JQDA 1ADGA 3FTNA 1HDCA 2TMGA 4OL9A 1PQPA 3AI3A 4MJLA 2PY6A 4HFMA 4XQGA 3OIDA 3MJEA 3F6YA 2WEKA 1AHHA 1T1RA 3GGGA 5T64A 4CM4B 3QJ5A 3GUYA 2O7QA 1TT5B 1YJ8A 1YB5A 3B70A 1U3VA 1YWGO 4IJVA 4RVGA 2WE7A 4B7UA 3VPGA 3AM5A 1E3JA 3PHJA 3DXFA 5CEEA 4N54A 3IP3A 2NU6A 3HN7A 2DBQA 2J5QA 3CH6A 5A3VA 1QSGA 3DB2A 3IQDB 2VWQA 5A03A 1C14A 4NBTA 3WQSB 3WGIA 5T8KA 3PYLA 2CVOA 1DRUA 1N9GB 2QQ5A 4CL3A 2RH8A 4I5DA 2X0JA 2IRWA 2B36A 2B4RO 2WD8A 3FR8A 3OF2A 3Q2IA 5HS4A 2B4TO 1X1TA 4BB5A 5JAMA 4XRGA 3DBHB 3FBTA 3D7LA 4IUYA 1KS9A 3OM9A 4Y9DA 1KYQA 3RSHA 4JJGA 4MP3A 4UVDA 1PL6A 5F5LA 1DPGA 1M67A 4JP2A 2O7SA 2DAPA 2C59A 4XZ3A 4A73A 4XR9A 1DAPA 4MIOA 1MG0A 4DQVA 2CY0A 4EEZA 3S2FA 4BS9A 4EI2A 4A2CA 3O9ZA 3PQFA 1LA2A 1A71A 1I33A 5KJFA 1PGNA 4OSOA 2Y0DA 3BZUA 4U8GA 3RKUA 4BO3A 4LVCA 4J4HA 3K9QO 1EDZA 3DWFA 4R4JA 3ST7A 3FF4A 2C0CA 3H4VA 4WLNA 4EW6A 1U5CA 1OZAA 2O2SA 1E3EA 5C7OO 3D4PA 3R0IA 1SB9A 1WWKA 3L6OO 4UEKA 2CVZA 4L0QA 4UREA 5TS3A 5KCZA 4J7XA 2H5LA 3DZBA 4OM8A 5H83A 1NFRA 4J90A 5CHEA 5IXSA 2Q49A 4GX1A 1MUUA 3WGOA 2PFGA 1P1KA 1Z7EA 4BNUA 2SCUA 2VUTA 2R2GA 1E1KA 3HDYA 4JROA 4LSMA 4FN4A 4UVIA 2DUUA 4XCVA 5IJZA 1H0KA 4CM3A 2IYPA 1GQYA 3FWNA 4UULA 4FCCA 2QW8A 2GSDA 3GEMA 3ON5A 3B1JA 1I30A 3H3JA 2WD7A 3KTDA 4CMCA 4J2HA 3QWIA 3TZCA 2X6TA 4YJGA 5FWNA 3NYWA 1JN0A 1EZ4A 5TIIA 1R0KA 4INAA 8LDHA 4DPLA 4DIFA 4DUPA 2QIOA 5A9SA 2ZYAA 1VE9A 3EW7A 3NV9A 4WUVA 1R0SA 2X1HA 3DC2A 1B15A 5IZCA 3IL2A 1ZSVA 2C20A 4GKVA 3DZGA 1WDLA 1I3MA 3C7DB 2AEJA 3NT4A 4QO8A 4WECA 5JY1A 1PGPA 2P5UA 2PLAA 4P4GA 3OFSA 4XJTA 3RUIA 4MIYA 4IDCA 4FGSA 4PG8A 1EDOA 2JD0A 5BQFA 2VZ8A 1PSDA 4CM5A 4BB6A 1A27A 2AMFA 1DLIA 3U9LA 1IY8A 4YJHA 3LDHA 4CQLB 2D59A 1JKIA 4NFHA 1NVTA 1C0IA 3JQ8B 4BNZA 4BNNA 4FJ0A 3SVTA 2GYYA 5DZSA 2DBVO 2VHZA 4YAGA 2YHIA 3GVCA 3RASA 1U3WA 1ZJYA 4LN1A 2GNAA 3KUXA 4I9HA 3VH2A 2E37A 2WM3A 2YQ5A 3KXDA 3AI2A 4ZQFA 2DC1A 2YYYA 4EEXA 1FDSA 2AHRA 2C54A 3ICCA 4Z9YA 1H6DA 3OJLA 3W8DA 1U8FO 4JBIA 2PGLA 1BDMA 1C1DA 1YOVB 3QWHA 4XEHA 4RF2A 1VL6A 2EGGA 3UUWA 1K0UA 1OFGA 4JBGA 4U5QA 4EJ0A 3UH1A 2NU8A 1A9YA 1MA0A 2ZYGA 4YJDA 2WE8A 1W0CA 3TZ6A 4R68A 4BNIA 3L4BA 3KM0A 4E5YA 3C1OA 1P45A 3FI9A 4PN3A 1OOEA 2GPTA 2O3UA 2PR2A 3AY6A 2PV7A 5EJ2A 1UJMA 3A06A 5FF9A 3WWYA 3Q2KA 1XQ6A 1EE2A 1V8BA 2VHYA 3DL2A 4PRLA 5IN4A 4CV3A 1SC6A 1KEUA 5K6AC 2VNSA 3LQFA 5DBGA 1B8VA 1LDBA 4IS2A 3WX0A 1GYQA 4Y8VA 3G17A 4Q3CA 5CPFA 2FPIA 5DBIA 4E31A 5AXDA 3OECA 3ZHYA 1F12A 5CDSA 4WASA 3FN4A 2J5KA 5ICSA 4RZHA 2WDZA 5JAQA 2IEBA 4E33A 4P8RA 2X22A 4DMMA 2Q3EA 4HNHA 1B16A 2AQKA 2NADA 1Q2XA 1ZK2A 2HUNA 4I1IA 3ADOA 1UP7A 3LT1A 2Y0CA 1UXIA 2C5AA 3W1VA 1NTOA 4JJIA 4RDIA 2B5VA 1QP8A 1CERA 5JC1A 2D4AA 1LC3A 2QX7A 1P9LA 3DZHA 2VYND 4IDBA 3GGOA 4UUNA 3TNLA 2ZB8A 3TWOA 5KOIA 2B83A 1PGOA 1X0VA 4IQ8A 3VAZA 1C1DB 4EJMA 1MXHA 4BNYA 2UUPA 4YACA 4RF4A 4ALIA 4YPOA 2JCXA 3V8BA 3RU7A 3K2EA 3RAJA 2GGSA 3SLGA 4YXFA 3QY9A 4BUCA 1BXZA 4BNKA 1WVGA 2J3HA 2PH5A 1ISMA 2Y99A 1E77A 4J1NA 3WGZA 1QLJA 9LDTA 1VM6A 4A5OA 3E5MA 3K73O 4WLUA 3PHLA 3JQ8A 3HADA 3UAGA 4C4OA 4YAIA 5JAIA 5K0ZA 5U9CA 2YHIB 3EVNA 1KEVA 4WK6A 1EVJA 4LGVA 3UCFA 1AUPA 3DZJA 4QXMA 5T67A 1DIAA 3PTZA 4A27A 2DPGA 3LLVA 1I2CA 4JCOA 3RBXA 5EQFA 3R3SA 2X9NA 1D3AA 3D4NA 4BNMA 3CE6A 4J9VA 3GY0A 3LK7A 2R6JA 3COSA 4CM8B 4F46A 1F0YA 3WICA 2JAPA 1GQ2A 1J4AA 4PLGA 3MOGA 1N92A 4EITA 3B6ZA 1LEHA 1VLLA 2I9PA 4CLHA 4PLPA 4HY3A 3VDRA 4BO4A 1NP3A 3M6IA 3K2BA 1QRRA 4MDHA 1TB4A 3AJRA 2GN9A 1YO6A 4NJMA 4MVJI 3WFIA 4QEDA 4AVYA 4IJUA 2NU9A 5TRTA 3KSUA 4YT4A 4TZTA 1D4FA 4GMFA 2V6FA 1ZUD1 4L9RA 3NTQA 1GTMA 3OQ1A 4CLOA 1KVQA 4QO7A 1ZW1A 4WGGA 4BNHA 1X14A 2UDPA 3T4EA 3A28A 4NIMA 4GQAA 3AU8A 4FPXA 3ULKA 3B1FA 3FRJA 2O3QA 3GFBA 1FF9A 3Q9NA 4B4OA 1HTBA 2JL1A 2HK7A 3OHSX 3OIFA 3LYLA 2D1YA 1XLTA 4HFRA 5KVVA 1A7AA 5JDCA 1IOLA 3ZW9A 4XR4A 1WPQA 5EL0A 4CMKA 4CR6A 3UW3A 4KMSA 1PJCA 4B4WA 2RHCA 1F17A 3PXXA 1Z75A 2GN4A 3GG2A 4YDRA 5DF1A 1XSEA 4CMAA 4L4RA 1NFQA 4J6FA 4NR0A 4JNKA 2JHGA 4OXNA 2JCYA 3GNTA 3OIGA 4KUGA 4J4BA 3PQDA 1LLDA 4Y6SA 3DZKA 4D79A 1P1HA 1PWZA 3BAZA 5DULA 2VZ9A 4RORA 1ADCA 2C07A 3INGA 5AQ1A 3RUAA 4D3SA 3VPHA 3RBZA 4GX5A 1DHRA 1OI7A 2EW8A 1DEHA 4NH4A 3NTRA 4AJ4A 1ADBA 3ONEA 1B0AA 4X54A 4BMNA 2OBYA 3L6DA 1E7YA 3F4LA 3HQ4O 1EFLA 2HLPA 2EGHA 1MFZA 1LRKA 4AJOA 3M1LA 1LSUA 4D45A 1XDWA 4I9UA 3AUUA 