5HTOA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1 (tetrameric ldh in an asymmetric unit)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
302
Chain Sequence
b'KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Oxidoreductase/dna
total genus 113
structure length 302
sequence length 313
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5htoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5htoA02
1MFPA 2QW8A 1U9JA 1R0SA 1N1GA 4P4GA 4JXKA 2QQ5A 4BGVA 5FF9A 2YDYA 4YJHA 1C0PA 1HE3A 1LSSA 4H15A 1NBOA 1EQ2A 2OP1A 2NVBA 1PR9A 1PR3A 5KTKA 1NQOA 1PGQA 1Z73A 5A02A 1Z7EA 1P0CA 2B36A 3JYQA 3KSZO 3EMKA 2RH8A 3NDRA 4IGFA 3C7AA 4U5QA 4CLOA 1E1MA 2X4GA 5JCXA 1GADO 1MG0A 3UOGA 1K3TA 2W8ZA 3F1KA 4E31A 1GEGA 1XYGA 1DFIA 1E3IA 2C7VA 1KY5A 3H9UA 1JAYA 4HNGA 1UXHA 3QJ5A 3GHYA 4BB6A 2J5RA 4ROSA 2A9FA 1X1TA 3MEQA 3WS7A 4DLBA 1PL6A 1ISJA 4DC0A 1YOVA 1EE2A 4HFNA 3ABIA 3E9NA 3WGZA 1UXGA 5HWSA 5L4SA 1BW9B 3NEPX 3M2TA 4AJNA 4GVLA 1EVIA 1O95A 1Z82A 3INGA 4DLLA 4HFMA 3EVTA 5GZ1A 1TEHA 3K2EA 5F21A 2OXIA 3ROKA 4FIZA 2VWHA 4MVJP 5I8ZA 4Y98A 2EKPA 1YS4A 1NFFA 3PQDA 3OJOA 4MVJI 4WOJA 2AQHA 3SJUA 3Q1LA 1E1LA 2IYOA 4ZJUA 3ZNPA 2DTDA 3A9WA 3KOUA 1IUKA 1NFRA 4QTZA 3UF0A 1PZGA 1I3MA 3NKLA 4O6VA 4MVJG 3AU8A 3NJ4A 2NADA 1B26A 3HZZA 3PTZA 3GDOA 1NP3A 4FC7A 1T25A 3PIDA 4EUFA 2IXBA 3U9LA 4XDYA 3R3SA 3LQFA 3QHAA 1U28A 3IDSA 3UCXA 1KIFA 1IHYA 3KRTA 3RUIA 1DFGA 2C0CA 4EDFA 2B4TO 2WYUA 3DOJA 1G0NA 1FDWA 1UP6A 4IS2A 3RI3A 1C0LA 4R01A 2J3KA 5IDWA 4I9UA 2I3AA 3QWHA 4CM9A 1B16A 1RM3A 2GYYA 1O94A 2X0IA 3BHJA 1UZMA 3U4CA 2CZCA 5G0UA 1V9LA 5KNLA 3Q2IA 2FWMX 2WM3A 1UH5A 4E2WA 1PTJA 5B1YA 4YR9A 2P91A 2X0RA 1JVBA 2AMFA 3EHEA 2Z1MA 1KY4A 4ZQBA 4PZEA 4EITA 4OOEA 4MKXA 1H2HA 4PRLA 2B5WA 3BZUA 3DAGA 3L4SO 4CMIB 4Q3BA 3ZH2A 2AE2A 4RPLA 5JAIA 1HE2A 4JX8A 4B3JA 4E5NA 4R41A 4RVDA 4GLLA 3GEMA 1GUZA 3NT5A 2O3JA 3X2FA 2Q4BA 3GDFA 4IDAA 3LYLA 2E4AA 1N92A 4MKRA 3RC7A 2AG5A 2P4QA 3KV3O 3WWZA 4LGVA 1GAEO 5KCZA 1B2LA 2YQ5A 4TROA 4BNFA 3ICCA 3PHGA 3GT0A 2ILTA 3I4CA 2RH4A 5DP1A 2E82A 1M75A 3GVIA 3AOEA 4OGWA 4WNIA 5JDIA 4LN1A 3WGIA 1YKFA 2PGJA 1ULSA 2R6JA 2Y93A 3GNSA 3U09A 1E6UA 2WEKA 3KB6A 3S55A 2AEFA 3EDMA 3HQ4O 5K0ZA 4ZRMA 1GV1A 2W2KB 3QRWA 4CV1A 5L4LA 4ND4A 5C7IO 3L07A 1IZ9A 2GPTA 4OXYA 2NUAA 2YJZA 3JYNA 2W2LA 3IUPA 3HADA 4UVIA 3V5NA 1BXGA 2Q3EA 2VHXA 3MJVA 1B0AA 1RJWA 2IE0A 1PJBA 2FN7A 3BA1A 1QORA 5JY1A 2ZIZA 1LBEA 4NBWA 4ND2A 2ZYDA 3U4DA 1SEPA 3ZU5A 4D0SA 4L4SA 2ZCVA 5JBIA 4QQRA 3I3OA 1DSSG 4R16A 3ZWWA 3G79A 1N2SA 3DOOA 4AL4A 1A72A 1YVEI 4UVHA 3GAZA 4BVAA 1A71A 3DFUA 4XJSA 3QY9A 4D42A 2ZYGA 4QUKA 5KKAA 3UUWA 4XYBA 1UXIA 3JD1A 4OQZA 1PL7A 4YWJA 1Y1PA 3VKUA 3E5MA 2HAEA 1ZSNA 1P3DA 2WD8A 2Q99A 3OICA 3T4EA 1LU9A 1R4MB 1LSOA 1DO8A 1NTOA 3L4BC 5A3JA 3N74A 1HDYA 1C1DB 1IPFA 3H9EO 2IEBA 4Q3AA 4W9NC 1YB4A 1N8KA 1LXCA 2VNSA 1LQUA 2CVZA 4YB8A 2D59A 4K26A 3DB2A 2WD7A 5TRTA 4LVCA 3GPIA 3JQGA 3NUGA 5DCUA 4N5LA 2C20A 1E3WB 1SPXA 3VH2A 4GLOA 4FFMA 5EESA 4YT5A 3H6KA 2OP0A 3AJRA 5H82A 4TZTA 5ER6A 2D2IA 4PFJA 1NPYA 4FSHA 4LMRA 4DPKA 1BXKA 3RAJA 3Q3CA 1IY8A 4XGKA 3FR7A 4B79A 4YJHB 3GK3A 2FRDA 4KP7A 4TSKA 1HRDA 3ZN2A 1B15A 1JWAB 2PD4A 4PVCA 1WXDA 1OC4A 4MO2A 1R6DA 3L0DA 3EUWA 3VAZA 5IDQA 4ZD6A 5B4UA 1Y81A 3TJRA 5JAMA 3OJ0A 2O7QA 1EVYA 3JQBA 2UUPA 3DZFA 3JQ9A 3PJEA 4QO7A 5KOIA 3A14A 3CINA 2IDZA 1VPDA 1V8BA 3ON5A 3W4IA 1SO8A 1E92A 1A27A 4CLXA 4EYEA 3WJAA 2Y66A 3RROA 2FPGA 4FOSA 3JQ8A 4FC6A 5J23A 4KWHA 2JFFA 3C1TA 4RCVA 5JS6A 1DRWA 3WMWA 4Z9XA 1X7GA 4J7UA 1RKXA 1LDEA 2J3HA 2ZCUA 3ZWBA 3OQBA 3CXRA 4JK3A 3PIIA 3VZPA 1ZK3A 5IZCC 3I9MA 4TKLA 1NQAO 3VC7A 4AJ2A 5HRUA 3HFSA 1IPEA 1QYXA 4MP3A 3HE3A 2G17A 1YBVA 4WLOA 5GMOA 3ZNQA 4CLRB 5KJEA 1XR3A 3HJAA 3WG9A 2OGUA 4XYLA 2DLDA 3KZVA 3DONA 3DZGA 2OZPA 4KWIA 5EPOA 3S1LA 5K9ZA 1H6CA 1P1RA 5DCWA 3DOCA 2DAPA 3V1YA 3QV1A 1PWZA 3O8QA 1F17A 4OHUA 5DN9A 5KVCA 4BO4A 2Y1FA 4G65A 3BXXA 3I23A 2R00A 5CFZA 1WDKA 2VNAA 3BMOA 1CRWG 5ES3A 2D0IA 4Q3EA 3BHMA 1ISMA 4B8WA 2J3JA 1LDNA 3LSYA 3H4VA 2CMDA 2EIHA 1TT5A 4HP8A 2A4KA 3DMTA 4RO0A 2BD0A 3O9ZA 1SOVA 1CDOA 2WE8A 1LRLA 2O48X 2DM6A 3ADPA 4J0EA 3P5SA 4KDEA 5T57A 4WEOA 4BMNA 5KJ6A 4J1SA 3UH1A 3WR5A 3W8FA 4BNKA 1LA2A 4PGFA 3PGXA 4YJFA 4B4VA 4J90A 2WMDA 3EAGA 4DXHA 3LC1O 3KYCB 3T7CA 5A9SB 3UW3A 1JN0A 3B1FA 3K9QO 1QYCA 5K6AA 2FSSA 2O4CA 4ZQGA 4CMAA 1N9GA 3GVHA 2YQ4A 4J4BA 3RUCA 4F6LA 1VSUA 3QQPA 3PJFA 4YAGA 4G81A 5L53A 1W4ZA 1NHGA 4L9RA 2FZWA 2EJVA 3D1LA 4IJUA 2XOXA 1U5CA 2NV6A 3NT4A 1O9BA 3PEFA 1JKIA 2PK3A 3GZ4A 4LISA 3IJPA 4YAEA 5FI3A 3UHAA 3AUTA 1EUZA 5AYVA 5A1TA 3GNTA 3N7UA 2YHIA 2EWMA 1JKJA 2UUOA 4CR7A 1GY8A 4MP8A 3O26A 4UVEA 4WGGA 2V6FA 4RV9A 1JU9A 2HUNA 2V65A 3BMCA 2B69A 2I3GA 5GZ3A 2GZ2A 5A9RA 1Q7CA 3PPIA 2EW2A 5JAQA 5T8KA 3WQRA 4I08A 2PV7A 3ZW9A 1A7AA 1PZEA 2CDAA 4DPMA 4IDBA 4BNWA 1E6WA 3CKYA 4O1MA 4Q39A 1AGNA 1M66A 1YL6A 2DTXA 4R69A 5F3RA 5JY6A 3I9LA 2BELA 4D45A 1PJ4A 3HDJA 5TQVA 4XQEA 2ZJ1A 1XG5A 2UYYA 4IDGA 4YRAA 2FPPA 4XQ9A 3CH6A 1W73A 3GF4A 3H7AA 3U49A 4RGBA 5I7SA 4DMMA 2FR0A 1QV7A 4JJGA 1WDLA 1EVJA 