5HVNA

3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with nad.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
354
Chain Sequence
SNAMISKLSVNPTFSPSYNIIVDSVLDFSHILEYVTNKQVLVVTNTTVAKLYLTKFLAALVDDLDVRTCILEDGEQYKSQQSLDKILSTLLENHFTRNSTVLVALGGGVIGDITGFAAAIYQRGIDFIQIPTTLLSQVDSSVGGKTAINHQLGKNMIGAFYQPKVVYTSIEFYKTLPQREYIAGMAEVVKYAFISKDFYLWLDSNRDKILAKDSVTLIEMVKRSCQIKAQVVAMDTGARAILNFGHTFGHAIEKCQNYRGLKHGEAVGVGMAQAIDFSHYLGLISQQQAKDFNDFIVSFGISIDFPNDICQKEFLEAMLLDNKELKFILIENIGSLSLQKQSKNELEQFLDISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
publication title 3.0 Angstrom Crystal Structure of 3-dehydroquinate Synthase (AroB) from Francisella tularensis in Complex with NAD.
rcsb
source organism Francisella tularensis subsp. tularensis (strain schu s4 / schu 4)
molecule tags Lyase
total genus 119
structure length 354
sequence length 362
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 5hvnA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hvnA01
1XAJA 1KQ3A 1NVEA 1VLJA 3QBEA 1NVDA 3CLHA 1NUAA 5EKSA 4RGVA 3QBDA 1NVFA 1SG6A 4RGQA 4RFLA 3RF7A 3OWOA 1DQSA 4P53A 3UHJA 5HVNA 1NVAA 1JPUA 3BFJA 1OJ7A 1VHDA 3ZOKA 1XALA 3HL0A 1O2DA 3ZDRA 1NVBA 2D2XA 1XAGA 1TA9A 3OKFA 1JQ5A 4MCAA 2GRUA 3W5SA 1RRMA 4FR2A 5BR4A 3CE9A 4QGSA 3JZDA 1XAHA 3OX4A 1UJNA 1NRXA 3IV7A 5FB3A 1JQAA 2BI4A 5K8CA 1XAIA 1NR5A 2BL4A
chains in the Genus database with same CATH superfamily
3BIOA 4MWTA 4I2VA 3NHKA 4YY3B 3CRRA 4PX3A 1CUDA 1QAQA 1ULSA 4LXQA 3AYXB 4JKYA 2XKJE 1QVWA 3LD9A 5FFMA 5EVCA 1Y3CE 1ZIOA 2I2BA 2PRYA 3HKEB 4IVRA 3VYVA 4BNDA 8ABPA 3KKNA 4EHFA 1RPAA 1NLZA 1E79A 3B1YA 5EG5A 1MD9A 1UADA 3UPTA 4YO7A 4P93A 3FSRA 5LZ5A 1Y9DA 1JSZA 2FFHA 4PYOA 3WYNA 3H5TA 1NF2A 2X9NA 4RF4A 3AUFA 3E0QA 2OCGA 3TOCA 1RHMA 4R54A 2P6UA 1GGKA 3VOSA 1YJBA 2A8YA 1B76A 1UMKA 2EYQA 3J7TA 1JG3A 2GBFA 4PO9A 3H9BA 2M9MA 2BI8A 2P91A 1EVIA 1JHRA 1XCLA 4PCUA 4LGMA 3UB2A 4CODB 2GPNA 2YIDA 4EDHA 1RI5A 2A9VA 1G3UA 1D2CA 3OP1A 4D9CA 4AUNA 3SC4A 4CEIA 1LW6E 2ZYDA 3T7KA 2O8FB 3L4BC 1ZUIA 1NAHA 5JATA 3FPEA 1T4CB 1T8RA 2CZGA 1QV6A 3KXLA 4IIEA 1N32B 1J39A 1ICIA 2V6GA 3AP3A 