4NJMB 3RVDA 1WZEA 1SBYA 3HDQA 2OL4A 1ENPA 4E13A 5C5IA 4B3IA 3GA0A 4LSWA 1VJ1A 1WZIA 1W8DA 3F1KA 1MLDA 5L7WA 1F14A 2D2IA 3PJGA 2Y1CA 3UXYA 3JQ9C 4DIBA 3PHIA 3F5QA 1K3TA 3AI1A 1Q1NA 1R66A 3TOZA 2HAEA 2PZMA 1HDRA 1WDMA 3ZWXA 1N9GA 5DCWA 5GMOA 1O94A 4LW8A 1Z82A 5G2OA 4QT0A 1NQTA 5COQA 3JCZA 1D7OA 1HSOA 5A5FA 1ISFA 1I36A 1Y1PA 1GZ6A 2PD3A 2NTVA 2PNFA 3GOHA 3IOYA 3DAGA 3OMLA 5A1TA 5CG2A 4OJNA 5IG2A 4CM9D 2BGLA 5MGBA 4ITUA 5DOZA 5ES3A 4E0BA 3F3SA 1DBVO 3BMNA 4MKXA 1XA0A 2X0NA 3FNEA 1LLCA 3HB4X 5AXAA 2VYNA 4YTEA 4O5OA 3BIOA 3KHUA 4XYGA 3DR3A 1UZNA 2BKAA 4CM9A 3H9UA 4XQ9A 2V6MA 1LI4A 3NTOA 1QLHA 1ZMOA 4MKRA 4CLOB 2VWHA 1M66A 4F3YA 4FB5A 1PR9A 5L51A 3FHLA 1N5DA 1U7HA 1NQAO 3I9KA 3K31A 2GO1A 3AU9A 2YDXA 4RZIA 2UUOA 3WYCA 3ZU2A 1EVYA 4TRJA 5I9LA 1NASA 1UH5A 1VRWA 3JQFC 1KIFA 4YT5A 1V0JA 1ONOA 5B4VA 3QVXA 2QZ9A 1O95A 1SO8A 2VT3A 1TA4A 3GR6A 3JD4A 4BO1A 2O3TA 4TVOA 4BO9A 1BMDA 3IUSA 5CP8A 3E9QA 5COAA 1Y6JA 1JKFA 4EUHA 4YJFA 3ZHZA 4OXKA 1UAGA 5L4SA 2IDZA 3JD1A 5JS6A 5IDWA 3ETDA 1NYTA 2IZ0A 2Z95A 2HMUA 4DGSA 4FR5A 2WD7B 4BKRA 1D8AA 3GEGA 1T24A 1HDZA 1T2DA 2JHFA 2BFPA 1PQWA 4AJEA 2BLLA 1DO8A 3PHGA 1E7WA 3BMNB 1AHIA 4IMRA 1PWXA 1U2DA 4FC6A 1JQBA 4DYDA 1XKQA 4QFCA 1BW9A 3A9WA 1NPDA 5L53A 2NTJA 2GERA 3RFTA 1XU7A 2YHUA 4K6FA 3MJSA 5T57A 3TN7A 4QTZA 5G4LA 5TT0A 3OBBA 4YCAA 3ZWMA 3CPSA 4OGWA 3ZWOA 3C85A 5G0TA 3G79A 5KNLA 2PZKA 3BTUA 1NFFA 3MJTA 4TWRA 3RUFA 5KJ6A 3OQBA 4CUKA 4XIJA 1ULUA 4N5NA 4RPKA 4YJHB 3TF5A 1D1TA 1GCOA 3X2FA 2I3GA 2XXJA 3GPDG 2O50A 3EVTA 3U49A 4NI5A 1NVGA 1IUKA 3LVFO 2NUAA 5JDCC 5BSEA 5HTOA 1RM5A 2I65A 3DMTC 2HCTA 3IAHA 5DP2A 1QYWA 4IGEA 3QP9A 1XYGA 5ADHA 5U1PA 3PQEA 4ZHSA 2O4UX 2VHXA 4MVJF 3AUTA 4R69A 2OOSA 4ND1A 5F5NA 4OMUA 4M89A 4PLHA 3ZNNA 3PGXA 3GVXA 4O0LA 1YOVA 1VSUA 4E3ZA 2XXBA 2I76A 3EK2A 4R5HA 1I2ZA 1J0XO 3WG9A 4UEJA 3PJEA 4E5NA 5DP1A 2G0TA 4PVCA 1P1RA 1ISGA 2WMDA 3WIEA 5FI3A 4CM7A 4JJFA 5JSFA 2CVQA 3AM4A 4N7RA 4J2OA 5JYDA 1VPDA 1KERA 3VZRA 1XR3A 1BVUA 4O1MA 4CPDA 1BW9B 1N8KA 3N58A 5G4KA 3HDJA 1EUCA 2G17A 4BMVA 2QG4A 4ZICA 1VL0A 1E6WA 4UEOA 2PKQP 2EIHA 4NZ9A 4QX6A 1N1EA 4JN6B 2FP4A 1PZHA 2EJWA 2HJRA 4YRBA 1JWBB 1YL7A 2X0RA 2YDYA 1BRMA 1CRWG 2P2SA 3D3EA 1ULSA 3K96A 1IZ0A 5BT9A 2PTGA 4Q3EA 5B12A 3GNQA 1ZXBA 1SB8A 4FDAA 5C7IO 1A5ZA 2BFAA 3FNGA 3GRPA 1DC4A 2CF6A 3UF0A 3RCBA 1UR5A 4NBVA 4TVBA 3MEQA 4Z0HO 1WNTA 1GY8A 3KYCA 3S1LA 3B1KA 4IS3A 3VKUA 3OJFA 4Z9XA 2Y0EA 1HYGA 3VC7A 3ETEA 1YB4A 3GH3A 3RIHA 3D1LA 1CYDA 1DLJA 3V1TC 4W6ZA 1R0LA 5I9NA 1UUFA 2AW5A 1EE9A 3JD2A 4TRRA 4CR8A 2GZ2A 4XIYA 4QQRA 3I5MA 2CMDA 2I66A 3VHRA 1JDJA 2Q2VA 4WCDA 1Y8RA 1A72A 4XGNA 3V5NA 4LVUA 2ZTUA 3MZ0A 2QYTA 1TXGA 4B79A 3E9MA 2DBRA 4XYLA 4R01A 1M6HA 1FDTA 1R6DA 1K89A 1X7GA 4IXWA 4RF5A 1UAYA 1ZMTA 5F21A 1ZZEA 1ZSNA 4CMEA 2A35A 3OEYA 3LT4A 3JQ9A 5JCJA 1LDMA 1RYEA 1PIWA 5DBFA 1E7MA 1QV7A 2X5JO 4URFA 1R4NB 4OQYA 1NWCA 5DOVA 4MP8A 4AJLA 3JQEA 2X58A 1YB1A 3GEDA 4PLZA 1HLPA 2BF7A 2VWPA 2FR8A 3RUHA 4ZD6A 2EF1A 3ONDA 4LRTB 1UDAA 4ZA2A 3KO8A 3JYQA 2ZJ0A 1YQDA 5A9SB 4MVJE 4PGFA 1PL8A 3KYCB 1LUAA 5G4KB 3UKOA 3WYBA 4OAQA 4C7KA 1NPYA 1B8PA 3L4BC 3VZQA 2ZIZA 1LJ8A 2A94A 2I67A 2UV8A 5JYEA 4J9UE 4DWVA 3SC6A 4AL4A 3FD8A 3JQCA 3RC7A 4Y6PA 3ZV3A 3GUCA 4ZVVA 1RKXA 2BI8A 3NDJA 2ZATA 2GZ3A 4R54A 4FD3A 3H9QA 3BMOA 3KV3O 4G81A 2HRZA 2Q1TA 3P19A 4NFYA 4CM1A 4AJ2A 3DHYA 5CDGA 3RU9A 4FFOA 2J3JA 4GWGA 2H6EA 2F1KA 1HT0A 3H2SA 3NRCA 3AFNA 1U8XX 3LZ6A 1M2WA 3MTGA 1O89A 1V35A 4TSKA 3RUCA 4D7AA 3ZV5A 1P3DA 3WMWA 3HUDA 2PK3A 3JQ7A 4BV9A 3NT2A 2VTDA 1GADO 2ZJ1A 2OBNA 3KSDO 3QSGA 1PZFA 3BHJA 2GZ1A 4D44A 4NJOA 3AWDA 5KJCA 2G76A 3GHHA 2LDBA 2UVDA 2ZB4A 3KEQA 1FDVA 3O4RA 5U4QA 4I5GA 1XIVA 4QUKA 5TJ9A 3V2GA 5ILGA 4DC0A 4BO6A 2D5AA 1Z7BA 1E6UA 2Q1WA 3MOIA 3WXBA 1RM4A 1ZK1A 2BELA 5A9RA 5IDQA 1H2HA 5IDYA 4WCFA 1LU9A 4YR9A 4YT8A 4DLBA 4RV9A 5TX7A 2WWRA 2BI7A 4EJ6A 3SJUA 3W4IA 4J91A 1SPXA 4RPGA 1QYDA 3JQGB 3G49A 4KTTE 4H16A 4CQMD 4B7XA 4UVGA 3IIEA 5L4LA 4WOJA 1E1MA 1E3SA 3WBBA 2B5WA 5HBRA 2Z1NA 5L3ZA 2PD6A 3QVSA 1HEUA 3NX4A 3U4DA 4UAGA 3PZRA 5ENDA 1JA9A 1H9BA 2RH4A 3I9JA 3Q11A 2HKIA 3WS7A 4LK3A 3QW2A 3R3JA 1QV6A 2ZCUA 4GKBA 4Q39A 5BNFA 5EPOA 2NV6A 1Q7GA 3RUDA 4FFLA 3IP1A 1V9LA 1LSSA 3QWAA 5TQVA 3LU1A 2XAAA 4BVAA 1QYCA 2QZZA 4EGFA 2Q50A 1N7GA 1YBVA 2VCYA 4JXKA 4EZBA 2EXXA 1IPFA 