2NM0A 2PH5A 4K9DA 1R12A 2BMAA 3B20A 1BXGB 3M1AA 3TFOA 4IMPA 5I9LA 2POQX 2C59A 1NPDA 1SCUA 1I0ZA 2BFAA 3ZI0A 3PK0A 1BW9A 1N7HA 2NVWA 4II3A 3RD5A 3DTTA 4RVGA 4NIMA 4A0SA 2GZ3A 3E9QA 1UAYA 4OO3A 4AJPA 4EJ0A 2A92A 2G1UA 3PJGA 1I01A 4J4TA 3Q11A 4AJIA 4GPD1 1T2FA 1A9ZA 1NVTA 3PFFA 1LC0A 3LVFO 4DIBA 2P5YA 3VZSA 3U62A 2OOSA 3A1NA 5T5QA 3RU9A 1O6ZA 2G76A 2B4QA 3SVTA 4RPJA 1ZVMA 1PZFA 4XX0A 4O59O 2NVUB 4FR5A 4W99A 1GYRA 1MA0A 1ZXLA 3I9KA 1K2WA 4KUHA 1Z75A 2QRJA 3IMFA 5JCJA 4IGEA 2RIRA 4OAQA 5EL0A 1UDCA 2OL4A 4K28A 5CG2A 1B3BA 4DLAA 1J6UA 2LDBA 4N7RA 2NQ8A 1IULA 3HB4X 4OMUA 2O23A 4M89A 5AQ1A 4YRBA 3F5SA 1KETA 2VN8A 2BFOA 2WD7B 1EVZA 3A4VA 1GUFA 3JQGB 4CLEA 1TXGA 4YQZA 4RPHA 4MKZA 3OSUA 4YDRA 3G17A 1SB9A 1YGYA 4RZIA 2Y0DA 3W6ZA 4KZPA 1E7WA 4BNVA 4CM6A 2GASA 4BNNA 5FI5A 3PWKA 3AI1A 2EJWA 4M1QA 4NU5A 3D5QA 4U8GA 5B12A 3AW9A 1UZLA 4MDHA 1DAPA 3SBOA 4DPLA 3JQFA 5A4DA 4J16A 1J0XO 1GZ4A 3PYMA 3QP9A 3SC4A 1ZUD1 1ISFA 2VT2A 1Y5RA 4HWKA 4CMIA 3P2YA 1U3VA 4F45A 3ETDA 1LDBA 1VKOA 5LDGA 4J1NA 2D5CA 5DZSA 3TL3A 2Q46A 3GGGA 3LLVA 2NU7A 4PLFA 1NASA 4CM3A 9LDBA 2YYYA 3RASA 3JQ8B 4A7PA 4CMEA 4BKOA 4CQLA 1XU7A 3DZKA 4URFA 4XEHA 1B8VA 3RUDA 3WXBA 1G1AA 4DREA 1Q7BA 3GN2A 2GO1A 1NQ5A 5A5EA 4CM4A 4DA9A 2G82A 5L51A 1YRLA 1NQTA 2Q50A 4EI2A 4QXMA 3I9OA 3PRJA 3KO8A 1PWXA 4FS3A 1FDSA 4IZIA 4QSMA 2BFPA 3DDNA 3W8DA 4XD2A 2CDBA 4RDIA 1ENPA 1I3NA 3F47A 3ANMA 3ZNNA 1PS8A 2W2KA 5KJ1A 1P45A 3LF1A 1I3LA 1KOLA 4CM1A 4LCEA 3AI2A 3GVCA 3EZYA 3IQDB 4R1UA 3AOEC 2IZ1A 3JYPA 3KYDB 5JDIC 2X5JO 4JGBA 3G1UA 4BNIA 5H83A 2GDZA 3KM0A 5EN4A 1C1XB 3KXDA 5JC1A 4YVFA 4FD3A 3LK7A 2ZATA 1ULUA 2FR8A 4IDDA 2CFCA 4IMRA 4UUOA 2YDXA 4INAA 3IP1A 3JD0A 1MXFA 4DWVA 4DBVO 3PZBA 1KVUA 5F5NA 4CR6A 3ETGA 2HJSA 1NR7A 4YT2A 2JD1A 1BVUA 5B4VA 6ADHA 2X9GA 1TA4A 9LDTA 2ZTMA 1Q7GA 4PG6A 4W4TA 5DULA 5I9MA 1N9GB 2QHXA 2J5KA 5T67A 1A5ZA 5DNAA 2VTDA 1P1JA 1V3VA 2GRAA 4NQZA 4AJHA 1AHHA 3NDIA 3P19A 1I10A 2IZ0A 4HV4A 4IS3A 5A5FA 3ETEA 1R4MA 1GUYA 4H3VA 5G4LA 3U3XA 4GWKA 3UCEA 5C5IA 1AHIA 1C1DA 2GGSA 4TRNA 1Y9AA 1DB3A 1HSOA 4EGFA 1KEPA 1MC4A 4C4OA 2C7GA 3MJSA 2YHIB 1QV6A 2QYTA 1O5IA 1YB5A 4R54A 3S2FA 2PZLA 1CWUA 4Z3KA 5FWNA 1T24A 1Q0LA 1E3WA 2WYVA 2YZ7A 4TVOA 4GWGA 1KEWA 3GOHA 3HSKA 2X22A 3VOSA 1CYDA 2RBEA 4CQMD 4JLWA 1TI7A 4IJWA 1HDRA 1PZHA 4R9SA 2HRZA 2B37A 2HJRA 1YO6A 3KLPX 5JFOA 5F1PA 5ITWA 3AFNA 5A04A 3KETA 4RF5A 5L7WA 1CEQA 1E0DA 1ID1A 3E5RA 1Q2XA 5JE8A 1NX6A 5T64A 1JDJA 4JNKA 1Q0HA 4BB5A 4BKRA 1WMAA 5IG2A 4YJGA 2YV1A 4HBGA 2DC1A 1BTOA 2FSVA 5BNTA 3WYEA 2B35A 4DMLA 2O3QA 5MGBA 1ZW1A 4JROA 2YUTA 3UGKA 1ADGA 2CF6A 1N7GA 2VWQA 2DBZA 2J6IA 2PGDA 3GQVA 1F8FA 2CVQA 4UEOA 4GMGA 1VRWA 3SEFA 1DPGA 4YT4A 3IUSA 4MIOA 1BRMA 1KC1A 5C7OO 1HL3A 2C2YA 4JBGA 1LDYA 1H93A 2PLAA 3GZNB 4JBIA 4CLRA 4BGUA 3JQBC 5L45A 3JQ9C 3DBRB 1JVSA 4MVJD 4A03A 2A35A 2EERA 1TB4A 3DBLA 3IKVA 1CQIA 3K30A 4FGWA 2DFVA 3UVEA 4IDFA 3L9WA 5TNXA 2VYVD 3ZU2A 5F1KA 3ROQA 2GUGA 3PGJA 2G5CA 4PVDA 1P77A 3QVWA 4HUJA 4DYDA 5JPIA 2Y99A 4XKJA 4HFRA 2ZB8A 1K6IA 3GH3A 1N5DA 2H5LA 3KSDO 4GX2A 3G0OA 4J49A 3VPXA 2RHRA 1WAMA 4O5OA 1HLDA 4FJ1A 4GX1A 8LDHA 2CF5A 4D43A 4CL3A 4GI2A 1RWBA 4DTIA 2Q49A 4D46A 1SBYA 5TSDA 5HTOA 3K73O 2VHWA 3TSCA 1U4SA 5JNLA 1C0KA 2Y0CA 1EUDA 3IAHA 4G5HA 1E7YA 4PLZA 4XYGA 3KYCA 1OC2A 5A9SA 1NFQA 3EK2A 2IRWA 4I5FA 3E82A 5L3ZA 1WZEA 1DRUA 1UAGA 4ONEA 4PLCA 1ZIDA 1NWHA 2I6TA 1JQBA 3DL2A 3K8ZA 4NK5A 3B1JA 1P1IA 3OQ6A 4WLUA 2BF7A 2YFHA 4MVJM 4BO8A 4B3IA 2FMUA 4BO6A 1NNUA 3WQSB 1I33A 2IYPA 4GSKA 1W0CA 3C24A 1E3SA 3R3JA 4CMBA 1EBUA 2E37A 4AJ1A 1GQQA 2HKIA 5LDHA 1UDBA 2I76A 1UZNA 2JJYA 2X23A 3ASUA 3GGOA 1LLQA 4YA6A 3GRKA 3WFJA 3WJ7A 3DBVO 3TZ6A 5K6AC 4W82A 1LEHA 2AA3A 4IIUA 4J3FA 1H6DA 1HF3A 4Z9FA 3AUSA 4OOFA 1LSJA 4GGPA 4NH4A 1P74A 4CQLB 2X58A 3AUAA 3V1UA 3Q0EA 1Z45A 2VUTA 2XXJA 3H8VA 4YPOA 4NK4A 4E2ZA 3QVSA 4D79A 2QIOA 3PLRA 2EGHA 1PSDA 4UREA 3PI7A 1E6EA 4CM4B 4E13A 4PG7A 2Z1NA 1LRJA 3GFGA 3JD3A 4RPGA 3TF5A 1SNYA 2Y1GA 1Y8QB 3TOXA 3G3EA 3ZHZA 3FI9A 2WSBA 1SZJG 2Z5LA 3F1LA 4WKGA 7MDHA 1L7DA 4NJMB 1YONA 2EF1A 1MV8A 2GLXA 3BTUA 4B4UA 3E18A 1HWYA 1HKUA 5T8KC 4GMFA 3NTOA 1NHWA 2ZB4A 1QMGA 1U7HA 4YAKA 3ZV6A 3S2EA 4RF3A 5DBFA 4XWYA 1VL6A 1HDZA 4Q3CA 4KTVE 2BI7A 1YB1A 4RQTA 5JDCA 5KJCA 1I24A 3VVBA 1BDBA 4D0RA 3P7MA 3RC9A 5DBIA 2C29D 1X14A 4HKTA 4Y6SA 1EDOA 4W7HA 1XHLA 5JYDA 1M2WA 3GAFA 3MJTA 3ZHYA 4EW6A 5KJFA 3PHIA 1PQWA 3TDKA 3RQSA 4TRMA 3BMNB 2NVUA 4FDAA 4D44A 1X13A 2PA3A 3C7DB 1AE1A 1WNTA 3GVPA 3R1IA 3MWEB 3C8MA 1SB8A 2C07A 1KEVA 2E49A 5DF1A 4IJKA 5AXAA 4IQ8A 1U7TA 4BO0A 4IQ0A 3FWNA 2BH9A 3FD8A 5TT0A 3WDSA 4RJTA 3ZWCA 1ZSYA 3QE3A 4OSPA 3VDQA 3WB9A 1QLHA 1DJNA 3KYBA 4EJMA 3WSWA 1F8GA 1ML3A 3C1OA 3RC1A 4Y9DA 3GRPA 4BO5A 1K89A 4OL9A 4DQVA 4TWRA 3TZCA 5JW6A 3AM3A 3B6ZA 2GNAA 4PG8A 2HQ1A 4N18A 1UR5A 2NTNA 3S8MA 4EUEA 1PL8A 5IZ4A 2BKAA 1H6AA 3KBOA 4IDCA 1P1HA 5AXDA 3TWOA 3ENNA 2X5KO 2IXAA 3K6JA 2JAPA 5G4KB 4NBVA 3W4KA 2X1HA 3D3WB 1VJ1A 5IDYA 1SMKA 3R6DA 1JA9A 2JHFA 3RU7A 3GHHA 3H2SA 4Y67A 1LX6A 2JL1A 4WLNA 4YJGB 3OEYA 4PG5A 4WLVA 3PHLA 4BNZA 