5HVKB

Crystal structure of limk1 mutant d460n in complex with full-length cofilin-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
165
structure length
164
Chain Sequence
AGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Noncanonical Substrate Recognition of Cofilin/ADF Proteins by LIM Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords LIM domain kinase 1
total genus 34
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 5hvkB00
1COFA 2NUTB 5KYWB 1YVNG 2VACA 2FGHA 3EG9B 3EFOA 1SVYA 1H1VG 1M2OA 4CBXG 4JD2H 5IVUA 1AK6A 3A5OS 3EGXA 2LXXA 2FH3A 4PKIG 1T2LA 1QPVA 1TMWA 1WM4A 1X67A 1SVQA 2I2QA 3CIPG 3EG9A 1RGIG 3Q2BA 2VIKA 3EFOB 1P8ZG 2KVKA 2W0IA 3A5LS 1PD1A 3A5MS 3FG7A 4KEEA 4CBWG 1SVRA 2FF6G 5KYUB 1YAGG 1TVJA 2XFAA 1D0NA 2L72A 1V6FA 3EGDA 2MP4A 5KYYB 2NUPA 5KYUA 1Q8GA 1C0FS 4S10C 1VKKA 2LLFA 1NLVG 3FFKA 2FH4A 1M2VB 3A5NS 1NPHA 1C0GS 3EGDB 5FAEA 1NMDG 1NM1G 1PD0A 1WNJA 3CJCG 2MOTA 2VILA 5A1MA 1CNUA 3FFNA 1EQYS 4KEDA 3EH2A 5KYYA 1JHWA 3L50A 1M2VA 2MV2A 4KEFA 2NUTA 2D8BA 5L6WC 5HVKD 1D4XG 5KYXA 2LJ8A 2HD7A 2QTVA 4PKGG 4Z94G 3FG6A 3EH1A 1T3YA 1AHQA 5FAFA 1J72A 2FH2A 5HVKB 5DD2A 4LIZA 4PKHB 1HQZ1 1PCXA 1P8XA 5KYNA 1AK7A 3DAWB 2NUPB 2XF1A 1UDMA 5KYXB 3CJBG 1M4JA 1T44G 4CBUG 1WFSA 2FH1A 1DEJS 3CI5G 3TU5B 5KYWA 2FF3A 4BEX1 1Q8XA 1MDUA 1KCQA 1T3XA 1VFQA 3EGXB 1CFYA 1F7SA 1ESVS
chains in the Genus database with same CATH superfamily
1COFA 2NUTB 5KYWB 1YVNG 2VACA 2FGHA 3EG9B 3EFOA 1SVYA 1H1VG 1M2OA 4CBXG 4JD2H 5IVUA 1AK6A 3A5OS 3EGXA 2LXXA 2FH3A 4PKIG 1T2LA 1QPVA 1TMWA 1WM4A 1X67A 1SVQA 2I2QA 3CIPG 3EG9A 1RGIG 3Q2BA 2VIKA 3EFOB 1P8ZG 2KVKA 2W0IA 3A5LS 1PD1A 3A5MS 3FG7A 4KEEA 4CBWG 1SVRA 2FF6G 5KYUB 1YAGG 1TVJA 2XFAA 1D0NA 2L72A 1V6FA 3EGDA 2MP4A 5KYYB 2NUPA 5KYUA 1Q8GA 1C0FS 4S10C 1VKKA 2LLFA 1NLVG 3FFKA 2FH4A 1M2VB 3A5NS 1NPHA 1C0GS 3EGDB 5FAEA 1NMDG 1NM1G 1PD0A 1WNJA 3CJCG 2MOTA 2VILA 5A1MA 1CNUA 3FFNA 1EQYS 4KEDA 3EH2A 5KYYA 1JHWA 3L50A 1M2VA 2MV2A 4KEFA 2NUTA 2D8BA 5L6WC 5HVKD 1D4XG 5KYXA 2LJ8A 2HD7A 2QTVA 4PKGG 4Z94G 3FG6A 3EH1A 1T3YA 1AHQA 5FAFA 1J72A 2FH2A 5HVKB 5DD2A 4LIZA 4PKHB 1HQZ1 1PCXA 3DA7A 1P8XA 5KYNA 1AK7A 3DAWB 2NUPB 2XF1A 1UDMA 5KYXB 3CJBG 1M4JA 1T44G 4CBUG 1WFSA 2FH1A 1DEJS 3CI5G 3TU5B 5KYWA 2FF3A 4BEX1 1Q8XA 1MDUA 1KCQA 1T3XA 1VFQA 3EGXB 1CFYA 1F7SA 1ESVS
chains in the Genus database with same CATH topology