1OX5A 3E1KA 3HXKA 5F5XA 3U39A 1IVYA 2JJ1A 3KALA 1L5HA 2WWYA 2PYDA 4MLZA 3L8FA 1FTYA 1YDEA 4R1MA 3WLIA 1BMQA 4HEQA 3ITEA 2BM9A 1OBFO 3D1VA 1WOYA 2N47A 2GA9A 5CVUA 3TNLA 5JD4A 3A27A 9LDTA 4QU5A 2Q46A 3E05A 1HYBA 3EZXA 4FYYA 1YMQA 3EVGA 4LRTB 4ZDIA 2VZLA 3EIXA 2CJXA 5YASA 2M32A 1LF0A 5ENDA 4WK4B 1J0EA 1GU0A 2GVNA 2BGGA 5L45A 1R74A 3TKYA 1J5EB 4FNOA 5KNBD 3KEQA 3MWKA 1NWHA 1IIBA 2F7SA 2J3JA 3OVMA 2HA2A 4I6EA 1T4MA 1SBIA 2G0TA 4KWCA 1K08A 1RD4A 5L7TA 3H9QA 3LWNA 3V4ZA 3AW8A 1M5UA 1Y3FE 2VRWA 3AEKA 4V3CA 1LDEA 4NPAA 3INNA 3S27A 4AS3A 1AQUA 2OOKA 4G6ZA 2HGZA 2HHLA 2WJJA 3H2IA 2GK7A 3OLYA 3QKRA 4GMXA 4R8VA 3RTAA 2JFGA 5BQOA 5L3ZA 3EEOA 1U5CA 1RKXA 1UC4B 4A0HA 3WWPA 1DFHA 3NT4A 4JJKA 4J2TA 4TROA 4RIEA 4M21A 4RKWA 1SC6A 1OPRA 4PG6A 3TN7A 4ZVQA 1YONA 4OXYA 4W5OA 2VJOA 2HK8A 3L8YA 2JCSA 3NG1A 2CFIA 4LSMA 4MINA 1VP3A 2JHAA 2BFBB 3D0QA 4L07A 4ZVVA 2DHCA 2QP3A 1TUGA 3F9RA 4UHJA 2ZS9A 4PTZA 5KCMA 4LBWA 2X8JA 1TTPB 1GTZA 2VHJA 4GQIA 1ZUWA 4UASA 4BV9A 7REQB 1NLUA 2CCKA 2EC5A 1SHUX 3CJQA 3DWFA 3FCYA 4HMQA 5KWSA 5KYXB 1G8GA 1XIVA 2HTFA 3RU3A 4IX9A 1Y7PA 3SSOA 4ARSA 1Y3HA 2N46A 3DP9A 4FDUA 1Z4IA 4HDOB 4CTKA 2O2JA 3AYZB 3UXMA 4BEBA 5FBWB 4JROA 3GWZA 2RCNA 3KBOA 4DJFC 2WM9B 2WNSA 4P4UA 3NZEA 4QWMA 3LX8A 3CUUA 1BD4A 1SKYB 1BS1A 1O94D 2V03A 3T7DA 4K9QA 3ZQJA 1KYTA 1P4GA 1K3FA 5I7WA 2EEPA 3B9QA 3LC2O 4DAEA 4Y2VA 1BWPA 5SYMA 1MA3A 2YYSA 4AROA 5JNUA 3P94A 4E4RA 1UBHS 5D51S 5KJ6A 4G1MB 1U0EA 4F4IA 3VR2D 1FYWA 3EH1A 1TEXA 4CKYA 2FZEA 4E22A 4LYHA 1MV8A 4OTZA 4TMZA 2C2KA 1E9DA 4BQRA 1WSDA 1FQWA 3F5QA 4XXHA 2OA0A 2LE0A 2ZR0A 4HF7A 1V6CA 1WUJS 2D2VA 3P96A 3QKWA 5FTKA 2C1EA 1RBQA 3SOPA 1N2XA 2C2XA 2GXSA 3I73A 5DASA 1Z73A 3CVYA 2ID4A 4BYMA 1BQEA 3RHZA 5KSOA 1UKZA 1XCPA 1CY7A 2ODNA 4KE8A 1DI0A 2F9FA 1V39A 1Y9JA 5EJAA 1APBA 2I2DA 3IOYA 3OAAD 8MHTA 3QBDA 1LBTA 4NHOA 4P34A 1RHUA 2BGMA 4RPJA 4BNZA 4MIKA 1LNZA 2O0LA 3K6RA 1KAQA 3T3EA 1F8XA 4XASA 5AW1A 5EQDA 4BLSA 4XDGA 4WCFB 3TGLA 4MQMA 3GLUA 4IIJF 2A5LA 4L75A 4QDUA 3DFZA 3QFCA 4EHAA 5D84A 3ZK8A 1XPOA 5LA6B 1D1TA 4GI7A 4TXLA 5KNBH 1YCGA 4Q9LA 4REQA 3GBVA 1HDYA 3VR6D 2GPWA 2HEIA 4MPTA 4B17A 5C8YF 