3LT0A 4E12A 1EK5A 1GEGA 1MGOA 1ORRA 2GCGA 1Y9EA 3JTMA 3AUSA 3FPLA 4MP6A 1KC3A 1HE4A 2W90A 3BMOB 5G0VA 1X7DA 4E2WA 4M54A 2O4CA 1E3LA 1C0LA 1LBEA 1P1JA 3O38A 4JLWA 1RWBA 1EBUA 1P1IA 3O03A 2E6UX 3ITKA 4BKUA 4ZQBA 1X7HA 1PEDA 3GN2A 1M6WA 3NGXA 5ILOA 5DCYA 1I24A 5I7SA 2GR9A 3JQGA 4GGPA 4YAJA 4K26A 2QRLA 4DLAA 3PVZA 1Y81A 3P2OA 4TKLA 3INRA 4I5FA 1UZLA 3TZKA 3JQFA 2W4QA 3WR5A 2AA3A 2VNAA 3NEPX 1HRDA 4RVFA 4ALKA 1LC0A 2P4QA 1VC2A 2W98A 3I9LA 3KVOA 4YWJA 2I6TA 2FZEA 2JAHA 2DUWA 2CSUA 1PJ2A 3PFWO 3KRTA 4CM8A 3U4IA 4BKPA 5EIOA 1IE3A 4Q3BA 2GLXA 5GZ6A 3ZGYA 4OQZA 2X7HA 1X0XA 3DONA 3C1AA 2XPCA 2PA3A 4A10A 1HWYA 5ITWA 2CNBA 2YJZA 3KLPX 2GRAA 2YV3A 4FS3A 4XD2A 3RD5A 2GASA 3AK4A 5JCXA 2PKRA 4OYRA 2F00A 2FOIA 4II2A 4XA8A 2NVUB 1I10A 3D5TA 3FNHA 2Y68A 3QWFA 4YEDA 1HXHA 5KIAA 3M2PA 1X15A 5KJ1A 3KYDA 4GWKA 1PGJA 1KEWA 4DQXA 4D41A 1PJ3A 4L74A 2P4HX 4II3A 1YDWA 1G6KA 2EP5A 3LC2O 1DXYA 4HXYA 4RF3A 2OMEA 1B3RA 1MC5A 1W6UA 5B4TA 3DTTA 4XQEA 2HMSA 3IJRA 3OICA 4M87A 3HFSA 3K30A 3CINA 2ZTMA 3GT0A 3HHPA 4AFNA 3ZWBA 1R4MB 3RKRA 4MIEA 2JD1A 4S3MA 1YXMA 5JBIA 2A92A 2HK8A 1VKNA 3C8MA 3GZNB 4MOWA 2VTEA 5A5EA 3WGYA 3WFJA 1V3VA 3SLKA 2Y05A 1DRVA 5A4DA 1HSZA 3UVEA 3F1LA 4P4NA 3WTCA 1JVSA 3WGHA 1E7SA 4GBJA 3RWBA 4BV8A 2C2YA 3GDGA 5EN4A 4WEOA 1DSSG 2JFHA 5AXCA 1T1SA 2RAFA 4CV2A 4DREA 1CIVA 4AICA 3LC1O 1NHWA 2WJPA 3DAFA 3QV1A 4S1VA 2FMUA 1I3LA 1A4UA 2HMVA 4RPLA 4WJZA 2NU7A 2YY7A 3D5QA 5HM8A 4NNJA 1Q0HA 1KBZA 3DMTA 4NDNE 3AOGA 1E6EA 3VPFA 2J3KA 3W6ZA 3N74A 5L7TA 2UAGA 3IJPA 1O0SA 2X8LA 3U4CA 3H9GA 3BYZA 3NAQA 4RLHA 2BFMA 1U28A 3O8QA 4XDZA 4Q9NA 4J43A 3BXXA 5J23A 3PLRA 1YH3A 2FHSA 1T4DA 2X9GA 3CXRA 4CV1A 1T2CA 2IXAA 4W82A 4ZRNA 1N1GA 1E1LA 1XG5A 2EEZA 3ZWVA 1BXGA 2DM6A 1ZK4A 3Q1LA 3Q9UA 4U6SA 3ZDFA 1V3TA 3BMCA 2EJVA 3PK0A 3ZU3A 4YYZA 4R16A 4DL9A 3KETA 1CF2O 1TT7A 1EVIA 1OC2A 4XWYA 3ONFA 2R00C 3M2TA 2D8AA 2JCVA 3OJEA 2RHRA 4BO0A 3L4SO 4R9RA 1R4MA 5B1YA 4ILKA 1CDOA 5F1KA 1UXJA 3DMYA 3ZI0A 2DFDA 4G2NA 1FMCA 1KEPA 4XYEA 4AG3A 5JCJD 2YFHA 4TKMA 1GUZA 1WAMA 1F06A 4AJNA 1PQUA 2EWMA 5IZ4A 3S2EA 1EUDA 1XQ1A 4IMPA 2O23A 2IYOA 1OAAA 4JGBA 1I5RA 3HE3A 5HWSA 3PRJA 1PTJA 5FYDA 3U09A 1A9ZA 4J0FA 4R1UA 2IEDA 1U4SA 5JW6A 4OO3A 3I9MA 3RQSA 4P4LA 5GY7A 3TOXA 4G5HA 1HZJA 3WLEA 4DRYA 3BMQB 3U5TA 3I4CA 1NHGA 4MPDA 1DFGA 4B4UA 3K5PA 3ROPA 1KVTA 5IFLA 2IE0A 4M49A 1ZVMA 1E7RA 4TRMA 1Y8RB 4R1SA 1BDBA 3S2GA 4J4TA 1H9AA 1WW8A 1B7GO 5IXYA 3OEWA 1V3UA 2JJYA 2CUKA 1G1AA 4CMJA 3GFGA 2ZKLA 3EZYA 2CDAA 4OKNA 3H5RA 3EY4A 3EHEA 4YJFB 2C29D 3M1AA 3OJ0A 4FFMA 1LRJA 4IQ0A 5T8KC 3PWSA 1I32A 3WQQA 3KOUA 2CZCA 4BO2A 1IL0A 1BTOA 3PIDA 3CUKA 3F5SA 4WEQA 3WTBA 1R4NA 1DB3A 2B0JA 4LCEA 5KKCA 4WOKA 1T2EA 4B7CA 1HZZA 2FN7A 3AM3A 1LDEA 4GH5A 3NJ8A 3HFGA 1E0DA 4RO0A 3ZW8A 1X13A 5KVSA 4IDFA 2PZJA 4OOEA 4PFJA 3S8MA 3DHNA 3EAGA 1P33A 5JO9A 3JQ6A 3WLFA 4YRAA 1NVMB 2FPGA 2JKVA 2NLOA 3GF4A 3HSKA 3JYLA 3Q3CA 3H7AA 4BQRA 2WTBA 2B69A 3AW9A 3O8QB 5JO0A 1Q0QA 2R00A 3OQ6A 4EDFA 4CQMA 2O3JA 4L4XA 4K9DA 1LRLA 1MB4A 2Q2QA 3HZZA 3SEFA 5KTKA 1GYRA 3EGOA 3OA0A 3ZHXA 4XGIA 1EVZA 5JDIC 1EMDA 3ETGA 2DFVA 1YE3A 4PG5A 3T4XA 3WYEA 1QORA 4PRKA 3BMCB 1C3VA 1DOHA 1GV0A 2ZTLA 4HBGA 2QYSA 3JQBA 4CLXA 3C1TA 1IYZA 3KB6A 4J1SA 2HO5A 3DOJA 3GRKA 3WSWA 4BGVA 4XDYA 1K6JA 1CWUA 1W4ZA 4FC7A 4L75A 4PLCA 2OORA 1JAXA 3N7UA 1WMBA 2VWGA 4GMGA 2V6GA 3ASVA 2CDBA 2Q4EA 4CMHA 3WMXA 3TRIA 2ZTVA 4HKTA 1YL6A 3IMFA 5JPIA 3GGPA 4J16A 3HB5X 1QXSA 3MTJA 1YVEI 1HF3A 3PHHA 4RCVA 3H5AA 1TI7A 2X5KO 5TC4A 2HMWA 4KDEA 4K1LA 4NG5A 5A3JA 2YUTA 1P44A 3DBVO 4D42A 4WCFB 3KYBA 1MV8A 1GEEA 2Y67A 3CTMA 4IGFA 4OXYA 3L6EA 4DMLA 3HN2A 4DC1A 4M86A 4OOFA 1B3BA 4CQMB 1XWFA 2HJSA 3ORFA 5G0SA 4E5PA 3X2EA 1NXQA 4W99A 1KVUA 2FWMX 3GZ4A 3UCXA 4GI2A 4RPHA 1X1EA 4JIGA 3I23A 3E18A 3ROMA 1FXSA 3CIFA 1RPNA 5I8WA 5L7YA 1E5LA 3EZLA 4NQZA 1G0OA 4DA9A 2IODA 3ZHBA 1QR6A 4BNFA 3UICA 1SEVA 2Y93A 5DN9A 2RIRA 5DDIP 2Y1GA 3RI3A 1DC6A 4I08A 3IC5A 4PZCA 3OP4A 1PGQA 1E5QA 3W6UA 2X86A 3PJFA 4NK5A 4TROA 3S55A 4BQPA 1V6AA 2OP0A 4BNJA 3I9OA 2VRBA 1BSVA 1CJCA 3QVOA 3PEFA 2PZLA 2ILTA 3T7CA 2FRDA 2YFQA 4U6QA 4IJKA 3JD3A 2X5OA 5AXBA 4GSKA 4WNCA 4XB1A 5GZ1A 2C82A 1DIBA 1R16A 4L8VA 1ENZA 4WLOA 2P5YA 1LDNA 2Q4BA 3DAPA 3RC9A 5MDHA 3OSUA 4ROSA 4MO2A 2OHXA 3INTA 1LTHR 3JQBC 4O6VA 5LC1A 3GK3A 3CKYA 4ONEA 3HNPA 