1COFA 2NUTB 5KYWB 1YVNG 2VACA 2FGHA 3EG9B 3EFOA 1SVYA 1H1VG 1M2OA 4CBXG 4JD2H 5IVUA 1AK6A 3A5OS 3EGXA 2LXXA 2FH3A 4PKIG 1T2LA 1QPVA 1TMWA 1WM4A 1X67A 1SVQA 2I2QA 3CIPG 3EG9A 1RGIG 3Q2BA 2VIKA 3EFOB 1P8ZG 2KVKA 2W0IA 3A5LS 1PD1A 3A5MS 3FG7A 4KEEA 4CBWG 1SVRA 2FF6G 5KYUB 1YAGG 1TVJA 2XFAA 1D0NA 2L72A 1V6FA 3EGDA 2MP4A 5KYYB 2NUPA 5KYUA 1Q8GA 1C0FS 4S10C 1VKKA 2LLFA 1NLVG 3FFKA 2FH4A 1M2VB 3A5NS 1NPHA 1C0GS 3EGDB 5FAEA 1NMDG 1NM1G 1PD0A 1WNJA 3CJCG 2MOTA 2VILA 5A1MA 1CNUA 3FFNA 1EQYS 4KEDA 3EH2A 5KYYA 1JHWA 3L50A 1M2VA 2MV2A 4KEFA 2NUTA 2D8BA 5L6WC 5HVKD 1D4XG 5KYXA 2LJ8A 2HD7A 2QTVA 4PKGG 4Z94G 3FG6A 3EH1A 1T3YA 1AHQA 5FAFA 1J72A 2FH2A 5HVKB 5DD2A 4LIZA 4PKHB 1HQZ1 1PCXA 3DA7A 1P8XA 5KYNA 1AK7A 3DAWB 2NUPB 2XF1A 1UDMA 5KYXB 3CJBG 1M4JA 1T44G 4CBUG 1WFSA 2FH1A 1DEJS 3CI5G 3TU5B 5KYWA 2FF3A 4BEX1 1Q8XA 1MDUA 1KCQA 1T3XA 1VFQA 3EGXB 1CFYA 1F7SA 1ESVS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COF A;  2NUT B;  5KYW B;  1YVN G;  2VAC A;  2FGH A;  3EG9 B;  3EFO A;  1SVY A;  1H1V G;  1M2O A;  4CBX G;  4JD2 H;  5IVU A;  1AK6 A;  3A5O S;  3EGX A;  2LXX A;  2FH3 A;  4PKI G;  1T2L A;  1QPV A;  1TMW A;  1WM4 A;  1X67 A;  1SVQ A;  2I2Q A;  3CIP G;  3EG9 A;  1RGI G;  3Q2B A;  2VIK A;  3EFO B;  1P8Z G;  2KVK A;  2W0I A;  3A5L S;  1PD1 A;  3A5M S;  3FG7 A;  4KEE A;  4CBW G;  1SVR A;  2FF6 G;  5KYU B;  1YAG G;  1TVJ A;  2XFA A;  1D0N A;  2L72 A;  1V6F A;  3EGD A;  2MP4 A;  5KYY B;  2NUP A;  5KYU A;  1Q8G A;  1C0F S;  4S10 C;  1VKK A;  2LLF A;  1NLV G;  3FFK A;  2FH4 A;  1M2V B;  3A5N S;  1NPH A;  1C0G S;  3EGD B;  5FAE A;  1NMD G;  1NM1 G;  1PD0 A;  1WNJ A;  3CJC G;  2MOT A;  2VIL A;  5A1M A;  1CNU A;  3FFN A;  1EQY S;  4KED A;  3EH2 A;  5KYY A;  1JHW A;  3L50 A;  1M2V A;  2MV2 A;  4KEF A;  2NUT A;  2D8B A;  5L6W C;  5HVK D;  1D4X G;  5KYX A;  2LJ8 A;  2HD7 A;  2QTV A;  4PKG G;  4Z94 G;  3FG6 A;  3EH1 A;  1T3Y A;  1AHQ A;  5FAF A;  1J72 A;  2FH2 A;  5HVK B;  5DD2 A;  4LIZ A;  4PKH B;  1HQZ 1;  1PCX A;  1P8X A;  5KYN A;  1AK7 A;  3DAW B;  2NUP B;  2XF1 A;  1UDM A;  5KYX B;  3CJB G;  1M4J A;  1T44 G;  4CBU G;  1WFS A;  2FH1 A;  1DEJ S;  3CI5 G;  3TU5 B;  5KYW A;  2FF3 A;  4BEX 1;  1Q8X A;  1MDU A;  1KCQ A;  1T3X A;  1VFQ A;  3EGX B;  1CFY A;  1F7S A;  1ESV S; 
#chains in the Genus database with same CATH topology