1ZK0A 2EG9A 3G49A 1MUUA 4GX0A 3ZWXA 3LZ6A 3TN7A 5ICMA 2EV9A 4H7PA 3L9XA 2GN9A 3TPCA 2I9PA 3LT2A 2W2LD 5LCXA 2D1YA 2OBNA 4MIEA 3JQFC 2BHLA 4JN6B 3W4JA 4TRJA 1T1RA 4M86A 2VQ3A 1ZZEA 1PJLA 4PLGA 1GQYA 2E48A 1E7QA 3AM5A 3HUDA 1D3AA 2NLOA 5DDIP 4CMJA 1P0FA 1GCOA 2FOIA 1B8PA 3PVZA 4DIOA 1W6UA 3FPLA 1YL5A 4WJZA 5BNFA 1VJTA 3FF4A 1CJCA 1G0OA 4E2YA 5JYEA 4M49A 1BXZA 3DBLB 2C5EA 1L1FA 5AVOA 3F4LA 4CMEC 4JJFA 5IXSA 3INRA 3LT0A 3C1AA 1GV0A 1MFZA 3DAFA 1UP7A 3ICPA 4ITUA 4E5PA 2O3SA 3WMXA 1D4FA 1PJ2A 4LRTB 3I6QA 4M87A 3EY4A 3KYDA 4IPTA 1PEDA 4U7WA 3GG9A 4IQGA 4W6ZA 3LLSA 3GUYA 1LUAA 2QX7A 3BIOA 3IOYA 3QVTA 4GVXA 1C1XA 2RHCA 3PXXA 3JTMA 1U1IA 5F1OA 4BS9A 4YJDA 3LF2A 3O4RA 2OUIA 5BSFA 2BGKA 5ADHA 1HEUA 4R3NA 1XCBA 4QFCA 1FMCA 2VT3A 1I30A 3JD2A 4MOWA 4GKBA 4P38A 1X7HA 3QIVA 4BO7A 4NG5A 3WSVA 1HYGA 4Z3DA 3W1VA 5DCYA 4OIMA 3QA9A 4F3YA 2HRBA 3I83A 4LSWA 1DC3A 3U5TA 1QYWA 1L7EA 3HG7A 3SXPA 2PTGA 1GU7A 5TIIA 4L4RA 4ALLA 1S7CA 2J5QA 1AXEA 1BG6A 1XQ6A 3H3FA 1DFHA 3OIGA 1HYEA 2O4UX 3JV7A 4BO9A 1Z7BA 4O63O 1XWFA 3MWDB 1X0VA 4JIGA 4PCVA 4HADA 2Y1CA 1UJMA 4PLPA 4WPGA 5CP8A 4D3DA 4J4HA 5KIAA 1EE9A 3OJLA 3ST7A 3H3JA 1ONOA 1K6XA 2VOJA 4B7UA 4IIVA 3F46A 1R4NB 3PHHA 3FNEA 2H63A 2UV8A 3PYLA 3VPHA 1QYVA 4YACA 5TGDA 4IZHA 5THKA 1LNQA 4L75A 1D1TA 1LLUA 3UCFA 5G0TA 3ITDA 1E3EA 1J4AA 1DAOA 4Q9NA 1EK6A 3KEQA 4JP3A 5TS3A 1ZXBA 4H16A 1GYPA 2QYSA 4J1QA 5CHEA 5F5LA 4ND3A 3NAQA 4GL4A 3VVCA 1Z6ZA 5DT9A 1KVTA 5CEFA 2W90A 4GQAA 4RL6A 4YBZA 8ADHA 3ONFA 1J49A 2JAHA 3VH3A 1ENZA 2VUUA 3DFZA 5THQA 3O03A 3SC6A 1LDGA 1ZEMA 4G2NA 3ZDFA 1XDWA 1PGPA 3K31A 2HCTA 4CJXA 1GYQA 2D4AA 1AN9A 1VC2A 2H6EA 2NWQA 2CDCA 5I9NA 3E48A 5ENDA 5CDGA 2VZ9A 1WDMA 1BMDA 1E77A 4DRYA 3DHNA 2PR2A 2PKRA 5I7EA 1NAHA 3H5NA 1MGOA 1N1EA 1PJSA 2D3TA 3GZNA 3H65A 3ZWOA 1XU9A 3EZLA 2PFGA 3INTA 3DBRA 4WCFA 4CV0A 3F6YA 4XB2A 1PIWA 5JAZA 1BVRA 2EP7A 2RAFA 4ALIA 4YTEA 3ZWMA 2CUKA 4P4NA 1HXHA 4JBHA 2D5AA 1KVSA 4CL8A 2OO5A 3HDQA 3ORFA 4BNLA 1PS9A 3FTNA 3EC7A 4JJIA 4XIYA 3MTJA 5GZ6A 1ORRA 4FGSA 2JFGA 4BV8A 3CIFA 2V6GA 4R51A 3O38A 4LRSB 1WMBA 1XQ1A 4ALJA 1D1SA 4QX6A 2FHSA 5TF4A 2EEZA 1DC5A 3LT1A 1V35A 1VM6A 4UEJA 1T4DA 1VE9A 4XR9A 1Y5MA 1Y9EA 3JQAD 4XGIA 3ONEA 3ZW8A 2DUWA 5ILOA 1DHRA 2OHXA 3IJRA 4GBJA 2PKQO 5HBRA 3DTYA 4OXNA 1PGJA 3IC5A 4I5EA 1E5LA 4NBTA 4I5GA 3WGGA 1UXJA 1TVEA 1ADFA 1BHSA 2NQTA 4Z9YA 5U4QA 2BFMA 4ZQHA 3BAZA 2IZZA 3RUHA 3HN2A 4NPCA 4R1SA 1DHTA 1HT0A 1H2BA 4JCOA 1EFLA 1YWGO 1F14A 5JMPA 2H9IA 4E5KA 4RVHA 4DL9A 1LRKA 1BWSA 2VRCA 4J91A 3GN1A 1QG6A 1X15A 2QRKA 3ZWYA 1MX3A 1ADBA 3RUFA 2NACA 1E7RA 1XSEA 4B7XA 3AI3A 1ARZA 1HDOA 2CY0A 2NU6A 5H81A 2VZ0A 3EW7A 2ZB3A 2DT5A 3WBFA 5TJ9A 3T4XA 1NVGA 4NR0A 2YV3A 4RF2A 3COSA 2RCYA 2J3IA 4PN3A 1J5PA 2CD9A 3TL2A 2PY6A 1BGVA 3SX2A 3ZHXA 4ESOA 3HWRA 4NI5A 5IZCA 3PYXA 4D41A 2AXQA 3Q6IA 1VL0A 2CNBA 4XB1A 2IODA 1ONNA 4ZHSA 1Y8QA 1D8AA 1F06A 4MVJH 1RM4A 3VTFA 4BNHA 1WWKA 2IEDA 4NMHA 1P31A 1PJQA 4CLHA 1FDTA 2FPIA 4NJMA 4E4YA 3DR3A 3MJCA 1V3UA 5IN5A 1LLDA 4XDZA 1VI2A 2JKVA 2VYND 3DEYX 3JQCA 4FFNA 3ONDA 1EEHA 1FXSA 4XYMA 2JFHA 1T2CA 1Y8RB 1U5AA 1U2GA 2HMSA 4R4JA 3ENKA 3JD4A 4N54A 4DUPA 3HHPA 1UXKA 2PZMA 3IS3A 1ENOA 4RVFA 2BLLA 3PDUA 1OOEA 1BDMA 3OBBA 2I99A 2HK8A 3N58A 1C14A 3WNVA 4BOYA 3SLGA 3RFXA 2GD1O 5L95A 1OAAA 3KHUA 3NGXA 3OJFA 4N5MA 5JCJD 5L7TA 1U2DA 3TOZA 3PFWO 3GY0A 2Y68A 5BT9A 3RJ9A 4R3WA 4K6CA 4E33A 3AY6A 4TKMA 3DZBA 1M76A 1I3KA 2OMEA 4IM7A 4PG4A 3WLFA 5IDXA 1JKFA 3CMMA 3OJEA 4BO2A 2ZTVA 1NAIA 4CV3A 1CETA 3JQDA 3OQ1A 5GY7A 3RUAA 3EGOA 4DGSA 1T2EA 4NFSA 4M55A 3BMNA 4CR8A 2I66A 2P4HX 5JDCC 4R68A 4WECA 1SOWA 4J2HA 2P2SA 7ADHA 3F4BA 4NBRA 4BHTA 4MVJA 4L4XA 4U0JA 1HLPA 2Y1DA 2AEMA 4Y8VA 1PJ3A 1TLTA 1ISHA 5G0WA 1DEHA 4UVGA 3V2GA 4P8RA 2X0NA 4RLHA 4MP6A 5JO9A 3OECA 1V6AA 2Z95A 4KTTE 5DOZA 4E30A 2JCYA 4PLTA 4LCJA 4L76A 3OIFA 2VYVA 1U3TA 3UXYA 3WYCA 1VJ0A 3KSUA 5KVQA 3VPFA 1B14A 1VKNA 5MDHA 1P33A 4ND1A 5A06A 3WGHA 5HA5A 1R66A 1DRVA 4Q3DA 4MJLA 1W8DA 4UULA 3TZKA 2C5AA 2QZZA 3GVXA 3ZU3A 4B3HA 1M67A 4BO3A 1KBZA 3D3EA 4LW8A 4AJEA 4I9NA 4TQGA 4XQCA 5G4KA 3WGTA 1Q1NA 4L8VA 2ET6A 4PLVA 5L4NA 3D3WA 1EUCA 4E5YA 1MXHA 3HFGA 4OJNA 4O0LA 2ZJ0A 3PWZA 2O50A 3B1KA 1GDHA 4IXTA 2DBQA 3BTOA 3JQ7B 2ZYAA 4D3FA 3WICA 1KERA 4GAEA 4Z0TA 2Q2QA 4MIYA 3PHJA 4ILKA 4RZHA 4HY3A 4J43A 2AQIA 3AFMA 4XJTA 3ZWAA 4YYZA 4FQ8A 2FY8A 5BSGA 2JCXA 1UP4A 2HSDA 3ROPA 3A28A 4RLSA 1DC6A 1SC6A 4B8ZA 5EMHA 4WASA 2EKLA 1LDMA 1A4IA 1IOLA 4C7KA 1NM5A 3V2UA 5C7LO 1GPDG 1XELA 1LTHR 3WNQA 1GTMA 1B8UA 3WGQA 2X7HA 2WDZA 4HNHA 4NFYA 4IINA 3GDGA 2Q1SA 1R15A 4YEDA 1P1KA 3HDYA 4HXYA 3C3XA 1WP4A 4WCFB 1EQUA 2DBRA 5TJHA 5CDYA 2PKQP 4XYEA 5HS6A 5CEEA 4IDEA 2SCUA 5IF3A 1YDWA 4K1LA 3VZQA 2EXXA 5ENVA 1C0IA 3F9IA 4ND5A 1H94A 1KVRA 3D0OA 3QSGA 4ZN6A 4PZDA 2ZK7A 3P2OA 5I8WA 4LSMA 4YRDA 1NVMB 3OH8A 1NYTA 1PS0A 2Q1WA 4QT0A 2GSDA 4Z6KA 3JYOA 1H9BA 4A27A 3KTDA 2TMGA 2EW8A 3K5PA 3GA0A 3S2GA 1CIVA 3M1LA 2OFPA 4CODB 1YE3A 2R2GA 3RJ5A 4B4OA 3LC7O 3B70A 5BR7A 1U3WA 2CSUA 1QXSA 1DIHA 2XXBA 3QWIA 4I8XA 5JO0A 3VH4A 2XPCA 5T6BA 2TMDA 4BNJA 