1ZNQO 2Q45A 2RBEA 5KVQA 4CLDA 3Q0EA 1H2BA 2A9FA 4MINA 5CDYA 4W9NA 2O48X 4HNGA 3KBOA 4PCVA 4EUEA 4PG4A 4AJKA 3D4OA 4GPD1 3K8ZA 3ENKA 2HDHA 4ID9A 5JXWA 1PJSA 2YQ4A 1PL7A 4WNIA 4RQTA 1GCUA 3NKLA 1PJTA 2PD4A 2P91A 3I4FA 1QYVA 2HQ1A 7MDHA 3BHMA 3KZVA 2H9IA 4J7CA 4IM7A 4NU6A 3ZU4A 2WYVA 3H3FA 4LCJA 1YBMA 3IUPA 3L0DA 5BR7A 2VOJA 2FR1A 4E2XA 2P9CA 4JX8A 3PLNA 1MX3A 4D3FA 5CG1A 3EDMA 3VTZA 3L9XA 2O2YA 4E5MA 3R6DA 5IAAA 5BNTA 3E03A 1N2SA 3ZN2A 1B2LA 1WP4A 2BGMA 3GQVA 4LISA 4XGKA 3ADPA 4R41A 2ET6A 2Y1DA 1VJTA 3C7AA 4Q3AA 3DFUA 1EUZA 1GDHA 4M55A 4RQUA 4B3JA 4CUZA 1EQUA 1HE3A 5F1PA 3IKTA 5I9MA 4R3NA 1J6UA 5COBA 5DCUA 2OUIA 3I52A 3FWZA 2DTXA 3QRWA 1PU2A 1ZO8A 1U7TA 4FW8A 4Q3DA 4IQGA 4D43A 2NVUA 1ZJZA 1YRLA 4ND5A 4ZQGA 4ALNA 5B4UA 2VT2A 4JK3A 1OC4A 5C37A 3KYDB 1YDEA 4IZHA 4J3FA 1NM5A 4W9NC 3WJ7A 3PZBA 4BGEA 1KY5A 2JFGA 5JFOA 4OH1A 2Y1OA 1J49A 2VHWA 3GVPA 3DZFA 5I8ZA 1ISJA 1K6IA 1I8TA 3JQ7B 4XB2A 4UUOA 3V1UA 4F6LA 5BSHA 4B8WA 4DBZA 4OIMA 4E4YA 1NQOA 4EYEA 3P2YA 5L9AA 3OA2A 2Y66A 3TZQA 1ML3A 3BTOA 2A4KA 3RFVA 1F8GA 2V6BA 3QE3A 3PI7A 2AQ8A 4WCFC 5THQA 5ENVA 4ALLA 1HETA 1P0CA 2NSDA 1GR0A 3RJ9A 2ZB3A 1BWSA 1GPJA 1YL5A 3LF1A 2GF2A 4HP8A 4L76A 4PG7A 1DIRA 1U5AA 2J6IA 4E32A 4FSHA 4GLLA 4BIIA 2CD9A 1GV1A 2W2LA 1ARZA 4XJSA 4JQCA 4KUEA 3RJ5A 4Z6KA 1AGNA 3TZHA 1XEAA 2AEFA 4YB8A 5L95A 1NWHA 3RBVA 1J5PA 2EKQA 3QA9A 4BNGA 2VHVA 2J5RA 2OZPA 3FSRA 2OGUA 5JMPA 1G0NA 4IJWA 3HDHA 3HJAA 4GX2A 3H8VA 3IS3A 2BHLA 3L07A 3ZWAA 2VRCD 4UUPA 5AYVA 4PLTA 1EEHA 1NQ5A 3ICPA 2Z1MA 4KP7A 2GN6A 3E82A 4IPTA 2AXQA 1HDXA 3KLMX 3B20A 5KJEA 1B8UA 3AOEC 4N5LA 5F3RA 2O3RA 1N7HA 1PJLA 2DLDA 1BXGB 1LLQA 1MFPA 3VZSA 2OP1A 4HWKA 4A03A 4U0JA 2Q1UA 4BOYA 3I9NA 1EBFA 4ND2A 5I7VA 1SAYA 2O3SA 3JYOA 1DIGA 4IIUA 1YBAA 3WBFA 3ZCXA 2P9GA 1Y9AA 2GD1O 4TMFA 1H93A 3OJOA 2W2LD 4KDFA 1TLTA 3HG7A 4D0SA 3UGKA 4GGOA 4CV0A 3O26A 1HDOA 4XYBA 5TJHA 3G1TA 3W8EA 3K92A 1L7DA 1ISHA 1K6XA 4PLVA 1PX0A 4BNTA 4LMRA 5T6BA 3MCVA 3ZNQA 1Y8QA 1E3WB 7ADHA 1ENYA 2BD0A 4AJHA 3UHAA 4HX5A 3WDSA 3V1YA 1EQ2A 1O9BA 3BMQA 4C7JA 1GAEO 3WIDA 3JYNA 1AE1A 1ADFA 1VL8A 3G0OA 3VZPA 4FGWA 4BO8A 3HWRA 1BHSA 4EBFA 1CEQA 2EKPA 3GDOA 1FJHA 1FDUA 2DT5A 4ZU3A 3SC4A 2NVBA 1KC1A 4P38A 3VOSA 2BGKA 1ZIDA 3DO5A 5TNXA 4W4TA 1KY4A 1K2WA 4O59O
chains in the Genus database with same CATH superfamily
5EEGA 3E1GA 2RBKA 4M1SA 4OK6A 2OG2A 2LBPA 4HDQB 4KAAA 5AM4A 3A6LA 3PDWA 1VG8A 2WI8A 1U8UA 1LNQA 4GL4A 3GVHA 3K16A 2NZUG 4ZVPA 4UM7A 4MV4A 3ENNA 4L5IA 3RTBA 3MAAC 2QX9A 3DZIA 2E6KA 2CLOB 1PFKA 4EMSA 4DA4A 2E82A 5HKAA 4M0FA 4Z0PA 4MS3A 3PS9A 1YA6A 4W5NA 4PSUA 4EHHA 2G9ZA 3PF9A 4KQMA 2WOOA 3IODA 1W73A 5PGMA 4FVTA 3B6IA 5H8WA 3EZ7A 5HRAA 1Z2PX 3ZI4A 3QU4A 3LA6A 3N0TA 1NRWA 1ZBQA 1AXEA 1FTSA 3FYUA 3NDPA 3MRXA 4CLEA 3TNYA 4HO1X 3ZQKA 3GDFA 3DXXA 3EEOA 1G3IA 4MDFA 4JHXA 4FHZA 4KQ9A 1N3BA 5CYFA 4BNVA 3MRVA 1M2OB 3AF2A 3UCEA 1FZQA 1Y42X 4MR7B 3BBPA 3GEIA 1ZD9A 1MOQA 1A3CA 1GU7A 2JZOA 1U7XA 1KP2A 4TMZA 5BSUA 4IQ4A 5HG0A 1RJ9B 3IMEA 5AK3A 5I4CA 5KWSA 1VL5A 1GYPA 4DR7B 4CT4B 4EW1A 3DOOA 2ODPA 1SKYE 3P0HA 4OQQA 3RDPA 3IP9A 4LK2A 1Y5RA 1SXJA 3GP3A 4D80A 1CJUC 2JS7A 1NMSA 2WNIA 4JU8A 1FYEA 1PG5A 3OIUA 1ZHOA 2IU6A 2B8JA 5BV7A 2A78A 2FK8A 4G5GA 4NEHB 2XQKA 4O4HB 5K09A 1SCDA 4UDXX 3QVKA 3M6LA 4IGIA 4QECA 4S12A 4MW7A 2GF0A 2CZQA 2JIZD 4MR9B 1BEEA 1OGIA 2FE4A 3FMPB 1XD2A 4JP3A 4ZVSA 5LWHA 1VSVA 4V0QA 3UG6A 3W8NA 3EJWA 4QYWA 1QM5A 5EPUA 5CCBA 3TH5A 5LD2B 3Q5GA 4CMIA 2PYIA 2ENWA 1WMAA 2D0IA 4GZ3A 4GSLA 5I4IA 5IZCA 5IP5A 3GMSA 1R0ZA 4KQWA 4O02B 4JJ4A 5K8JB 4R05A 2GAAA 2NXCA 2SECE 4G26A 3HJFA 4P82A 1Y8QB 4LSGA 2HIHA 1V3QE 3K6JA 3FZNA 3LBIA 3Q8KA 3AHHA 5LB4A 1ZLYA 2CUTA 1CUIA 3P5SA 1T5LA 1KSJA 3PNVA 3AFMA 4ND4A 1IVSA 4IO1A 1QC5A 3ESCA 2J4DA 2WSYB 1TADA 4D4HA 2VYVD 3N05A 1OGYA 1W2GA 3MWDA 1K3UB 5JVDB 2QM8A 1HE2A 4PGMA 4CDMA 3FYCA 1KQ3A 2YN0A 4KXXA 1ZJ4A 4FN5A 3VDQA 4BX3A 4C2BA 4D3XA 3W5DA 4E1VA 3C5HA 1D1SA 2RONA 3VZCA 1JZQA 5IABA 3LT2A 2CC2A 3I01A 5HE8A 5J9FA 4MUNA 3M4JA 1Z0UA 3Q4GA 5K9ZA 1JECA 5F3WB 5A4AA 1R4ZA 1XEFA 2IXEA 1PR3A 1I5EA 1LW6E 1VYUA 4K8RB 5I7FA 3WGTA 4D26A 1O6BA 1JLHA 2P90A 4RY2A 3KEMA 1OX5A 1Z74A 1H94A 1WCV1 1JJIA 4OHWA 4DANA 1CZUA 3QF4B 4A7PA 5TGDA 2XJ4A 2PMFA 3L7JA 4EJ2A 4KREA 4OXXA 4OV6B 4LOIA 1BGVA 1MTZA 5THKA 3X1WA 4D46A 4JMLA 1K5HA 