1CSEE 2C4KA 2HHHB 1XD2B 1QJ4A 3ZPXA 4BAGA 4LWOA 3M82A 5EIBC 1RBMA 2IYEA 5J5VA 4PZEA 1THZA 1FX1A 2HU8A 4EUEA 4QT4A 4H6XA 4C14A 2ZROA 4Q24A 1XQ9A 4B7CA 1DQNA 3NBMA 3OPYA 3QE2A 5BUSA 4Q02A 4KTTE 4MHSA 4I66A 1XTJA 1N2CA 1FDVA 1NBEA 2OTCA 5MN4A 3DPUA 3DEZA 4CTOA 2VLIA 3DYVA 2ZT6A 5H02A 2BEKA 3NBYC 2J87A 1NVKA 3T5AA 3RGGA 4W1RA 2JARA 2I7DA 4QU0A 1XQ6A 3QJYA 5FORA 5AKXA 4X8MA 4RHEA 2Q2NA 1J5XA 1L2TA 2XWPA 3KEFA 2NWQA 4HLDA 3K09A 3GLFA 2F6RA 2CKMA 1VXOA 1JR4A 4JEHA 4PYNA 4YP7A 5K3DA 1DLIA 3AF5A 3ZIAA 4MDEA 4CEJA 4X91A 1TA0A 3HR4A 4MWOA 5JCOC 3RM3A 3EQ2A 4IMIB 3B38A 2BN4A 4IOKA 2VATA 4Q5IA 3T3DA 4J9VA 3TR5A 1DIBA 1XX6A 4DDMA 1JEAA 4IV0A 3UBMA 3RCBA 3WI7A 1Y3BE 3LU1A 2DWPA 4RWZA 3WFIA 1VYHA 5LP1A 1DV2A 1SGWA 1JKIA 1E99A 4CMEA 2YQ5A 3MUEA 2EHJA 5AUQA 5F9MA 1WABA 3X43A 1Z2PX 1NAIA 4MROA 2A35A 3HN6A 4TS1A 4RIFA 5J2TF 3RBZA 4RELA 3T54A 5KEIA 2WJHA 3MCUA 1GL9B 2DKFA 1FZQA 3P9SA 4LW8A 2Z09A 1I80A 1QWOA 1K3TA 3U7FB 1XPRA 4GPTA 1X87A 3OJ0A 4OQXA 4PLWA 1E2JA 1VIVA 1UXGA 3O1LA 2G1JA 4PICA 1SG6A 4PIPA 4F3TA 1JG2A 2HSGA 4KIWA 2PH5A 3L82B 4G89A 4U2KA 3KFVA 4MV1A 2WWRA 3KKZA 5BSUA 4H15A 3TRJA 3UHPA 1ZICA 2VF2A 3RUAA 2OBXA 3TUJC 4ZGBA 5CCXA 1PZHA 3FUXA 4UMEA 1UFOA 1LGYA 1A4IA 5DLYA 4ZP1A 5A0FA 2D2XA 2EZ8A 3V97A 3Q7EA 4MKGA 3R41A 4QC2A 2Q0SA 2VTVA 4P98A 3IXLA 1FRFS 4Y98A 5EXPA 4OAQA 4OUDB 2IS4A 1GFIA 3E2IA 2OC4A 1TVCA 4UU1A 3WL8A 2G63A 1U3UA 2MSCB 2ORYA 4WNAA 3HB9A 3H11A 2IHTA 3AMVA 1C8BA 1NV8A 3ET4A 4BZPA 5FEUA 1X9HA 1SCUB 2AK2A 4MVJI 4DDUA 1F4PA 1VSQA 3SS9X 5K3BA 1T0HB 1Y98A 3BRWD 2OXEA 2Q2VA 3B6IA 4GWGA 4U9HS 3ZC3A 1R0WA 2XPCA 1B0UA 3FOBA 3AUJB 4MB2A 5BYBA 4CLRB 4C43A 1HRDA 2PIDA 2EARA 1KY4A 1XRNA 1XU7A 1XYVA 1T1EA 2GD0A 2WD8A 1A8IA 4P31A 4UZFA 4B4OA 4BQIA 3HBNA 4BO8A 2XYRA 1U6KA 4EO4A 4LYYA 5M3BA 1QPBA 4CWAA 1J06A 3NR2A 4FCCA 1BVHA 1EX9A 4KB5A 1UC9A 2ET6A 1SHKA 1AX9A 2WU3A 1QQ5A 3AOEC 3BJIC 2B2XA 2QTBA 3H65A 3LF2A 4ZT3A 1U04A 3DFKA 4BGDA 1XTTA 2C4TA 1HQKA 4IXNA 4O4JF 4QUKA 5E1MA 3K6SA 3W2FA 4Z9AA 4BKMA 4HZUB 4GP6A 3B1JA 1Z6YA 1K27A 3FGZA 3IT0A 5EMNA 3QI2A 4OQNA 3WGJA 4C04A 3SKVA 3LPAA 2NSYA 3E7PA 521PA 3BKXA 3SQLA 4MJ3A 3VO9A 