5JC8A 2R00C 5HM8A 1EK5A 1GQ2A 3UFXA 3D64A 1HE5A 1DJQA 2VTEA 2ZTUA 4IXWA 4E0BA 2JD2A 4X54A 4ZQFA 3U4IA 3CSDA 4UEKA 1HYHA 1HZJA 4AICA 1ZBQA 2YHUA 3VKVA 3ASVA 2HU2A 1GZ6A 2PD6A 1EDZA 3DMTC 2NTJA 1IL0A 4AJ4A 2AQKA 4BNXA 4E21A 1O0SA 3ADOA 1XA0A 4ZGWA 1ZCJA 3UAGA 4MPDA 3H2ZA 1IZ0A 3GEDA 1HZZA 3AM4A 3WIDA 5IFLA 1NXQA 2G0TA 4L73A 3RUEA 3ROMA 3AY3A 4B4WA 3WGYA 1XGKA 2O3UA 5COBA 1WPQA 3LT4A 5L9AA 5G0SA 2F1KA 1R4NA 2P9CA 3H9JA 4KMSA 2O3RA 3JCZA 4XIJA 2Y1OA 3Q9NA 4TZKA 4XR4A 3OP4A 2HK7A 4BNMA 3C7CB 4CUZA 2HMUA 4OKNA 1ZMOA 4D3SA 4M54A 1SAYA 5A05A 3ZHBA 4XZ3A 1T2AA 3ZCXA 1R0LA 5BNIA 3NTRA 4KQWA 4NNJA 3KUXA 4U6SA 1K0UA 2P9GA 2YY7A 3IP3A 1I36A 3U0BA 3FBTA 3F5QA 4BNUA 2VCYA 3WQQA 5KVVA 3PZRA 4CQMB 5IJZA 4CM7A 4E3ZA 4BGIA 1ZK2A 1S6YA 3QVXA 1GD1O 4DC1A 3K92A 3FPCA 4WLFA 3G1TA 3UN1A 4A10A 4LVUA 5CAEA 1I2ZA 4KUEA 4NU6A 1B3RA 1Q0QA 5ITVA 1LJ8A 3TZHA 5B4TA 2ZKLA 2QZ9A 3WBBA 4GH5A 3NT2A 2HMVA 2VHZA 4Z0HO 4CMKA 3K2BA 3FNFA 1HETA 2EKQA 2DTEA 2XAAA 1HDXA 1P9LA 3OETA 4OKIA 2DPHA 5EQFA 3IKTA 1FF9A 5TLSA 3X2EA 4CM8A 4BGEA 1YDEA 4WE3A 1ZMTA 3OEWA 5I7FA 1IE3A 3QWAA 5BSHA 1OBFO 4CM9D 2X6TA 4ZVVA 4YXFA 3RBVA 4QFDA 2DUUA 3AWDA 2BGMA 2P68A 3GGPA 3I1JA 3WFIA 1LC3A 3KEOA 1EZ4A 3STHA 5DOVA 1UDAA 4WCFC 2BRUA 4BQPA 3DBHA 1DLJA 3AU9A 4J9VA 4A2CA 3MOGA 2P5UA 2DQ4A 4K6FA 2DKNA 3ZV4A 3DZIA 1T26A 1FJHA 4FPXA 5CPBA 4J6FA 3KLMX 3GMDA 3RKUA 3TZQA 1TT7A 3MZ0A 2LDXA 3GNQA 1MB4A 1XIVA 4WNCA 3UICA 2ZB7A 3GUCA 4JP2A 1T4BA 3VPSA 3R0IA 2J8ZA 1HSZA 4A26A 1HTBA 5IN4A 4R5HA 1ZFNA 4FCCA 1WW8A 3MOIA 4PIVA 4HX5A 1P44A 1ZJYA 4DYVA 4CM5A 3E8XA 4NZ9A 1K5HA 4J0FA 4L74A 1ONPA 2Q1TA 1YQDA 3FN4A 2DBVO 1ZNQO 2Y05A 3L6EA 3GR6A 4KDFA 2Y0EA 3D4PA 2VHVA 1QKIA 3D4NA 3CEAA 3HDHA 3WTCA 3HB5X 2Y67A 1PGOA 3I4FA 3PQFA 4R1TA 1LI4A 1PQUA 2NSDA 5COAA 5JSFA 3BTSA 1RM5A 1KS9A 4GX5A 1DC4A 3E1KA 4I1IA 1T2DA 3D4OA 3NRCA 1PJTA 4Y6PA 4TMFA 2AE1A 2UAGA 2XF8A 4CLOB 3AOGA 1U3UA 2DVMA 2V6BA 4BKUA 1ZJZA 3H9GA 1VLLA 3WOHA 4J2OA 3D5TA 1ZEJA 1LQTA 4FFPA 2JCVA 2Q1UA 3K96A 4W7IA 1V3TA 2NU8A 3RIHA 3CZMA 5I7VA 4E32A 4GGOA 2UVDA 2GR9A 3RWBA 3PLNA 1I5RA 3QVOA 2PNFA 2VUSA 4TRRA 4NBUA 5EINA 1X0XA 1Y8RA 1YOVB 1IB6A 5B37A 1ENYA 1JWBB 3JQ6A 5KWEA 2HMWA 2HK9A 3GG2A 4XQGA 1T1SA 1A7KA 3KVOA 1EMDA 3SJ7A 1R37A 4ZICA 4N5NA 3AK4A 4RVSA 4CMHA 4DIFA 2W98A 4XA8A 1I2BA 2GN4A 4ALMA 3T7EA 1UUFA 2C54A 3FCOA 4PRKA 3OM9A 4RF4A 5BSEA 4XRGA 4XGNA 3V1TC 1LSUA 1PX0A 2WJPA 3QWFA 1QP8A 3TFQA 4BNGA 3ANLA 2AHRA 2C82A 4CMCA 3DMYA 4UAGA 2EGGA 1YQGA 2O3TA 3JSAA 2I67A 2NNLD 1A4UA 1KVQA 1HDGO 4FFRA 4YCAA 4EBFA 1MC5A 1DIAA 2VRBA 3GMSA 3DZHA 3L77A 4BV9A 2GCGA 4C7JA 2B83A 1DXYA 4KQXA 1AXGA 1CERA 2V7PA 2YV2A 2A94A 2X8LA 4MVJF 1Y6JA 4AFNA 2NU9A 2NTVA 3M6IA 4GKVA 2AQ8A 3OMLA 2WTBA 3OFSA 1H9AA 4RDHA 1E3JA 1PJCA 1XKQA 3PDJA 4YAJA 4DVJA 3RC2A 3E9MA 4BUCA 3NYWA 3V2HA 1V0JA 4S3MA 4QEDA 4ZU3A 2O2SA 4FOOA 1M6WA 1GFSA 3MCVA 3DAPA 1IYZA 3DQPA 4P22A 4WK6A 4Q3NA 4AJOA 4D7AA 4AJKA 4BO1A 1RYDA 5L40A 4YT8A 3BMQA 3BYZA 2BGLA 4FW8A 1RM0A 4ZA2A 5HS4A 3JQAA 2VWGA 4AVYA 2P9EA 3HNPA 4QO8A 3DWFA 3CTMA 4E2XA 3ULKA 5EIOA 3VPGA 3VTZA 1QYDA 4CUJA 1IHXA 4EEXA 2GERA 3ZV3A 4Y6RA 4A73A 3FWZA 5IXYA 4MINA 2UDPA 4J7CA 1ADCA 1MLDA 3NX4A 4UUPA 3JQ7A 5G2OA 4ALKA 1ZK1A 3WYBA 1KYQA 2X86A 4II2A 4OM8A 4ZQEA 1YBAA 1SEVA 1JLLA 2V6MA 1G6KA 2FR1A 2Q2VA 2AW5A 4KOAA 4NFHA 4ALNA 3EVNA 2GZ1A 4XRRA 4DQUA 4F46A 3W6UA 2PGLA 4LK3A 4M8SA 3GLQA 3VH1A 4PLWA 1XLTA 3UKOA 2FZEA 4AJJA 1WVGA 3L6DA 3VZRA 4XCVA 1YJ8A 3L6OO 2Q45A 3MTGA 4CLDA 3OA2A 4E12A 2ZTLA 5COQA 3VDRA 4P4LA 2WYWA 1PU2A 5C37A 3EYWA 2AEJA 3WIEA 3CUKA 3I52A 3I9JA 4WCDA 1DLIA 1Z74A 4NHEA 1O89A 2E6UX 2PWZA 4NDNE 4CM8B 1GCUA 1A9YA 3PJDA 3E6AA 2GF2A 4A5OA 1H5QA 1QLJA 1I2CA 4ZRNA 1R0KA 5U9CA 5AOVA 2X0JA 1WLYA 3DXFA 1AUPA 2EP5A 1JAXA 4OQYA 1FDUA 1ZO8A 5ICSA 3IL2A 3H9QA 3FR8A 3L4BA 3NGLA 4UUNA 2ZQYA 3DBHB 2VYNA 5JLAA 4W9NA 1QR6A 4BNYA 4YAIA 5DBGA 1NWCA 5TT1A 2VOEA 3ZWVA 4BKQA 2DU8A 5CDUA 5EERA 3W8EA 3VHRA 2AG8A 2HLPA 3F3SA 4RPKA 4UUMA 2VZ8A 2HMTA 1JW9B 1XEAA 4U0KA 1MG5A 1CF2O 4CV2A 4F6CA 3IIEA 2I65A 4S1VA 3AY7A 1YQXA 3NTQA 4LMPA 4B7CA 3OHSX 2B0JA 3BHIA 3DHEA 4FBGA 3ZU4A 2X5OA 4JQCA 4J9UE 5JXWA 3M2PA 1PQPA 2GN6A 3I5MA 1DIBA 3RBXA 2PD3A 1OFGA 4UVDA 2PZJA 1H6BA 2BI8A 1K6JA 4WUVA 4MVJE 5A3VA 5CDTA 2HO5A 1KEUA 2Q4EA 3TQHA 5C3MA 1F0YA 3WLEA 3DZJA 1RYEA 3S2IA 2I5PO 3OA0A 1WZIA 1YBMA 2O2YA 4PLHA 1HDCA 3TNLA 3OIDA 2CVOA 4BIIA 5FFFA 3ZZNA 1E5QA 5KVSA 1OZAA 4OYRA 4E6PA 1OI7A 1F12A 4E5MA 1E1KA 5L7YA 3ZGYA 4EUHA 1ZH8A 4WEQA 1I8TA 1QSGA 3FHLA 4IJVA 1M6HA 1DBVO 5ER9A 4DBZA 4FN4A 2JHGA 4EEZA 3TRIA 2Y1EA 2VHYA 3D7LA 1DDOA 1VL8A 4ID9A 4AJLA 1GPJA 2HDHA 4HFJA 3NDJA 3PP8A 4IY1A 4R5MA 1EFKA 4L0QA 1E3LA 1YH3A 2F00A 2YW9A 4CPDA 2YFQA 5TX7A 1ZKMA 2PZKA 1FK8A 1JTVA 2B4RO 1X1EA 4I9HA 3E03A 3GEGA 4OSOA 1YL7A 3RKRA 3H5AA 5CG1A 4CQMA 4PLYA 3RBZA 3ZV5A 3MJ4A 3RVDA 3NV9A 4CUKA 1NPTO 1YXMA 6LDHA 3GPDG 3Q9UA 3WX0A 3ZNOA 3DO5A 1FDVA 4YQYA 3FNHA 3PWSA 5IAAA 1Y7TA 4FJ0A 3JQEA 4FJ2A 1H0KA 1RPNA 3RFTA 3PQEA 4TVBA 5EQDA 3WTBA 1YJQA 2ZQZA 4EZBA 4U6QA 4OH1A 2WWRA 3CMCO 2Q2WA 2OBYA 3MJEA 