4O4HA 4N9QA 4YAFA 1CQZA 4U9UA 4ZREA 1E9SA 2XVYA 3GPIA 5GJVC 4AMVA 3E1KA 1H3EA 2E3JA 3HO6A 1SBQA 3IR5A 1J21A 3EEQA 1E1RA 3ETJA 2ZAIA 3QLJA 5D7BA 4TKVB 1CD5A 5LDGA 3RARA 3T7DA 1N9KA 4KYTA 1T4MA 4QGAA 1J99A 4GHWA 2VSNA 5AIBA 3WWPA 4INOA 5HOEA 2X0FA 3LECA 1XCMA 3AEQA 3K4HA 2Y1LA 1VHDA 5EZQA 1MO4A 2VKQA 1WDKA 4CDRA 3MJVA 2JF0A 1A77A 3ABIA 2H2DA 4GC9A 2DHCA 3IE0A 4N18A 5IAJA 4BCDA 4C01A 3O7WA 1UCFA 2AK2A 2DXIA 2Q62A 5FNZA 1NSTA 4MR7A 2CXOA 3W8FA 5A7FA 1A8HA 3VC1A 6PFKA 1KAOA 4I5EA 1ACMA 5JARA 1HNNA 1G5TA 2KW5A 5C7YA 4UC0A 5FULA 5JCOA 3ZLVA 3SX2A 3SQNA 1Z5WA 4LYDA 1L8QA 8ADHA 2PN1A 2QTNA 4XRRA 2YC2C 2ZE8A 1NUPA 5J1TB 4BNWA 5JMWA 1A9OA 2V7BA 3MWDB 4ZOLA 5J40A 5SYMA 2HU2A 3CWCA 3D7MA 3WGNA 2HWWA 1JIIA 3TFOA 2GILA 2ZI4A 4EG6A 4YPFA 3AUAA 2QUZA 5EP2A 3WLOA 5JJLA 2LGJA 2O19A 3E58A 4YMIA 5A04A 2AF4C 2CFCA 2JGKA 2QPAA 1JEDA 3KXKA 1DNPA 4RWZA 5FL7A 2O07A 5TEWA 5A4IS 1MC4A 1SRRA 2JAUA 3OO0A 4XKJA 3QG1A 2Q0XA 2W7TA 3VVBA 3AW8A 2E48A 2OBMA 2VPIA 2YOHA 3AL3A 3HJTA 1Y5MA 1KOGA 1ZR4A 2JFFA 4K88A 5EWMB 5LP1A 3BRWA 1TNDA 4MYSA 4AN4A 4HLQB 1CJTC 2A7QA 4QARA 2QD1A 4D8VA 1ORIA 2VPYA 3WOHA 1W0JA 4MAAA 1QG0A 4LHXA 4CT0A 2LWIA 5HRUA 1N2GA 1ZCJA 1JLLB 3A2LA 3DBLB 5A6SB 4KOAA 2BFWA 2C8LA 3EMKA 3V9PA 3ZDDA 1XVAA 3NKFA 3BGSA 3WLTA 4DJJA 4KZPA 1U11A 1D0VA 3MRTA 4PLYA 3WYGA 1H3FA 3VR4H 3DD1A 1TM5E 4I1RA 3BX1A 3W78A 1NU8A 1ONNA 1T8TA 2IL1A 4JUIA 4E2FA 4OHYA 2ATIA 2FPPB 4B3FX 1D2AA 1GL7A 1RU3A 5JVDA 5ESWA 2IZ1A 1HDGO 4RQAA 4YBZA 3L4EA 4C0SA 3AY7A 4IINA 1L8XA 3KJNA 3ZS8A 5HYVA 5IAGA 1SU6A 4DXDA 3MTIA 1A9RA 3AB7A 3LC7O 3HRHA 3LQYA 3PPXA 1XVTA 4AJJA 5C1OA 1EXWA 3SY8A 4UM9D 1XQXA 1AT1A 4RDHA 3GRRA 3RRZA 4EGQA 4O08A 4WZAA 4Y6LA 1A7JA 3RV3A 4GE3A 3AYXB 1SKYB 4G1VA 2FMFA 4DR2B 3ILXA 3LX6A 3MWFA 3AVYA 2B2CA 5DISB 5CDTA 2O8BB 2A30A 5A02A 4AS1A 1E2HA 4E88A 5C3MA 3QE9Y 2OTCA 4HJRA 1XTUA 2PANA 4BV3A 2FUKA 1WUKS 2OMKA 3EC7A 1BFUA 1Z5ZA 2G83A 5K6AA 2W4MA 4LUCA 4R7GA 4ZPXA 3BXPA 3C5CA 2ZT5A 4F2GA 4IXMA 4G65A 1S02A 3HS3A 3I6IA 4NYMQ 1FPMA 3TINA 3KELA 1ZSYA 2AKYA 3I83A 3P96A 4CJXA 1J09A 4LMPA 4UZFA 4ETWA 4ANFA 3QITA 2P62A 2WJGA 1KAMA 4N5MA 4PYNA 5DNWA 1HE5A 4BNXA 5IFKA 2WRZA 4GLBA 4V1CB 1H6BA 3H6HA 4CEIB 2PHZA 1XKXA 4WINA 4OMFG 2DSNA 3IO5A 4MQ5A 5A6VA 3S6JA 1A9SA 4I14A 3TFWA 3FG9A 4FHCA 2AG6A 3L0PA 5TC4A 1A5BB 2EHDA 5FOWA 4BFXA 3JYPA 1VCMA 3DB1A 4CMBA 4QAQA 3ZWDA 5EUQB 5FWXA 5EJEA 3CNLA 4YAKA 1J2UA 1C1XA 1UDCA 2EOAA 2X8JA 3BHIA 4PLFA 4I81A 4DA7A 3VH1A 1AK2A 3R09A 1P73A 2MYTA 1FU4A 3R0JA 3TW8B 4TZKA 3JZFA 3E7XA 2XCOA 4FOSA 1E2EA 3U62A 3N39C 1Y8CA 1KETA 5JVDF 3OZTA 3NHSA 1KQOA 2ALJA 1YKGA 4IOLA 5H1YA 1Z88A 3E6AA 3KJZA 4YJGB 3NDRA 2J8ZA 4ZJUA 3VFDA 3AP1A 3TJRA 3ZVLA 4UMFA 1BXKA 2NACA 5EIHA 4DTIA 3SQMA 4JQSA 4WE3A 5IMSA 3JSXA 3LRXA 4KNVA 1NUSA 4DQ0A 2N1MA 3S81A 2VUSA 1ORDA 1WLYA 3CV3A 4XGQA 5IW8A 4QFDA 1FFCA 4OLBA 1FTNA 5A3RA 4PQGA 4YVFA 1CETA 3SIWA 2JVJA 3FYSA 1NOKA 2ZE6A 4M1YA 4X1YB 1DC5A 3UT6A 4AUEA 3C8ZA 4EY4A 1I0ZA 2KLBA 5BVGA 4G2TA 1RQNA 4QGBA 4UE6A 3DJYA 5DSXA 3V1NA 1VYVA 4EO9A 1EFDN 1LQTA 2VUUA 4PZAA 6GPBA 1BU5A 4F56A 1W0KD 3I8XA 3TDKA 4DIKA 2X40A 5IZCC 4HH3C 2G5CA 3FZGA 4V0ME 2PZAA 4C0AC 3O4JA 3T9FA 3L6RA 4WX2B 4FJ1A 1T5HX 3RC2A 2BGTA 2FN8A 1DCFA 1FPQA 3K9FC 2XCSB 4LYFA 3R5TA 1KO5A 2OEPA 4TN1A 1EFCA 4JI4B 1JQDA 4E21A 3HGTA 1PSZA 2A0KA 1C3OB 2WA1A 4OJKA 4X71A 4L85A 4BGUA 3I2JA 1T25A 2RE8A 1TCVA 2UYHA 3G1WA 1Z8FA 2QSYA 4UZSA 3TOSA 2DTDA 3DQPA 1ENOA 4QFMA 1L5RA 1G8MA 4C1BA 3W5AA 2OV4A 1U3UA 1QYXA 1UMCA 2YXDA 3GLQA 4D4IA 1PE0A 3DPIA 3SJCA 1KFCB 1Z2EA 1I01A 2VYVA 3A1NA 3OETA 4G56A 3UB4A 5KTMA 5JALA 4S1TA 4C14A 4YREA 3H4TA 1C4XA 3CX8A 4BQSA 5KWEA 1ZC4A 3DOEA 3NWOA 4BLQA 4CR7A 1EFRD 1KI9A 2R7KA 4AYTA 4TLDA 1ZGJA 1GFSA 4U0KA 4WV3A 3E61A 5FUBA 4NBWA 4QT4A 3Q2OA 4F5WA 2XMGA 1KH3A 1WB9A 4ZQEA 2PMKA 1XMVA 2CL0X 2FFJA 2CKDA 3KOXA 5ER6A 3SHVA 5TSDA 1YQWA 4PONA 1QKIA 1PD0A 4PX5A 4R8KA 1JJVA 1EJ6A 3KFVA 1XZNA 5AI5A 3C74A 4DLKA 4IDGA 3KCNA 2P67A 5DW0A 3IUMA 4OUDA 2NMVA 1RHKA 2WTNA 4O4JB 1IAQA 2YKGA 3LM8A 2EQAA 2ACEA 4EB8A 4ZYVA 1FU8A 1JFFA 4MI3A 4BX8A 2VTVA 4AUNA 1Z36A 1SXJC 4WDRA 4TXJA 5B57C 1GZDA 2VXBA 2K4MA 4FILA 1GFWA 4CMEC 3AF5A 4L8WB 1IHYA 2FZLA 5AI4A 4ND3A 3WWZA 1LCIA 1SC4A 3QVWA 5REQA 2M6KA 1JVBA 2QI9C 1F0KA 1EG2A 1E3IA 2EZUA 2I1WA 3F96A 4P86A 2I2DA 4U2CA 4YK7A 