 1COF A;  2NUT B;  5KYW B;  1YVN G;  2VAC A;  2FGH A;  3EG9 B;  3EFO A;  1SVY A;  1H1V G;  1M2O A;  4CBX G;  4JD2 H;  5IVU A;  1AK6 A;  3A5O S;  3EGX A;  2LXX A;  2FH3 A;  4PKI G;  1T2L A;  1QPV A;  1TMW A;  1WM4 A;  1X67 A;  1SVQ A;  2I2Q A;  3CIP G;  3EG9 A;  1RGI G;  3Q2B A;  2VIK A;  3EFO B;  1P8Z G;  2KVK A;  2W0I A;  3A5L S;  1PD1 A;  3A5M S;  3FG7 A;  4KEE A;  4CBW G;  1SVR A;  2FF6 G;  5KYU B;  1YAG G;  1TVJ A;  2XFA A;  1D0N A;  2L72 A;  1V6F A;  3EGD A;  2MP4 A;  5KYY B;  2NUP A;  5KYU A;  1Q8G A;  1C0F S;  4S10 C;  1VKK A;  2LLF A;  1NLV G;  3FFK A;  2FH4 A;  1M2V B;  3A5N S;  1NPH A;  1C0G S;  3EGD B;  5FAE A;  1NMD G;  1NM1 G;  1PD0 A;  1WNJ A;  3CJC G;  2MOT A;  2VIL A;  5A1M A;  1CNU A;  3FFN A;  1EQY S;  4KED A;  3EH2 A;  5KYY A;  1JHW A;  3L50 A;  1M2V A;  2MV2 A;  4KEF A;  2NUT A;  2D8B A;  5L6W C;  5HVK D;  1D4X G;  5KYX A;  2LJ8 A;  2HD7 A;  2QTV A;  4PKG G;  4Z94 G;  3FG6 A;  3EH1 A;  1T3Y A;  1AHQ A;  5FAF A;  1J72 A;  2FH2 A;  5HVK B;  5DD2 A;  4LIZ A;  4PKH B;  1HQZ 1;  1PCX A;  3DA7 A;  1P8X A;  5KYN A;  1AK7 A;  3DAW B;  2NUP B;  2XF1 A;  1UDM A;  5KYX B;  3CJB G;  1M4J A;  1T44 G;  4CBU G;  1WFS A;  2FH1 A;  1DEJ S;  3CI5 G;  3TU5 B;  5KYW A;  2FF3 A;  4BEX 1;  1Q8X A;  1MDU A;  1KCQ A;  1T3X A;  1VFQ A;  3EGX B;  1CFY A;  1F7S A;  1ESV S; 
#chains in the Genus database with same CATH homology
 1COF A;  2NUT B;  5KYW B;  1YVN G;  2VAC A;  2FGH A;  3EG9 B;  3EFO A;  1SVY A;  1H1V G;  1M2O A;  4CBX G;  4JD2 H;  5IVU A;  1AK6 A;  3A5O S;  3EGX A;  2LXX A;  2FH3 A;  4PKI G;  1T2L A;  1QPV A;  1TMW A;  1WM4 A;  1X67 A;  1SVQ A;  2I2Q A;  3CIP G;  3EG9 A;  1RGI G;  3Q2B A;  2VIK A;  3EFO B;  1P8Z G;  2KVK A;  2W0I A;  3A5L S;  1PD1 A;  3A5M S;  3FG7 A;  4KEE A;  4CBW G;  1SVR A;  2FF6 G;  5KYU B;  1YAG G;  1TVJ A;  2XFA A;  1D0N A;  2L72 A;  1V6F A;  3EGD A;  2MP4 A;  5KYY B;  2NUP A;  5KYU A;  1Q8G A;  1C0F S;  4S10 C;  1VKK A;  2LLF A;  1NLV G;  3FFK A;  2FH4 A;  1M2V B;  3A5N S;  1NPH A;  1C0G S;  3EGD B;  5FAE A;  1NMD G;  1NM1 G;  1PD0 A;  1WNJ A;  3CJC G;  2MOT A;  2VIL A;  5A1M A;  1CNU A;  3FFN A;  1EQY S;  4KED A;  3EH2 A;  5KYY A;  1JHW A;  3L50 A;  1M2V A;  2MV2 A;  4KEF A;  2NUT A;  2D8B A;  5L6W C;  5HVK D;  1D4X G;  5KYX A;  2LJ8 A;  2HD7 A;  2QTV A;  4PKG G;  4Z94 G;  3FG6 A;  3EH1 A;  1T3Y A;  1AHQ A;  5FAF A;  1J72 A;  2FH2 A;  5HVK B;  5DD2 A;  4LIZ A;  4PKH B;  1HQZ 1;  1PCX A;  3DA7 A;  1P8X A;  5KYN A;  1AK7 A;  3DAW B;  2NUP B;  2XF1 A;  1UDM A;  5KYX B;  3CJB G;  1M4J A;  1T44 G;  4CBU G;  1WFS A;  2FH1 A;  1DEJ S;  3CI5 G;  3TU5 B;  5KYW A;  2FF3 A;  4BEX 1;  1Q8X A;  1MDU A;  1KCQ A;  1T3X A;  1VFQ A;  3EGX B;  1CFY A;  1F7S A;  1ESV S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...