4BQRA 5AXCA 3DHYA 3LDHA 3O8QB 4CMGA 1DIRA 3GFBA 1DOHA 1OMOA 4J1TA 4OXKA 5CPFA 4BMVA 1EBFA 5ILGA 1DIGA 2H1SA 4J7XA 3QWBA 2QG4A 5TC4A 5CEJA 2WE7A 3ANNA 3NJ8A 4QECA 3BMOB 5FEUA 1PGNA 1E7SA 1P1FA 3ZWNA 3QW2A 4FB5A 3BTVA 5CDSA 3C85A 4WLEA 1I32A 3FBGA 3LC2O 4EJ6A 4IBOA 1B7GO 3RSHA 4RORA 5DP2A 1TT5B 3FTPA 1E7MA 1MP0A 3H5RA 5LC1A 4AG3A 5U1PA 4KUGA 1QRRA 1ISGA 4BKPA 4I5DA 4RVUA 4BNTA 3RCBA 1U8FO 3ITKA 2X9VA 4R1NA 1U8XX 3I6IA 4GSLA 2VRCD 4NJOA 4YJFB 2D8AA 3CPSA 5JMWA 5FYDA 3LU1A 1CQJA 4RQUA 1D7OA 2QRLA 2DPGA 1O8CA 3RFVA 3I9NA 3WWYA 1ZSVA 3A06A 1X7DA 3WGOA 1GEEA 5G0VA 1GZ3A 4Z0PA 3AUUA 5KKCA 4DQXA 1U4OA 3FSRA 2B5VA 1GL3A 2O7SA 3BMQB 3GC6A 2OORA 4WOKA 1GR0A 1KC3A 2X9NA 5AXBA 4BL5A 4BMSA 5BQFA 2FP4A 2VWPA 4FFOA 3CE6A 3FNGA 3JQAB 1LLCA 1VSVA 3SLKA 1E1NA 3FRJA 4IUYA 5A03A 2JD0A 3DC2A 2EHDA 1R16A 3HN7A 1ZK4A 1NR1A 2C2XA 3CZRA 3QLJA 4R9RA 5A9TA 3ZWPA 5EJ2A 2GN8A 1C3VA 1HE4A 4PZCA 3OF2A 2PH3A 2DFDA 4FFLA 3BMCB 1ISIA 3V8BA 1BSVA 3U4HA 3Q2KA 2W4QA 3JYLA
chains in the Genus database with same CATH superfamily
2VJMA 3COWA 1R0SA 3EASA 3FBWA 5E9AA 1N1GA 3MCUA 4JXKA 1MCZA 3GLHB 5G41A 5IUNC 3WNDA 3OWXA 1BN7A 5I9BA 4YJHA 2XQKA 1FSPA 1D8TA 2YHBA 4LXQA 1HE3A 1LSSA 3AV3A 1NBOA 3A6HA 2BDTA 3PF8A 1A0OA 4H15A 4EG6A 4F0JA 1PYOA 2ZGVA 4LWQA 3UB4A 2V4UA 1I4WA 5LLSA 1YC5A 1NW6A 1Z22A 4IGFA 3LPNA 3C7AA 2CEKA 3FCCA 4OQFA 4L50A 3C48A 4PTYA 3V4SA 2RGWA 1L5OA 1MG0A 3ZXUB 3UOGA 4AKTA 1ZD9A 3U2QA 4MI9A 2B98A 4YP9A 4IVQA 5JSZA 1Y9DA 2QJOA 3Q7IA 1E3IA 5CIQA 1YUBA 5CDFE 3QJ5A 3WA6A 2W93A 2J5RA 4L0MA 1OJLA 5HF5A 2O6LA 3IQFA 4V0NA 1Z5WA 5I4CA 3G23A 1PWHA 5EIXA 1BYIA 1UXGA 5HWSA 4B71A 1E1DA 1GN9A 4MW4A 1O95A 4HFMA 2QTVB 13PKA 1ZU5A 2ZIXA 3EVTA 4RKYA 1V3QE 3IDOA 3K2EA 3QVLA 5GZ1A 3O7MA 4RZQA 4F2WA 3N59A 2Y27A 1SQGA 1XC7A 2VWHA 4LQLA 4MVJP 1V4BA 1UJBA 1HFEL 2OV2A 1QWSA 4Y98A 2EKPA 4YCBA 4EOGA 3IVXA 2IIPA 4I6GA 2RHBA 2XYQA 4YLYA 1XQXA 2DB3A 3UV3A 5HQ3A 4PO1A 3NOVA 2DQKA 5GONB 2KYRA 2RJOA 4O2AF 1O9GA 1I4LD 2IYOA 4GPZA 4ZJUA 2DTDA 3KOUA 2NO4A 3OCWA 5DGXA 4QTZA 1ZISA 1PZGA 1U2ZA 3AV0B 4GM4A 3LQ4A 4DUGA 4X85A 4MVJG 5L6MB 1EP3B 4MLCA 1CXZA 3GDOA 1IHOA 3I6MA 3UAOA 1QG2A 3DE0X 2QR2A 2YJ4A 3CZPA 1F7VA 2Z8YA 4XDYA 4DJFC 1JDUA 5IK2A 2WVHA 4FLMA 4K05A 4PZZA 2JGKA 3FF1A 1B0UA 1HFJA 5EQTA 1KIFA 5A4MS 4NJEA 1N3IA 2BEVA 3GJRA 2C0CA 3QUCA 4PIMA 4B9AA 2WYUA 3DOJA 3EIFA 1G0NA 2R8EA 3ZD8A 3BBPA 3TQSA 4R01A 3H2KA 2I3AA 1D4ZA 4CM9A 4YQFA 3DOFA 1RM3A 3CN7A 2AC4A 2GBPA 4RE6A 1M5TA 1O94A 3HZHA 2X0IA 5LQSA 3D0RA 5D3MB 3RVQA 1JA0A 2XTAA 5G0UA 4JT8A 1V9LA 1S5PA 2BSXA 3Q2IA 4RHEA 5KNLA 2WM3A 1S1MA 3DLTA 4GS5A 2OZEA 5B1YA 1V6SA 2GJSA 2P91A 4HT3B 5KX5A 4ZMSA 4Y6LA 2Z1MA 2A9JA 1VCNA 1OU0A 4PZEA 1EIZA 2YHAA 4MKXA 4WVLA 1BGXT 1E32A 2GETA 2VDWA 5CM9C 4ESVA 1XNRB 2VNIA 1EK2A 2YCLA 1F6WA 3MPOA 1U1GA 4DCGA 5DTIA 2QUBA 4NG4A 4CMIB 2O8BB 1JEQB 3GEEA 2AE2A 4Q3BA 5FTLA 5ITZA 1XJCA 2HADA 3A1EA 2A9QA 4D99A 4RVDA 3IXQA 3RABA 5EUBA 3HP1A 2Q4BA 3AZPA 3MPUA 3GDFA 2NU7B 1NLFA 1XF1A 2GPBA 2DUJA 4P3NA 2JIBA 4HN2A 3RC7A 2P4QA 1W0KD 1D5WA 1F60A 1U5BB 4PCAA 1WTAA 1GT6A 1TOAA 5AI9A 4JMPA 5KCZA 3DF9A 2VQEB 3TXXA 3ICCA 3FRIA 3KZ1E 3SIXA 1R00A 3H16A 1AOXA 3RKSA 5DP1A 3N6VA 1M75A 3AOEA 3ZJUA 3WGIA 4LXGA 1UC5B 3NBUA 1FXUA 1TA9A 2PGJA 1ZUWA 5CRIA 5U4XA 1E6UA 4NCXA 2VH5R 2QM8A 4FQ5A 5CX1A 5FFMA 3S55A 3ES9A 1KZHA 4W5JA 5JANA 2ZE5A 4QYIA 3LZCA 3PWTA 5EIHA 1I6MA 5FUMA 1QJ4A 5ALDA 2O57A 3QRWA 4MUMA 3R0VA 4ND4A 3L07A 2BFEB 5BNZA 2SKDA 3U19A 2DY1A 4UAUA 5KYKA 2ZDGA 1OXXK 2RHTA 3CG0A 2FH5B 1A5AB 1U2TA 2W2LA 3IUPA 3OUZA 4Q82A 5G1OA 3V5NA 4CCSA 4CTJA 2JGIA 1FFWA 4FLEA 5HW0A 3HXTA 5FJJA 3WLKX 1EESA 1NJSA 3OSZA 4DDTA 1PJBA 3GXOA 3BZWA 3ICEA 1TF7A 2QR5A 2W2OA 4NBWA 4UJ5A 5AOCA 4TS4A 3ESZA 5LOVB 4L4SA 4G2TA 2JJQA 4IZOA 2YVUA 3G79A 4K9RA 1YQ9A 4MXDA 3RK4A 4MHOA 1Q92A 4DLUA 4CKBB 3B89A 2WHYA 3H2BA 4CKYA 5BN4A 3TMKA 4CKCB 4RJLA 1Z35A 2QTNA 2VHEA 2B82A 4QUKA 3K71B 4M8LA 1S8OA 4YRZA 2WG2A 4OQZA 1N5IA 3MS2A 1LNSA 2JHCA 4MVXA 2P6UA 3D8NA 4ZVQA 4OQQA 1Y1PA 2DSNA 2ZYVX 3E5MA 3PGA1 4LJ7A 4HB2A 1ZSNA 2OLEA 1I9CA 4U9UA 1DCKA 1TYAE 4J0QA 4PTZA 5GVRA 4NYMQ 1LU9A 3OUTA 4AUMA 2EJTA 3CM0A 1NTOA 1Z4QA 2ZJOA 1JMYA 2BFFA 3R4CA 4D6PA 3JARA 2QSUA 3N74A 4WFQA 4D4JA 1N8TA 3G2NA 4TYYA 1NE7A 2RIPA 1D03A 2OG1A 2RGYA 4LYEA 4W9NC 4X8HA 1T1GA 3IH5A 3ORQA 3TTYA 4DAOA 2P2YA 5A0TA 1MC8A 4RKQA 4K26A 2FOXA 1SM4A 2WJHA 2WD7A 5E95A 5TRTA 4QC2A 3GPIA 4UDXX 4LZZA 3KYJB 3USCS 1OKKD 1V95A 2C20A 3L7DA 3EQ9A 1RZUA 3P45A 3VH2A 5BXYA 3AKZA 5EESA 1VL5A 2EFHB 2WTMA 3AUXA 3AJRA 3UAXA 4TZTA 5ER6A 3OFND 5LBIA 3ZHRA 2VJMB 2FEWB 1D2MA 4XOIA 1GL9B 1MVOA 3O6VA 3ZBQA 4PQGA 4B79A 3GIWA 3OZDA 4YJHB 2YWBA 1VYTA 4QU8A 4YQEA 2FRDA 5CLFA 3E3OA 1MZPA 3RSLA 2PCLA 3PEWA 4YUVA 3R7FA 2PD4A 4PVCA 1JSLA 3QE9Y 2WJZB 1R6DA 2IH5A 1N2HA 4FNOA 2YFYA 4HWSA 1JEDA 3QLUC 4RFLA 2V1XA 3F7MA 3PD1A 2ZWIA 4QLBA 5JAMA 4EG0A 7ABPA 4B6QA 2EKBA 2XCRB 3IURA 1V7ZA 1JPNA 1P2DA 4I4CA 5I5GA 2AZTA 2QLJA 1VPDA 2M6LA 3ON5A 5JSZB 2FQYA 5A5GA 4Z4EA 4KQFA 4EYEA 2Y66A 3RROA 3V1NA 4FOSA 2OBXA 3C14C 8MHTA 2F6RA 5JNUA 4L3WA 2CLIB 