4JYZA 1QG6A 4L9SA 2FGKA 4YMHA 3DHEA 2REXB 3P97A 5KYYA 3VSCA 4Y67A 2XT6A 3TL3A 4PTLA 5AK4A 4KITB 4KR2A 1M3SA 2FPKA 1VI6A 3EUAA 2FSGA 3NKLA 3DBRB 3C4VA 5I4BA 4MVJA 1G7RA 5F4BA 5HDQA 3TFQA 2HRBA 3P0JA 2WTMA 2XQFA 2AQIA 2B37A 2D06A 2VQ3A 3JQAA 2MYUA 3FOBA 1MW8X 1PWEA 4R3WA 5AW7A 4C2UA 3LCCA 2H1VA 4MVJD 3QPBA 1UZMA 3ONNA 4FFPA 4TQUS 2BGIA 1XALA 4EA8A 5I47A 3NGLA 4YMUA 1COWD 1QONA 1J9ZA 3T3OA 2EQBA 4O0MA 2PRSA 2PWZA 3TQSA 3TIFA 4E6PA 2Y76A 1B4DA 2XA9A 1FFAA 3DYBA 3KAKA 3PHCA 4N39A 3ZX4A 2OSVA 3IHLA 1JYFA 1NBHA 2CD7A 5F78A 3R24A 3URMA 2I6GA 4R8VA 4XM0A 2O2HA 4QJ5A 4GGMX 3KJFA 2ODQA 3TTSA 2CUNA 2P9EA 4CUJA 4L4SA 4K28A 3HVRA 1PJBA 3CRRA 2VCEA 5DNEA 2P9HA 2W58A 3EWNA 3WL4A 1JR6A 1WQ3A 1R12A 4IUDS 3WQRA 3AWIA 1RQ7A 1E4OA 3D8TA 1N7JA 2F7SA 3UK2A 2ZPUA 3K0HA 3TKYA 4L4ZA 4OPMA 4YP1A 4K40A 3TSZA 5D3KA 2XODA 1NAHA 3LWZA 3DTYA 5E6SA 4KCGA 1FX0B 4H4CA 4JJEA 5F33A 3OCUA 1DAFA 2NUPB 2ZAGA 5IPFA 2IY9A 2ASVA 2KJQA 2WZBA 1F48A 3OX1A 4FZ5A 1TYEB 2NTNA 1ZRMA 2VDJA 2NTEA 1H65A 2YV2A 3N0XA 1Z15A 2BEWB 4X6LA 3RFCA 3RKSA 3EUWA 4DEXA 2EV9A 2BR5A 2EP7A 5GWXA 1IHXA 4BHTA 2IS1A 3ANLA 3BWBA 1G7SA 2XDQB 4BQNA 3BHNA 4KXQA 4Z7QB 5G0WA 1A8UA 2HFKA 5AJTA 1DAOA 2JH8A 3W4JA 3VA7A 2NXNA 1D2CA 1JHMA 3BWEA 1Z26A 2BFDB 2YVAA 4JVNA 4LZNA 4B32A 1Z5OA 1KP9A 1GPBA 1RAEA 2EZ4A 3CO0S 1VI2A 1MN6A 1XZLA 1FY2A 4DB4A 4OQMA 4Z0TA 2Y1EA 4BO7A 4CDNA 4Z1MD 1XDSA 5ICMA 1PDVA 1YIOA 2R87A 1JLKA 1O6ZA 1SCUB 1SOVA 4RH1A 4EQ6A 2MMGA 3M89A 2P79A 4ZAGA 2NSLA 4B7ZA 2OB1A 2PGJA 1QCCA 3W5IA 4UBJA 5EC8A 1XZJA 2ETXA 6LDHA 4U9IS 5H4HA 4NONA 4BZWA 2B1RA 2F64A 3F4BA 1XUOA 4EI8A 3IB6A 5AM1A 4PZZA 2NXWA 3PE6A 3BGIA 3FX2A 1GZHB 1NR7A 3ZY6A 2VPZA 2BKLA 3QKUA 3ET4A 1H5QA 2ZU6A 3D6MA 1QWOA 1SZJG 3CMMA 4IOMA 4YASA 4C0WA 4DS3A 5I7WA 2HU7A 2PKQO 5BSGA 5LMCA 3L8GA 1RQXA 4R6WA 2C5EA 1H42A 2GKOA 4Y98A 3LX8A 4A2PA 1R0WA 3R0XA 4HN4B 4M3NA 4LFAB 1IUPA 1CC1S 1G8JA 5E9AA 1RP1A 4UVEA 3SK0A 4JWKA 2P6MA 2Q8NA 4MQFB 4BMCA 2NNLD 2OO5A 1JTVA 3SF8A 3G3EA 4KACA 3IQZA 5A71A 2FW1A 4RZXA 1G2IA 4CI0B 2XOXA 1J70A 1M2KA 2JIQA 2G7MC 4MVJH 3LHIA 3QU5A 4MVJG 4WESA 4BASA 1ADGA 2C5BA 3IJ5A 5EJ7A 3RYFA 2TMGA 3AI3A 1UWKA 4V02A 3PVSA 2PY6A 3V4SA 5DNUA 2HX1A 4RABA 1L2TA 5DM2A 3S3TA 4EI9A 3J80A 2PBRA 2REQB 2JLBA 4HX9A 1W87A 2YZMA 2WEKA 4KQ1A 4N3AA 4UCXA 4RFVA 4CM4B 3QJ5A 5AVZA 4Q00A 1TRKA 2WV9A 3GUYA 3FNIA 3AB3A 4MKHA 3AEZA 4BWFB 1FFBA 1MB0A 1J42A 4OQLA 3R0ZA 4UHHA 3ZVMA 4RVGA 1T9CA 1Z4OA 4FEGA 1D2NA 2XT0A 3T9DA 5KOJB 2ZYIA 4IH9A 1E3JA 3PHJA 5CGQB 3QPCA 2Z6QA 4OK5A 3RE1A 1AMUA 5CEEA 3VV3A 1I2DA 3EVGA 2PT6A 1IDN1 2NU6A 4FYPA 2JHAA 3KAPA 1B6RA 4YMVA 4Y0AA 2XBUA 1BMTA 2DBQA 1T35A 1T34A 3CH6A 4IW3B 1IEXA 1ZISA 3WL5A 1C14A 4RTRA 3WGIA 1YDFA 5HGJA 1J90A 4KPYA 3B2EA 5JT1A 2HY7A 1MEOA 1N9GB 3CS3A 1WUHS 3I5AA 4JEIA 4G5FA 5BV1A 3WC4A 4MUBA 3BCRA 2HA5A 2P40A 4L5AA 5C8YF 5JPDA 2GQ0A 3S8YA 4BBAA 2FX3A 4KVAA 4C0BA 1DQYA 2B4TO 1TKAA 1UM9B 2HWYA 3B6EA 4HDNB 3IXMA 4JSRA 4YNBA 3VTAA 1SU4A 1R3UA 4EF4A 2OCLA 1ZIOA 2CMKA 4AS3A 3ZDAA 3OZWA 4JJGA 1PEYA 5F5LA 3BCSA 2H7XA 2R8PA 4PSDA 1RNLA 1XDGA 2ZVDA 2XCRB 3GEEA 3SAJA 3CY6A 1PI3A 3IVGA 5A3QA 3FTQA 3K1YA 1E89A 4MIOA 2J9FB 3IV9A 3Q98A 4UFNA 4IKEA 1Y1TA 3AG5A 1MG0A 1XI2A 1SUEA 4DQVA 2QBYB 4A2CA 1KIAA 1KMNA 1SXJB 1MX9A 1US8B 3FI0A 4ZQCB 4M9QA 4LRWA 1DG1G 1A9XA 1JXQA 5DCLA 3BZUA 4BO3A 1OIXA 4LVCA 4J4HA 2OXCA 3IIKA 5TR9A 1ADJA 1SHTX 3DWFA 4P7JA 1RRKA 3FJOA 2C61A 1BZYA 4X7MA 5FIUA 3FF4A 1KZ4A 2VZEA 1HGXA 4EW6A 3TLKA 1OZAA 1F2UB 1B41A 2GZDA 4FLFA 3R0IA 4QASA 4YQEA 2FZVA 1SB9A 1T6YA 4Q16A 2ZXFA 4BVEA 2WWVD 2J41A 3LGSA 4L0QA 4RWEA 4LBYA 2PX8A 3ZJ5A 4QVGA 2CJWB 5K4GA 1WZUA 4OM8A 5IYZF 3REQB 2NW6A 2XV1A 5CHEA 1JR4A 2CJYA 2IIPA 4N0QA 2Q49A 1NN1A 3KNZA 1GA6A 2QLNA 3CZQA 2QQEA 5FL3A 3ZE6A 4GX1A 2AS0A 2ZZMA 2CJXA 2IXTA 1KGSA 4G0ZA 4L0DA 4REQA 1Z9BA 1ZNWA 2A1TR 4PBRA 4BNUA 4YI3A 2WPDA 5B30A 3U2QA 2SCUA 2C2WA 2R2GA 1P1BA 2VUTA 4LQCA 1RWKA 4UVIA 4O4JF 2AGVA 2E4YA 5FL7D 4CKWA 3P71T 3FWNA 1GQYA 3CWZA 3FBWA 2ZRHA 4KXVA 3ODGA 4ISCA 2V0CA 5F2NA 4RHCA 1H8HA 4JSTA 3O83A 4P84A 1N5RA 4HGYA 2PUEA 3DKIA 4ZK6A 2HWXA 3ON5A 1BMFD 1I30A 4DF3A 5DWDA 4C3ZA 3FOZA 3HACA 3QWIA 1GPUA 1TAQA 2EP8A 3WK6A 4OHZA 2AL7A 5FWNA 1Q83A 3GJ7A 4RXUA 5UKDA 1D0IA 1JN0A 5JFGA 1ODCA 4FYYA 2UUAB 2Q2OA 3OQIB 4JU9A 4L57A 2BKUA 1YI8A 3FMGA 4D4MA 4DPLA 5LOVB 4OBWA 3GQBB 1AF4A 1I7QB 2JBAA 4WJKB 2G36A 5TMDA 3AKDA 3QF4A 3NKVA 1F6BA 2Q4TA 2V4UA 1N6IA 3LDFA 3B8HA 4HB4A 4EQZA 1OA1A 1CYEA 1XTKA 2X1HA 3PFKA 4YMWA 1ZSVA 4GKVA 4B75A 1RXYA 4QO8A 1CUCA 4R9VA 4Y2SA 5E7JA 2VPTA 5CMLA 3AESB 4WECA 3C7KA 1G1MA 2C78A 4CFYA 4TZ0A 3OFSA 3G02A 1ZD5A 3N2NA 4IDCA 4FGSA 4LDJA 2GUWA 4AZWA 2JD0A 1DU4A 2VZ8A 3CX7A 4DLSA 4OHPA 2PKCA 2H85A 1L7XA 3F90A 1HFJA 1AQ6A 2WIGA 3U9LA 5A5DA 1C7ZA 1IY8A 2XZOA 1GNRA 4CQLB 1Y0BA 1VSQA 4FMCF 4PR3A 5E8RA 4KRXA 4BNNA 1QGZA 3M33A 3NTXA 3H8WA 3SVTA 4FEYA 2QD5A 2Z43A 3GVCA 4CU2A 4DBVO 2YJNA 2GNAA 4NICA 5E38A 3VH2A 1HNXB 2E37A 1AM4D 3AI2A 4KIUA 5KSYA 2YYYA 3ICCA 1NI5A 1UMBB 2WW8A 3EGDA 3LUAA 4I1UA 2R7MA 5IM4A 5KTRA 4KN5A 4IIJB 2PUAA 1XNJA 3E9EA 2PGLA 3M34A 5B1SA 4XJXA 3HZOA 3WK8A 2CT8A 4XCXA 1MH1A 4HN2A 3ME5A 2CDNA 1RQ2A 4JBGA 3DV9A 4HNQA 4C07A 2O1SA 4ENRA 1TIPA 1MA0A 1T8SA 4YJDA 4R68A 1BXRA 1T8UA 2YWFA 4W5WA 3L4BA 1F2UA 2HHLA 4KO4S 2W6MA 1XRMA 2RKWA 3OG9A 4KBYA 5KPJA 2VTBB 4BLOA 3GL9A 4HDOB 3FW1A 2PR2A 1R50A 1G4HA 3LK6A 2XCLA 4PSCA 1E1CB 1OXTA 4R6XA 4G8CA 2B8TA 5EJ2A 4ZT4A 4PQFA 1XCGB 4OUDB 5CW1A 2JLVA 2LNDA 3UJ3X 4X00A 3SHTA 1DAMA 1VL1A 3DL2A 1W35A 1FDOA 2Z2KA 2AFIB 5DTQA 1LDBA 3WX0A 4LZOA 3Q1KA 4Y8VA 1NY5A 1JS1X 1S8NA 2ODEA 5CPFA 5DBIA 5FV7A 4H7IA 5AVXA 4L4UA 5HK9A 1F12A 1T6ZA 5CDSA 2WWFA 1P2BA 3VUFA 1XPRA 2J5KA 4ZVLA 2J48A 2WDZA 2QTLA 3DE3X 5JAQA 3UTCA 3HLKA 2SKCA 4E33A 4MYCA 2VRNA 3Q9LA 4HNHA 1B1CA 2Q21A 4GDMA 3QLUC 5FDFA 2JFQA 1PR0A 3AL2A 1Q2XA 2FJUA 2FN3A 1ZK2A 2J46A 1TJ3A 1N5LA 2HUNA 1RS0A 3JWPA 2BZ1A 4I46A 2AOUA 4M2LA 5JWRA 2C5AA 1RAAA 4JVLA 1XA4A 1NTOA 1QG2A 4RY8A 4TKUB 4G36A 1ZQ9A 1IEQA 2WPNA 1LC3A 3DZHA 1P9LA 4C20A 4JASB 4R8RA 4UUNA 4A8TA 3TNLA 5KOIA 5JD6A 3THWA 4RJ2A 3CGWA 4BZXA 4UNIA 1PGOA 4IQ8A 3VAZA 2QVYX 2P75A 2JIOA 1MXHA 3CEMA 4GLJA 1KQNA 5CITA 4RF4A 4YCSA 4YCCA 4GYYA 1QTRA 3KVNA 1XEWX 3MCAA 4NLLA 4CU5A 4UXIA 4G5OA 1CUXA 2HFJA 3QIAA 2CVPA 1ML4A 2OT3B 4LOAA 2PH5A 4I4IA 1ZGZA 4HRYA 1FMJA 1N7IA 2VAPA 2XEXA 3WGZA 1IEWA 1WEHA 5E4YA 5D3ZA 3IXLA 5J2TF 4DCJA 1QQ5A 2A14A 1LPNA 4C05A 2WB4A 3FE2A 1VKRA 4QDUA 2AFVA 3NC0C 3W9UA 5CA1B 2YHBA 3JQ8A 3PHLA 4LF4B 4KR6A 3HADA 4E6EA 1L3CA 5JAIA 1RI4A 5E6SB 3O8BA 4DWWA 4HG2A 5K8UA 1EVJA 1QIHA 4WW0A 5A7HA 1V1MA 1XTVA 1W9MA 4DV5B 4H1HA 1L5ZA 4JLJA 2H08A 2H5IA 4A27A 4DDWA 4ZRDA 1XJCA 3WHPA 3FDXA 1IG3A 3R3SA 1BDIA 1D3AA 2WOJA 4BNMA 4MA5A 4J9VA 4D99A 1Q0TA 5ALFA 4OBEA 5CH5A 1XN4A 3DCJA 2PCJA 4FLEA 2HRCA 4J0JA 1WUYA 1YKSA 4WWHA 2XKAA 1J4AA 4BQOA 2ACVA 4V1CI 1EJBA 2DJ5A 1R8JA 1T3HA 3TCKA 3ZKWA 3KPYA 1OBOA 3EXG1 1LEHA 1F4LA 2FSVC 2I9PA 3GXOA 4BBZA 1NLZA 4PLPA 4CLHA 5C8VA 2GJ4A 1NP3A 3TR0A 2XZLA 3FFAA 4LJLA 2LTAA 4KPGA 4EG7A 2GN9A 3MHTA 1ETHA 4IJUA 1VRVA 3BXZA 2NU9A 4TZTA 2W6IA 1T8PA 2YW2A 1UKBA 2V0NA 5SZJA 3WRWA 2DLCX 1FSPA 2V6FA 4HUQA 2HEGA 1L4EA 1BNCA 1T2VA 1L6IA 3ZEAA 1M5TA 4J94A 3QU9A 5FFMA 2BFEB 1ND5A 4QO7A 4ZDIA 4R98A 4BNHA 1E1RD 3PQ4A 2QE6A 5B3JC 2UYCA 3T4EA 3C6BA 5B58C 3AIMA 4JLKA 3ULKA 4M0KA 3K8YA 2BOVA 3GUVA 2P4UA 3Q9NA 1UJNA 4BP9A 5FOUA 4FZVA 1QAQA 2HMYB 1ZCAA 4NXNB 2DOKA 1SOMA 1OREA 1MNQA 1YRWA 2INGX 2YV5A 1IBSA 1HL7A 3LG2A 2WZCA 3LY9A 4EVIA 1F60A 5KVVA 1C80A 1ZNYA 1T43A 5C46F 3CVUA 2XMCA 4LY9A 4EJSB 3FCCA 5D85A 2RHCA 3TW4A 1Z75A 3GG2A 3GW8A 4QYIB 1GNQA 2HL6A 2G09A 2PS0A 4YDRA 5DF1A 4CMAA 4NR0A 4LRYA 4YP9A 3OQOA 3V42A 4F12A 2IP1A 2DPYA 3BRSA 3IT0A 5HUHA 4RHYA 1Z2CA 1YZNA 2K6GA 5HVNA 1NG9A 1YFLA 1A69A 1O9HA 4HB0A 3PQDA 4PPYA 5KYUA 2F3QA 3LUJA 2HJVA 2VC2B 1IM5A 3FFXA 2JFUA 3QQ5A 3INGA 4RORA 3EIHA 4H2DA 3EARA 2VJOA 4HATA 2H07A 4GX5A 3S2ZA 4OX9B 1OI7A 4GPIB 3NTRA 2E89A 3SX4A 2QE7A 2QPOA 1DKNA 5SZIA 1B0AA 2C84A 2CWDA 2E4VA 4FBLA 5DBOA 3ZZ1A 3F4LA 1EFLA 3G2HA 4G1BA 2EGHA 1ODKA 4V0OA 4DV1B 1MORA 1LSUA 3THOA 3RVDA 2GSWA 2A7XA 4R2HA 4ZI5A 4E22A 3CZAA 2RIPA 3PNLA 2OL4A 1E3TA 2LE0A 4EF5A 3OZCA 3GA0A 1QKJA 1VJ1A 4LHVA 3F1KA 2QTWB 1PQYA 3VJMA 4FYMA 1YS1X 1JX6A 3UK6A 3WGLA 4D9KA 4WZBA 4N7JA 2LXNA 4HK4A 3ROXA 5HP4A 3P2IA 5CLIA 3AFHA 3EOBI 5CGZA 3F5QA 5EI5A 3O31A 3IAS1 4JYPA 5CFLA 2XMPA 3TOZA 1Q0SA 3I0NA 2P9FA 3ZWXA 4QJIA 3DAYA 3OU2A 3B52X 4JUFA 2J0UA 1WV0A 2ZM6B 2WMNB 1Z82A 4Q4HA 5G2OA 1LVUA 4QT0A 1VG1A 2FPRA 3ETCA 4BKMA 4W9RA 2HBYA 1UM9A 3OLYA 2C95A 4HDNA 5A5FA 3KQTA 1SUBA 1OFUX 4QLBA 1DIOB 1P4RA 621PA 1VZ3A 2PNFA 5A1TA 