4BJ3A 2JFFA 1XZEA 4GRAA 4HLQB 1ZD5A 1DKMA 1JH8A 4L8FA 4NENB 2B1GA 3TCXB 4L7VA 5HZHA 2IQIA 3CXRA 3W1EA 5DJ5A 2WSYB 4JK3A 1ZK3A 4GMXA 4MPTA 4TKLA 4WY8A 1KWGA 3HFSA 3QBVA 2ZIXB 3GRFA 1QYXA 3IEUA 3PDHA 1YBVA 5EKTA 2C61A 5KJEA 4GZMA 3HA3A 2ZSEA 7AT1A 2BR5A 3HJAA 1T6NA 3FYHA 3WG9A 3RJMA 1BEUB 3JPYA 5K9ZA 3VR5A 5EPOA 1E1QD 1OVGA 4A8JC 1QVVA 1GCIA 3QK7A 1IDOA 1G9TA 1LS6A 1JR2A 1W5EA 2FSHA 3OEEA 5DN9A 5E0KB 4UOZA 5KVCA 4K9OA 5JBQA 2NO0A 1NUHA 3GRZA 4ENRA 1F5NA 3G8YA 1AA9A 4Q6WA 4RTMA 3QPWA 3SIPA 3OIYA 1IUOA 5CFZA 5AW9A 3TX2A 1P4JA 1WCIA 1OZGA 4MV8A 2IPAB 4HJRA 4Y1RB 2I80A 1BKSB 1TAQA 4K6OA 5JCZA 1L7RA 2Y6VA 2D0IA 4EGSA 5IHPA 4RELA 3COJA 2ZR7A 2J3JA 3NZEA 2VPIA 2QM3A 1SVUA 3LSYA 4BLPA 3E9RA 1ZGCA 4QTYA 3OZGA 5B64A 1VG9B 1XCMA 3ECSA 1TT5A 1N4AA 5EE5B 5ERGB 2JZNA 2GBFA 3DMTA 3TG8A 3A25A 2YVAA 2VJNA 2BD0A 2ZIVB 3I01A 3O9ZA 3D6FA 4JQSA 4HL6A 4KAAA 3P5SA 1M0EA 3KQSA 3IHWA 1NQUA 2BEVB 5BY2A 5KJ6A 3U48A 2ORED 5ISMA 1CUZA 4YJFA 3W2TA 3EAGA 4YRJA 3VX4A 1BRTA 1R18A 3UW3A 1JN0A 3KKKA 1B1AA 1MJNA 4GZLA 3PC3A 1P7PA 3KAKA 2HV8A 1B00A 2G9QA 3I1IA 4OGFA 3NOQA 4R8MA 4X84A 3NDBB 2O4CA 1CC1S 2P6MA 4ZEXA 1DWOA 3D2CA 1LJUA 2MWMA 3GVHA 4D6XA 5G1PA 2TRSB 2RGGA 2G5TA 2ERXA 3H2HA 5BN5A 3IUBA 2IZOA 4R2IA 3PJFA 3ORRA 4I3FA 3S70A 2Q0QA 3S7TA 3U3ZA 4JU8A 2B92A 3AETA 2ZTSA 1GLNA 1U5CA 2HCBA 2NV6A 3EGXA 3NT4A 1JKIA 1RRCA 3IJPA 3KPVA 3KQNA 1EUZA 1XUOA 1ZWLA 1VPEA 2ZP1A 4L4ZA 2NG1A 2ZBVA 4G85A 4IO0A 2XVYA 2EWMA 2UUOA 2YHIA 2GJ8A 3I2FA 4QQ8A 2IYSA 1BH6A 1GY8A 4ZCLA 3TI9A 2C8JA 4NZZA 3WKEA 4D3XA 1QZUA 4EKGA 3M5PA 2V65A 3JTEA 1Q0SA 1ULBA 2B69A 4DZZA 1L9XA 1Q14A 1TQ4A 2GZ2A 2X7JA 2HNAA 4V0MA 4MB6A 3PPIA 3EULA 4H7FA 1BFDA 2H07A 2O2JA 4S1WA 1YZYA 3E7PA 2PV7A 4I08A 1LWNA 5LMNB 5J2UF 1Z25A 1A7AA 3IPLA 4QPCA 2ODNA 4BNWA 5D87A 4BWGA 3EA4A 3KFVA 3GLKA 3IBFA 1C2TA 2EC5A 2QW0X 1JFVA 3CKYA 4P3OA 3VXKA 4LC9A 2L0XA 1AGNA 3N53A 5DBOA 3R7LA 2UYGA 4BFLA 2ZYHA 2PKWA 1VDMA 3A3OA 3DUWA 5JY6A 4M9UA 3QXGA 2WVJA 3QKTA 3TVTA 4B6EA 3JW8A 1DG3A 1H2AS 4N82A 2UYYA 3RGGA 1M6NA 1CIPA 3MOSA 4P4SA 2FPPA 5KYUB 4KVGA 3OPMA 3O2NA 2BSAA 1ZGBA 4QYIB 5JD5A 1D9XA 1U9CA 2XUPA 3H7AA 3K09A 4RGBA 5I7SA 5ICCA 4N5DA 1SJ9A 2FR0A 4YPOA 1QV7A 1ECCA 4KODA 2P27A 1XV5A 4ZCMA 3PDWA 1ZD8A 1GILA 1UWCA 2OC9A 4LBVA 1R12A 4MQBA 3M1AA 1NZJA 4ITVA 3FUCA 3CVVA 1TK3A 3WL6A 1NPDA 2WQ6A 2BFAA 4HLNA 4EQZA 4IUBS 2IP1A 5CXXA 1BW9A 3RD5A 4WD3A 3DV2A 4RVGA 1RAAA 3QUSA 4JLMA 2O0LA 2GZ3A 2ZREA 3VU9A 1YR3A 3V7WA 1QCDA 1TYZA 3FDXA 1AZLA 4AJIA 3BS4A 4IJMA 2C4NA 1QGAA 1DC8A 5AUNB 1WU8A 4ECAA 3PFFA 2P5YA 3KXLA 2P8SA 1L1QA 2OOSA 5FOSA 1BMQA 2ZRBA 5BN4B 3WGJA 3AMVA 1EFUA 3A1NA 2F90A 4Q37A 1O6ZA 4Y2HA 1W88A 2G76A 3HU1A 1W1IA 2AD1A 2B4QA 1AIPA 4XX0A 1J09A 1N75A 2NO9A 4O59O 3KK0A 3DL7A 3QG1A 2NVUB 4W99A 1YU6A 1GYRA 2GCOB 2GN2A 4F4FA 3I9KA 3SFZA 1IBMB 1R3UA 1XI2A 1K2WA 1N5OX 1O95C 1Z75A 3IMFA 3D8UA 4L7QA 3NORA 2PQ2A 5EL0A 4A1OA 4BEBA 2Z3ZA 4E11A 4A92A 4EHNA 4OLFA 4KB5A 2ODTX 5D6NA 1B3BA 5MN4A 4DLAA 3GGCA 3H05A 1J20A 1Q12A 3PRHA 1L5MA 4JMLA 2XRYA 3V8PA 3WA7A 1QIDA 2NQ8A 1USGA 1NP7A 3NHYA 1M1NA 1WSBA 2O23A 2Q9UA 1I5EA 1FUIA 4GI1A 2A59A 1OWOA 4B7AA 5DI3B 2B8EA 2WD7B 4ZPXA 4UTVA 5FBHA 3A4VA 2VJPA 4YQZA 3IBYA 3ETJA 1LWOA 1YI8A 1ORDA 4U7FA 3G17A 1P1CA 1D5CA 2Y0DA 1NRIA 4R81A 3V8NA 4BNVA 4BNNA 3AI1A 3AINA 4OX9Y 2Y9MB 4NU5A 3D5QA 1Z56C 1UK8A 2I2WA 2K2WA 3HCAA 4QDOA 3L2OB 4BC1A 3N2LA 1XZCA 3H5TA 3IDZA 1YB2A 3MT8A 2AZXA 4GBED 1OLOA 3SDSA 3Q3GE 3JQFA 4IQ4A 2ZI9A 4G4JA 2ERYA 4J16A 1NZFA 1IMOA 2OM6A 4ARSA 5LNK6 3PYMA 1MT3A 1W0JD 2CGEA 2GK4A 5DNVA 4BFTA 3PKZA 3HXMA 1ZUD1 1JU4A 1ISFA 1NMZA 1QRDA 1XMXA 2KJQA 3JAKB 4YI5A 5K8IA 5L3QB 1AURA 3GPCA 1NUTA 1UKYA 2PRYA 2PMWB 4QLAA 4TUYA 5LXTB 2HWXA 3ETDA 4MR9A 1M74A 3HYLA 4J1NA 4HRAA 5DZSA 2Q5IA 4LZWA 3ZXSA 3JZIA 3GGGA 2H1HA 3AR9A 3N2IA 4TXLA 2GK6A 3K05A 4FYXA 2W2TA 2WJJA 3ZEIA 3TZBA 3VR4A 2XSZA 1FSSA 1RHMA 4XEHA 1B8VA 3D7KA 4IV5A 4DREA 1G1AA 2G04A 1NW3A 2WTNA 1Q7BA 2HREA 2ZJ7A 1P4GA 3DL4A 1CW2B 1SPBS 4FSDA 4XPZA 1NQ5A 1EG2A 1XEFA 1ZESA 5AUQA 4HNUA 5KQMA 3RIXA 4LOJA 4R05A 4DA9A 5DLDA 3AB3A 4I1OA 2X14A 4N76A 2WJ3A 2PLFA 3I9OA 4IIBA 4V24A 1YE8A 3PRJA 4DJJA 4IZIA 1FRVA 2R1TA 3MQ4A 3BJEA 3SQWA 3DDNA 4MZXA 2OZLB 2XCIA 1DEAA 2A1UA 1A76A 3CX4A 2W4IA 4XD2A 3GLSA 2YJ6A 3LUPA 5LU8A 3WV4A 5EXXA 4M8NE 4DANA 5JARA 3MK31 4EMSA 1DT5A 1KOLA 3PFHA 4CEJA 2XCUA 5BUQA 2OM2A 3PCXA 3I8OA 3CUTA 4UFNA 3VGJA 3GVCA 3NVMB 1YMVA 3EZYA 1J42A 1TU4A 3N8IA 2JK0A 3LC0A 3PA6A 1BS2A 3AOEC 2CHEA 4AM8A 3KYDB 3A0RB 1BGWA 2QROA 2XUJA 4S1TA 2I3ZA 3HKDB 2JFQA 3BIFA 1DBIA 1XP8A 3KM0A 3MA0A 2FFAA 1R4AA 2PQMA 5HBGA 4EENA 2IXFA 3KXDA 5JOQA 3ZJ4A 2OV1A 1E4VA 4C2TA 3FKSA 4YV0A 2ZATA 4PO8A 5DPMA 4PQRA 4ZOEA 4INOA 4IMRA 3OESA 2B9EA 3IE2A 3QPCA 3IRVA 4DDKA 1MXFA 1SIWA 1XLUA 1O96A 3PZBA 1UPTA 2QTZA 4HG2A 4RY8A 4ZHQF 3VPAA 3IPCA 5HKBA 1RS0A 3ETGA 1AKWA 2HJSA 1J0DA 2WIDA 5BR4A 2REBA 4ZDKA 1ZW6A 9LDTA 4ZOBA 1RCUA 1Q7GA 3IE0A 3MUFA 4IOJA 3TLEA 1W47A 4F7DA 1JG6A 2QHXA 2J5KA 2DULA 3MTDA 1QRAA 2NVOA 4OREX 2VTDA 3AF4A 1S01A 1TDJA 3S99A 2OT3B 1GPH1 1AHHA 1O97C 3NBQA 4G1BA 3A6ZA 5D86A 2FF5A 3U3XA 1A9TA 3SSMA 1AMUA 4NE2A 4OL0A 1V7QA 1AHIA 5BVGB 3QQ5A 4EGFA 1G8HA 1MC4A 3U4QA 1R5OA 1E98A 5A5VA 3MTBA 3I0NA 1KFCB 2C7GA 1W4CA 2YHIB 3MJSA 2WDPA 2QN7A 4QOSA 1EHCA 2R96A 4ZV7A 1OSNA 4R54A 6NULA 1CWUA 3FDFA 3RTEA 4AMBA 1A5SB 1DWUA 1ECBA 1R2QA 1JH9A 3U5ZB 1KZ7B 1L8AA 3P27A 3NVDA 4GWGA 1M73E 2WSIA 2C4UA 3GOHA 4YDRA 2F1IA 2IHYA 3VOSA 1A2KC 4I6JA 4P7FA 4HVLA 2G72A 1G2IA 5IRCD 1CYDA 1X7XA 1XEXB 3TR6A 2PIAA 4IJWA 1UM9B 4DWOA 1PZHA 4YY3B 2HRZA 1JPJA 2B37A 4TTTS 3C3PA 4YREA 1WB9A 3ENZA 3L7NA 1NBME 1GA1A 4MK4A 1XCGB 5BW8A 1KK0A 3MWLA 2H9YA 1M2FA 1LF5A 1KRWA 3E5RA 1XPUA 4FUTA 1Q2XA 1K2VN 1S2IA 2GYVA 1JDJA 4MUIA 5CA1A 3HMKA 1DBSA 5A7HA 4BKRA 1XRMA 4P3XA 4W5TA 1WMAA 4WW0A 4X61A 1KAQA 4YJGA 3T54A 5IG2A 1VQ1A 5BNTA 4HAOA 3UFBA 2B35A 1B0ZA 1GPNA 1H4VB 4DMLA 3IUJA 4B84A 1SUDA 4JL5A 3LQRA 4XASA 2C9DA 5BVHA 1RJFA 4GVPA 2D0DA 3KOZA 1NKVA 3VQTA 4CGYA 2HJHA 5H4GA 3FSJX 3WLHA 1JHPA 1FW8A 2ICAA 3K53A 3RYHB 3TW6A 1OLXA 2PGDA 4KQJA 4FMDB 1VPTA 2CVQA 1GPKA 4HDCA 1JDNA 3CNLA 3LLCA 3SEFA 3MT7A 5KQRA 4DZTA 1KDVA 2XQFA 4NTZA 5M5BA 1GSOA 3L0BA 3IUSA 4OLAA 3NAZA 2F8LA 3HEMA 1TZMA 3X1WA 4JQOA 2C2YA 1H93A 1UJ5A 1IXYA 1RXCA 3OD1A 4NPAA 4BJ1A 1XCJA 3ZX5A 3FPFA 1TCCA 3EH2A 3KDSE 4FCWA 4Q47A 1JVSA 4MMZB 5JCOA 1XZKA 2JJ1D 4A03A 1M8FA 1S2NA 2A35A 2EERA 4O4IF 1ZJ6A 4N9QA 1OPXA 3H8WA 4RKRA 5JVDB 4EY4A 1ZUNA 3BE4A 5FPKA 4TV9F 5TLSA 2VHQA 1ZA2A 1W88B 5E7JA 1WHSB 3IESA 4KLRA 4PCLA 3ROQA 2WTXA 2G5CA 2J4FA 2VBCA 3GJ3A 5EUMA 1E2FA 4HBZA 1YCHA 4JL6A 4JR2A 3SQLA 1T8YA 4KQKA 3CRNA 1N5DA 4GX2A 3G0OA 1GZDA 3B7GA 2BMDA 4J49A 5FUVA 4LYAA 2RHRA 4GLFA 1RR6A 3SS9X 4AN4A 5I4KA 1KI4A 4PANA 4X65B 3G82C 8LDHA 3EUEA 4FTWA 5K0BA 4EM6A 4GI2A 2B1IA 1LVHA 5I3ZA 4CNBA 2Q49A 4OBWA 3VPCA 1SBYA 4TXHA 3RHFA 5AW1A 1PO7A 3TSCA 2MSKA 3MGKA 4GQIA 1F1BA 4EL5A 4JITA 2R8BA 4G5HA 1WR8A 2QG6A 4MROA 5K8VA 2Y92A 1B8OA 1HFWA 1OC2A 1Y5LA 2OR3A 3KYCA 3R0JA 2WYIA 4FFVA 4PQEA 1NFQA 4QYXA 4RMHA 4EAAA 2JG3A 3OMXA 4OI0A 1QUEA 2C2HA 2ZU6A 1Q1QA 4HHEA 1VXRA 2IUUA 1I1QB 2XGMA 1ZIDA 1JQBA 4PSDA 1U0EA 2X0KA 2DUNA 3A4IA 2Q0HA 4UD6A 1YS1X 3AR2A 3V4RA 4I4IA 1WKBA 2GA9A 1NNUA 2YNMC 3OJCA 1I33A 4OIFA 4QJ3A 1W0CA 1SCBA 1E3SA 2ZYIA 1EM6A 5FAXA 5HUQA 2I3DA 2J87A 2Q4RA 4DADA 3CX3A 1UKAA 1R6VA 4Q4HA 4TS9A 3VR0A 2EX0A 3M6WA 3ZZ1A 3P0EA 2JJYA 2X23A 4Y1GA 1A9XB 3ASUA 4TUYB 1XZGA 5E1DA 4F2GA 3GRKA 5TPZD 3WFJA 3W5BA 1VMDA 3WJ7A 4MR9B 1QFSA 2QV0A 3D9QX 1XTVA 3GJ0A 1JHRA 4MSUA 5B1EA 1LEHA 1BOOA 3AJ9A 3ZDDA 4B31A 4FHFA 5D5HA 1W9MA 3JASB 1DDGA 4KH0A 4R1PA 5IANA 2HSGA 4P9NA 4IEIA 5D6OA 3SEAA 3UMRA 3IR7A 1LK7A 5CK5A 3Q0EA 2XXJA 1RMQA 1Y48E 3H8VA 1TM4E 3K1ZA 3NUZA 4GHWA 4I55F 4R1MA 2IX3A 1N4DA 2RONA 3LUHA 2EGHA 1PSDA 3PLRA 4EHDA 1RTKA 4AX8A 3AM1A 2Y76A 4G5SA 4PG7A 3WFIA 4IHKA 2F8SA 4RPGA 3TF5A 1ND5A 3QLTA 2GN0A 1O95D 1Y8QB 4RVOA 4Z4FA 4HF7A 5ABPA 5ALWA 1B6GA 1XQWA 5DNDA 3ZHZA 1CDDA 5BSRA 1KQPA 1M0SA 1NF8A 1YONA 4MQ6A 1MV8A 3KJGA 4B4UA 3RANA 3A9SA 3FYTA 4K0RA 5T8KC 4GMFA 5EZ6B 1Z4NA 4K3UA 4KWCA 3T0GA 1HPLA 1DBQA 1CUFA 1U7HA 4GGMX 2C3PA 4CEJB 4QA9A 1RC8A 4QBHA 4GFDA 3RARA 3L6CA 3NM6B 2H9AA 4N12A 4RF3A 1PHRA 3I09A 4D81A 4XWYA 4Q3CA 1HDZA 1I7NA 4DUGD 3N6RA 3TINA 2BI7A 5JDCA 1JHDA 5KJCA 2DFTA 2WUEA 3U7RA 1P29A 5A3QA 1NVUQ 5DBIA 4F93B 4JZKA 4D4GA 3RVPA 3ZH9B 1X1RA 3L8MA 3PDIB 1TJ4A 3K09C 3SQMA 2AR9A 1RE1A 4JS0A 3NNDA 4FHZA 3GAFA 4GR9A 4EW6A 5KJFA 1UBGA 5CFNA 3JATB 4BBPA 2FWIA 2Q4DA 2D7CA 1SRQA 4IRUB 3HJGA 4N48A 1VKRA 5KHAA 1XQVA 3THYB 1Z6AA 1TECE 2R8ZA 4X5OA 2J0SA 3JRXA 1IZ7A 2ISQA 2LKDA 3LTNC 2IHVA 3VSBA 4KSCA 1CSEE 2P9ZA 4MICA 3W7AA 1PBNA 3ZWDA 3GVPA 4P2GA 4IIHA 1VJ5A 3MWEB 5AK0A 5F33A 1KDZA 1KEVA 5ALFA 5DF1A 2O7RA 3M6XA 3H86A 3QU4A 1ACMA 5ADWA 2N1MA 1US8A 2GZSA 1EKXA 1F9AA 3OCJA 2DFKB 2XNKA 4IQ0A 1IXSB 1KARA 2BH9A 3O5AA 2DF8A 6ABPA 1GDTA 3D6AA 3OX3A 4BEVA 3QSYA 4OBXA 4OSPA 5M3BA 3WB9A 4AZ0A 1Z26A 1NYQA 1SCKA 4ENWA 2XQJA 2C5BA 4BO5A 1FFBA 1K89A 1KDPA 5I7OA 2RH5A 5HHTA 4KXVA 3TZCA 3FCAA 4WJLA 5JW6A 5BV1A 2QTCA 3O1LA 3BOSA 4RK5A 4HATA 3LOQA 4ZT5A 2ZZNA 3E5HA 1GGKA 5LFAA 4A2WA 1PV2A 4O2BB 1P1HA 3VJLA 5ADUS 2COUA 1XCPA 5AXDA 3O1JC 1FTWA 3KLOA 4JHLA 4UU0A 1NF3A 3ZDZB 4C4ZA 4OLBA 3QU5A 1SMKA 3Q8WA 3R6DA 5KNBA 4BQSA 2WFLA 3RU7A 3H2SA 4TXJA 1LBHA 1EWQA 2YWEA 1LX6A 4H7EA 4RDCA 5AHRA 3LRPA 3GLRA 4YJGB 1M72A 1MR3F 2PXHA 3TLGB 1L5LA 1GPMA 3E3NA 2NQ2C 1EA7A 2WICA 3AL2A 3SXJA 2LNDA 2V0GA 5FNVA 3ZWXA 2QPOA 1JDZA 1U7WA 3ER9A 1B6SA 4YRPA 1JSRA 4G8JA 3H11A 4NULA 2GN9A 4QBFA 3TPCA 3OZFA 1C4WA 2W2LD 2ZR9A 4KRGA 1FSGA 4KO2S 3JQFC 1LGYA 2BHLA 2CSXA 4J16C 4M86A 3C5EA 4D98A 2FN8A 2Q8QA 4F5YA 2PKEA 4LHXA 2IYTA 1C41A 2VPPA 4M0KA 3S3TA 2JAWA 3D31A 4X0EA 4OHVA 3TVYA 5IFKA 2OBBA 4QWMA 2WZCA 3ZXIA 1EWYA 2R66A 1O97D 2ACWA 2PYDA 4WJZA 3CRZA 3GFFA 5FA8A 2XT9A 3ADCA 3E5NA 5KWSA 3BBLA 1WZNA 4YHHB 1DTEA 5FBVB 1ZUNB 4Y9SA 4S0ZA 1L1FA 4P92A 4BCBA 3CBQA 2CBGA 3F5FA 4JEHA 3DAFA 3QXHA 5C4GB 2D74A 3NS7A 4WNAA 3MJDA 3MWGA 4MW5A 3NHSA 2FW9A 3VV3A 2O3SA 1TM3E 3CLSC 4Y2QA 1PJ2A 1DG9A 2OWEA 2XWPA 3IMGA 4LRTB 4M87A 5JZ9A 3OZRA 1CUCA 1TKAA 3K5HA 