1R8SA 5LYJB 1O6GA 4OJNA 1SFRA 1U3FA 3GJ3A 1N8SA 1YGPA 1QJCA 2JFBA 3U3MA 3V55A 1AA6A 4KFCA 5AIAA 1WHTA 3HJHA 3VNSA 3OM0A 4CKBB 3F3SA 1DBVO 3BMNA 1EA7A 2LIVA 1XA0A 2XMSA 1AGXA 1OPXA 1XXHB 1EM6A 3FB4A 5AXAA 3VOTA 5DX8A 2VYNA 4YDSA 2ZBGA 4XVHA 3P52A 2P9BA 1UZNA 2BKAA 3D8HA 4I19A 3T7KA 4XQ9A 2NYVA 2E1PA 2SHKA 2V6MA 4FOLA 2ZG6A 4I36A 4K9MA 2R4QA 1ULAA 3QH4A 3K0SA 1O95D 2OCPA 2VWHA 1X7XB 1YR7A 3CUYA 4FQ5A 4Q9JA 3TTVA 1PR9A 1WU8A 3QFFA 1U7HA 1I4LD 1JBEA 1GAWA 3HEAA 2TMKA 3L04A 3U17A 4BQEA 4M53A 3BH6A 3F6BX 3TW0A 4HSGA 2F67A 1ZUHA 2QP4A 1EVYA 2GJ9A 4OJMX 2EBUA 4TRJA 5SZKB 5CYGA 1HT1E 1ISRA 1M0WA 4M0DA 1NLMA 2YYSA 1RWVA 3DE6X 1GFZA 1TF5A 3QE2A 4B47A 4YT5A 1G38A 1CP3A 2MINA 1CLUA 1ZYUA 1QPGA 3LKVA 1E20A 4IX1A 3HDVA 2QLTA 2O3TA 4OIFA 1CW2B 2QRUA 2QMEA 2E0IA 3IUSA 2IA5A 5BV2P 3PUXA 1BE0A 3QBTA 4RESA 2RGXA 4GIBA 3PIRA 1Y6JA 4UQPA 1JKFA 4EPXA 4EUHA 2A9VA 1TQ6A 3CLVA 3ZHZA 5JADA 1S1CA 3C70A 4ECAA 3O74A 1UAGA 4OX9Y 5AT1A 4C21A 1DMSA 5T4BA 1POWA 3OOYA 5JS6A 5IDWA 2A2ZA 5JHGB 1FUEA 1C8VB 1NYTA 4FI3C 1SOAA 4FR5A 4Q21A 1W36D 2OPHA 4F85A 1EJ0A 5C8YB 1RMYA 3Q0IA 4ZYZA 1V4VA 4XVUA 3RR2A 4WACA 1E7WA 2PVSA 4LF7B 2Q3BA 3T7TA 1XRQA 7REQA 2BMEA 2Q9UA 1VMKA 2Y1XA 4FC6A 3SP1A 5HIAA 3AKCA 3W7VA 1BW9A 5KDLA 2EFYA 2ODBA 3LUDA 3NXSA 3T1OA 3ZCPA 1P0PA 1OXMA 4Y1RB 1A98A 4AXXA 4AD8A 3EZ9A 4J0DA 5A4MS 3LNCA 2JK0A 4K05A 3TN7A 4NYMR 2WAYA 3FUWA 4QTZA 3OBBA 1Y7LA 3UT0A 1GCGA 3DS8A 2W4IA 3MLBA 1OLXA 2CVHA 3DLPX 3BILA 4OGWA 5KNLA 3KPWA 2GS9A 4QODA 2PZKA 4PZLA 1XZQA 4Q1DA 1WR8A 3W04A 2QWXA 2ZSAA 4YCNA 3TLCA 2X77A 4INJA 4XIGS 4DM7A 2I4OA 3I5XA 4L3WA 3O2QB 4REOA 1CVRA 2DQZA 3BZBA 4N5NA 2R4TA 2FP3A 1E6KA 3X2FA 2XXJA 1P29A 3GPDG 4ND6A 4OHMA 2UVPA 1J56A 1RRFA 4WBSA 3UGJA 2AWOA 1U7UA 5KHLB 1GQFA 1OXBB 2NUAA 5JDCC 4ODIA 1ZVJA 5HTOA 2I3BA 2I65A 1HTTA 1R6AA 3PX2A 2HCTA 2R6CA 2RBGA 4G0PA 5DP2A 4IGEA 1IJEA 2WF9A 1LVGA 3QVGB 5U1PA 3T3EA 1MJFA 3L41A 4O3MA 1QIJA 1A5SB 1S0UA 3A37A 4MVJF 4Y2JA 3LJKA 2V7XA 2B8EA 2ZIAA 3L6BA 4HAXA 4R69A 1GNSA 1E1DA 2W8BA 1VCHA 5HDBB 1PYGA 2HZ7A 1EH5A 2UYOA 2K7FA 1SUIA 3HB7A 1E9AA 3C41J 2CYCA 1JXMA 1V4BA 3LVRE 4M89A 4PLHA 3ZNNA 1DO2A 4HXFB 1HTWA 1QDLB 2QUAA 2XXBA 1E2QA 3TDNA 4F9EA 4PTZA 1G2PA 4V39A 1EP9A 2G63A 4E5NA 1P1RA 1VLVA 3FVWA 5ALYA 1SCBA 2VPPA 3REFA 4N7RA 4KXMA 4QU0A 2PSDA 1KL7A 3KR0A 4U3JB 1KERA 1N2ZA 1QBGA 1XR3A 4JVMA 3S2UA 3T35A 1JHDA 4OM7A 2PYZA 1N8KA 4IIXA 1QGUA 3UB3A 1EUCA 2I3ZA 1Q1AA 3SEQA 1CB0A 2RGWA 3D0QA 1E62A 3K20A 2CNLA 3LCMA 3OZBA 1F5NA 4LBWA 3BCHA 2IBTA 2V3VA 2A5JA 3IKLA 4RV4A 1IPHA 2H4FA 2PJUA 2QLLA 4DY4A 5LXTF 3D9QX 5KX5A 1T1EA 2C88A 4CKEA 1XTJA 1Z37A 3WNDA 2VP3A 3QKWA 4GRDA 2HJRA 3A6HA 4YRBA 3T1HB 1N2OA 2FEKA 2E18A 3RS3A 1K7FB 4Q66C 2X0RA 5EPEA 1UK9A 3BN3A 1NQXA 5L6MB 3BGWA 1E4YA 2P2SA 2JBHA 3KUKA 2SBTA 1DC7A 3LHFA 4H1UA 4K2HA 4C2AA 2YOFA 1HBJA 1Z6PA 3Q8XB 3M6UA 4TTTS 4LZWA 1BCRA 4PZ0A 5A62A 4JS0A 1O95C 2YY6A 3DKVA 2V8BA 3NPMA 2XRMA 1ZXBA 3QNMA 3GWGA 4FDAA 2BFAA 1JJFA 1WSBA 3GRPA 3ORYA 5HFNA 3UF0A 1FRNA 2GM3A 3H1GA 4HDMB 3C6ZA 3RCBA 5CLJA 4TVBA 4NBVA 7REQB 5LZ4A 2JVKA 5EE0A 5JUWA 1L4FA 2XWSA 2DB3A 2D1QA 4Z0HO 1WNTA 4TKUA 1WBDA 2CN1A 3MGKA 1USUA 2PBFA 4QPZA 1FRVA 3VKUA 2ZSHA 1J07A 3HJUA 3V3TA 4INPA 4LQDA 3GLIA 3RAEC 1XDUA 1V8ZA 2A0UA 1RJFA 3GJ8A 1YB4A 4FD2A 1F7VA 1XE3A 3D1LA 4JXJA 5JJ5A 3BCUA 4H4DA 1RXSA 3CFYA 3FIJA 4INZA 4V3CA 5I9NA 2AW5A 1EE9A 3JD2A 2AYYA 3EA0A 3KUCA 4CR8A 2CB0A 1PCXA 3A31A 1UJ2A 3UJBA 4G97A 2WU8A 2CMDA 3M1IA 3VHRA 4GI3A 1C9KA 1JDJA 1Z8DA 2Q2VA 1D09A 2QMQA 1TYCA 1Y8RA 2QN1A 1IOWA 1IRXA 2XTAA 2FUG6 1UC5B 2EU8A 3EH1A 3F9RA 4YGXB 2IF2A 5G3ZA 5KAPA 3CPJB 1Z0JA 4UMVA 5J63A 3TM4A 5JISA 3KAQA 1B1AA 1FDTA 1Z39A 4GKAA 3FKJA 3ZD9A 1YZYA 1DV1A 2H5EA 3EVZA 4KLZA 3VSAA 3ZUPA 4CG2A 1PNOA 4RKWA 5C1PA 2BONA 1NF3A 4MZDA 3CRMA 1UC8A 2AJCA 1C8LA 3A26A 2A35A 3DOUA 5CFMA 5FWDA 1IXRC 1W29A 5JCJA 3RT9A 4RTKA 1IN7A 1NI4A 1NWCA 4HLDA 3OE1A 1Q1QA 5DHQA 4F4DA 5IKOA 1WDTA 1HFKA 1TQ2A 1J2JA 2FU5C 2AOTB 2FR8A 2ID9A 5EMJA 4JP8A 2EF1A 2AUNA 4ZD6A 5PNTA 3SWWA 2O54A 4ZA2A 1C30A 3OOJA 3RGWS 1KJQA 4MVJE 2FUNB 4YI5A 2VYFA 5JANA 3BWYA 4LJSA 2WIBA 1XF1A 2PA0A 4DQDA 2ZR8A 4KC0A 4MULA 4RD1A 1B8PA 5TS2A 5JAPA 3ELBA 1MOSA 3EGEA 3VZQA 1KMIY 2A94A 2M6SA 3U1BA 4US1R 5JYEA 4MS4A 3SC6A 4I50B 2BFEA 4YRCA 1ZD8A 4OQ4A 4BVJA 5BUCA 1A9QA 2IXFA