1PEDA 4U7WA 5IKMA 1PYGA 3GUYA 3SIWA 1LUAA 4S35A 3QVTA 3O90A 4ETMA 1ZI9A 2XB6A 3PXXA 1JMVA 3MMSA 1YQWA 1XNJA 4M9SA 4W5WA 1VL1A 4HD8A 2VL7A 2B7LA 2OUIA 3VZCA 5ADHA 1RLOA 3A6PC 4QFCA 1ZGHA 3CUVA 1FMCA 2VT3A 4FHDA 3HL0A 5F2EA 3SHVA 3UB3A 3DFFA 4P38A 1RACA 1EDDA 2IQ5A 3N05A 4FYKA 3VBEA 5KYWB 2ZIGA 4YC7A 5ECDA 3ZGNA 4IIYA 3P0RA 4U2DA 5KYXB 1HYGA 1AJEA 1N2IA 4E3WA 5DCYA 4KX5A 3B2NA 4LSWA 4W1RA 3U5TA 2XRFA 1ETHA 4G63A 1L7EA 4X6XA 1CK4A 2QY9A 1VP9A 2AS0A 3DYVA 3HG7A 4DCNA 5KC9A 1TEZA 1JEYA 2PTGA 3V7NA 1IZYA 1M8PA 5AKJA 2HHAA 4HWRA 1QUFA 3PA8A 1E94E 1V1MA 4F91B 3PFGA 5AOAA 1JFTA 1AXEA 4ND8A 2PO7A 3H3FA 1DFHA 1DI0A 3OIGA 5GIOE 4L5IA 4AT1A 5CCEA 1HYEA 2O4UX 2W5UA 1Z7BA 1BCSB 1OH8A 3VO9A 3FGPA 1Q0RA 1X0VA 3K3PA 4B17A 2UUCB 4HADA 4PLPA 3KJXA 1M2GA 4J4HA 4C04A 3I0ZA 4G9EA 2IP2A 3OJLA 4FGJA 4XX1A 2X8JB 3H3JA 1S8AA 2PBZA 3RT9A 2BJVA 3BF7A 4B7UA 3F46A 4KQCA 1R4NB 2HR1A 1TK9A 4L4YA 3WLIA 3KR0A 4UJ3A 3LQYA 1JA1A 1U2RA 1QYVA 1JU3A 1VRCA 1PJAA 4OI4A 2GA8A 5FWYA 3THWA 1FFEA 1YRWA 1LNQA 4PZUA 1D1TA 1H69A 2RK6A 2V7VA 3D8TA 3HBLA 2CNNA 3ZD9A 3VYSB 2N42A 2VCEA 3PR2B 2OZVA 1RI1A 1F2DA 1E9FA 3SZUA 2XVZA 5C8YF 1ZXBA 4X00A 4H16A 4J1QA 1G3QA 1SD5A 3H04A 4EG8A 1LV7A 1RLIA 1GLGA 3I72A 2WNHA 3VVCA 5JRZA 1KU0A 5EWMA 5DT9A 4EMBA 2FK7A 2NN3C 2FOLA 3TM5A 2XXAB 4Q4CA 1EJ6A 4J76A 4P4TA 2VUUA 1XEWX 1G98A 3MAAC 3O03A 5LZ5A 4ODIA 1D0IA 3CRRA 3SC6A 3TIVA 3VR5D 1L5KA 1ZEMA 2QL7A 3TO5A 3TPFA 3OEED 3GJSA 1PR4A 4CF6A 4NZPA 2J9YB 3SZ3A 3A9VA 4H6VA 3WC4A 5CAEB 2NWQA 3CNBA 4C4RA 2BFNA 3MW8A 4I1YA 1GPLA 1RAHA 3ILSA 2VZ9A 4Q9IA 4DDWA 1DCFA 3K0AA 3RSGA 1BMDA 4NYJR 4HEQA 3SR4A 4CIVA 3K6KA 3RHSA 2C2OA 1VBMA 3IDQA 3AEUA 4L6AA 1UXOA 2PKRA 4EEKA 2A67A 1TVKA 1ZN8A 2CZQA 5I7EA 1MGOA 1E4EB 1PJSA 2D3TA 2VPYA 1SC1A 1U90A 4I0WB 5AKKA 1QOPB 3G6WA 1RPTA 2YNMD 4CF3A 1T0HB 1O54A 1FYEA 4KRYA 3T15A 4NONA 3K0CC 1G8JA 4KRXA 4GDMA 3SZRA 3COZA 3KT8A 3L1KA 1BVRA 2EP7A 1JI3A 1XZHA 2RAFA 3HU2A 1HR0B 4ALIA 2G1KA 3NIDB 1WU7A 3L7YA 2G0AA 3KP1A 2GVDC 1Z6QA 3IXMA 3HH8A 5DEIA 1G9XA 4CL8A 2WBLC 3HDQA 4BNLA 2CB0A 4JJIA 9ABPA 1RLUA 2D2FA 4BV8A 2V6GA 1R27A 3OAAA 2G9RA 3NHPA 4JNCA 5TF4A 4LI0A 1N0HA 2JLQA 2O1SA 4BUJA 2AF3C 1FTYA 2GDJA 5JCOC 1US8B 1P9WA 1T4DA 1VE9A 2I3BA 3AHGA 1Y5MA 4KK4A 4WTOA 4XR9A 2HYDA 4LDAA 2ZT6A 1AF4A 2C03A 2VRWA 3HU5A 4GBJA 5HBRA 3DTYA 4LZJA 4UHEA 1T4GA 5KI6A 4OXNA 5AVSA 4MS4B 4RHUA 1HA3A 3P9KA 3DVSX 4I5EA 4NBTA 3LCCA 4YP7A 2HD4A 2ZROA 4PGHA 4KIUA 2NQTA 3I5AA 1YBHA 3QEKA 1RQXA 4ZOLB 3MQFA 3FPKA 5TB5A 2IZZA 2VP9A 3L1JA 1Q7TA 3DXZA 4JKOA 4L22A 4ETWA 3TBHA 2CV2A 2FW6A 3LKVA 4JCOA 1ULHA 2JGRA 1MOPA 1V5GA 2V54A 3LG2A 1F14A 4DCJA 4JVSB 4F3CA 3LRXA 2JCGA 4E5KA 4G09A 3W5HA 3Q8MA 4MVYA 3KB1A 4RVHA 1OAKA 1QB8A 3U26A 1N57A 3A3KA 3ILVA 3M83A 4O4JA 4DL9A 1FSFA 4OAOA 4LGCA 4JQZA 1SXPA 4O4HB 1BWSA 2FA9A 4J91A 4JWTA 5FCDA 3WO1A 3ZG6A 2QRKA 4IGIA 3RREA 1ADBA 2CL5A 2FMXA 3T5GA 3K0SA 4H18A 5CJJA 2VT7A 3D7RA 5CB8A 2O19A 2K4MA 4P33A 5ALJA 3L8FA 3OLZA 2CE2X 4Q7KA 3T3GA 2CY0A 2NU6A 4TPKA 5FT9A 5H81A 5HRCA 2PWBA 1EXNA 3E2IA 4HQKA 3K9CA 4W8HA 4H6XA 2WB2A 3SE0A 5FBRB 2VSOA 2ZB3A 3IBGA 3DLAA 1A9RA 4D96A 3WBFA 3FHTA 2WIKA 2LVBA 3NHLA 4RY9A 2EEPA 3ED5A 2Q2NA 3QPUA 3COSA 2MOKA 2RCYA 5EIWA 4PN3A 2FCRA 2OOKA 3ZV7A 2REXB 3QH4A 3JRWA 3TL2A 5H8WA 3OWHA 2PY6A 1BGVA 4UBKA 3SX2A 1GUBA 1EGHA 3HWRA 4B74A 5IZCA 5FWXB 2PN1A 2QRMA 2QN6A 1SCQA 4G0PA 4ZHSA 2QU7A 1G1MA 2HV9A 1XAHA 3R6GA 2VSQA 1E6LA 4M99A 5IKPA 2FSUA 1JNXX 2ZVQX 1MTZA 1WX1A 4RFSA 4V38A 7MHTA 4YAUA 1JSZA 1PK8A 1R64A 1CUYA 1XRNA 4ERXA 2FPIA 2V98A 3MJCA 1V3UA 4XDZA 5LZ9A 2DG2A 2PT9A 2RGBA 4YO7A 1VA4A 5KCMA 3ONDA 1EEHA 2CNKA 2AWNA 2GAFA 2QVXX 2YWDA 3A2NA 3L92A 4M4SA 2G9UA 3NHWA 4GEGA 4K9SA 4MITA 4R4JA 4ZWNA 5PNTA 5CITA 3KQUA 1YK0A 2ATCA 3HHPA 3IS3A 2FJPA 1ENOA 2PL9A 4I7EA 1JQ5A 4RVFA 5FWDA 3PDUA 1XMIA 2HBYA 2I99A 3ZK8A 1FX0A 2E5WA 2GCNA 2G5GX 3CGGA 3L1UA 3HYTA 1OAAA 3NGXA 2CNWD 1V39A 2E2WA 5JNWA 5DM70 3O73A 4G4SO 4C05A 3A7EA 3ZEAA 4BRWA 4COKA 5F7OA 5E6RA 3GY0A 1AY0A 5HRAA 3U44B 4AF8A 4JA2A 5BT9A 4I36A 4UDYX 5A4IS 4YGXB 2F3SA 2VNHA 3DZBA 4RHTA 1VJCA 4ZAXA 1IQRA 1M76A 3NTUA 5D1HA 1G8GA 3IX7A 2QRVB 2IW3A 1ODKA 3GLTA 1EGMB 3GQBA 2R1ZA 2FSIA 3LUKA 4ZT4A 1Z4PX 2BKXA 2VP4A 3T3IA 4B6OA 2JHPA 4BTVA 2WF9A 2OHIA 3RUAA 3A4LA 4DGSA 1YULA 2DFPA 1FRNA 1ZH6A 5JDCC 3S44A 1MVLA 1DARA 2RHOA 1FEZA 2FDXA 2BN4A 1QONA 1UT6A 3O4HA 1VHTA 7ADHA 4QYMA 3F4BA 4IUCS 2AH5A 4KQ1A 4TX1A 1N32B 4L4XA 5CT4A 3OKCA 1IM2A 3KZNA 3KB2A 4ZI7A 1N5RA 1ECJA 2BGRA 1ISHA 4MR8B 1DEHA 4JOCA 2JLYA 1MW8X 5TF0A 2V8BA 3I39X 5JXGA 1UINA 2Z95A 4KTTE 3X1YA 1Y1QA 2J0UB 5EI5A 5KNCA 5CYFA 1C3XA 5LPNA 3AEQB 1SBNE 2Z56A 4ADSG 3BH6A 3KSUA 1OA1A 3KG2A 4I81A 1JYFA 4ZO7A 1U0RA 2MSDB 1VB5A 3USES 4Q3DA 2XW6A 4YMHA 1JAZA 5HSGA 1B1CA 1MOZA 5EP2A 2C5AA 1B8NA 1N6RA 4IIJA 1NVAA 5AIAA 3VR4D 5FWYB 2XSZD 1E63A 1SBIA 2A5GA 1YI0A 4EA7A 3THWB 1Z0ZA 1A9PA 1M34A 2HHJA 3GJXC 1KBZA 1ULAA 1V4VA 3U4MA 2DHDA 3N2YA 5FTKA 4AJEA 1GGEA 3CLSD 3WGTA 1SK9A 3AB7A 3BILA 3PGMA 4PNPA 3D3WA 3GLIE 2VF7A 3GRYA 1BWQA 4MA0A 3LCVB 1JQAA 1U0FA 4O0LA 4ZEWA