5FYDA 2WG1A 4NE9A 1T9AA 2FMIA 5A9RA 1L5OA 3K0AB 1M7BA 1V0JA 1ZAKA 2D1QA 1PNRA 2YJ4A 2JGLA 4OQFA 2OENG 1FK8A 3OFND 4BBZA 4J76A 4G07A 1H0HA 1K8ZB 4JS0A 3C14C 1NRXA 4HEA6 4TTJA 3AX6A 4JASB 1P0MA 3SKXA 1IQUA 1SCIA 1VM6A 2C57A 4ZDWA 5C7OO 2R2AA 3IHKA 2R48A 5C80A 4Q7QA 4QTXA 1GV0A 3USZA 2AZDA 4KGXA 4H27A 1XQVA 5IBRA 2FOXA 3CLVA 3PFBA 3L0DA 3BREA 1AQIA 2QPTA 1A2OA 4FD3A 5KZMB 4EI2A 1V1RA 4CDMA 2ALJA 1P5FA 3LA6A 4KZKA 2VT3A 1JEOA 2WPDD 3DOIA 1SOVA 4RETA 1Q1GA 1HLGA 4LNUA 3HCBA 4U7FA 3LUJA 2HCTA 2YY6A 1BDIA 4N01A 1A8PA 1Z8NA 4GBJA 1JSXA 2AN4A 2HTEA 4J0JA 4U9IS 4KOEC 3U7RA 3WLQA 1PFWA 1JHAA 4A2PA 4AYXA 2XOEA 3V8QA 1T35A 3AF2A 2PT6A 4BNJA 3QE9Y 1F0PA 3IAFA 5JYEA 1NR5A 2Q1XA 4IDDA 2V65A 3VO1A 1KS2A 2XSZA 3CMCO 3QV2A 4NCKA 1E3QA 1ZOIA 1A8HA 3BRQA 3RQIA 5CLFA 3JARA 3TTXA 1RR6A 1K9VF 3ZKAA 2ZE8A 1KFEB 4TMWA 2VZ9A 4QFCA 3FCUB 4OK5A 5BYAA 5H9WA 5E3JA 5FWXA 4XVRA 4RD1A 5HIJA 5JS8A 3RIMA 4HZIA 1LFAA 2H2AA 5A4MS 5B12A 4MYRA 1I32A 1NYTA 2VH2A 3E6AA 1T4DA 3KR2A 1XVVA 2OFWA 1CZUA 1KI6B 5CX1B 5AQEA 3IIIA 5F7ZA 2JFPA 3ZDBA 4GO1A 3CEJA 4OHCA 1MHTA 3PLRA 4R2WA 1O58A 1LTKA 3MPOA 5CT9A 3PR3A 1BXRA 4LK2A 2H9AA 1OE0A 5IP5A 2QL6A 5BR7A 3MOSA 4IWNA 2PU5A 1IEQA 1JQAA 3YASA 2IU0A 1XVTA 3DFMA 4GXQA 1Y5NA 4JA0A 2VBCA 4IQ4A 2QQGA 2ZJBA 4F92B 1Z47A 3TIVA 2FWMX 3FRJA 4HQRA 4FYHA 1AGPA 1XHLA 1H1LA 5FTWA 1GQFA 4IIXA 1BDHA 2XNDA 3DLTA 3OT5A 3HYSA 1JF8A 1PHPA 5E4JA 3ZDZB 4XSGA 3GRUA 3HHPA 2JJYA 3DMFA 3HEMA 2EKLA 4K7JA 4XUGB 2AKEA 1I1OA 1ISMA 4X20A 1VSUA 3C70A 4TLAA 1NJSA 1IPFA 4BCDA 1XZGA 821PA 1NMQA 2FXIA 4YWJA 2BGLA 2NU9A 2CFCA 1KZ7B 4RL6A 1H2WA 1E3IA 3L7DA 1QZTA 4LMAA 1OGIA 4ZI2A 3NO4A 3MWJA 1W9HA 2C1XA 4KLNA 4ZVPA 1NJ6A 3ID6C 5FI0B 5HQTA 2BR4A 4O4IB 4RD3A 4U1RA 4YT5A 2ZB8A 2I29A 2CZCA 1OASA 5JE8A 2Z6UA 4IS2A 2NV6A 4BKUA 4OYRA 2DQ4A 2R44A 4NG5A 3UGQA 1RM4A 3IUSA 1AKYA 3HCOA 3DMTC 4R16A 4BGVA 4CRWB 1NLMA 1GRRA 3VNSA 3ES9A 2O07A 2WINI 3AUXA 1FTQA 2XJ4A 2ZIVB 3WMRA 3HCRA 1KYIA 1ZD5A 4O2AA 4P54A 2EX1A 4N6OA 1HNXB 3G0CA 3GJ4A 1FSGA 3JVVA 3LTEA 1PSDA 3GHHA 4M0CA 4MKZA 4UBKA 5JSKA 1E58A 3TQFA 3DD1A 4Q3EA 5KVVA 1UOQA 4MQEB 4DIBA 3I1JA 1TM7E 1OHHA 1Z7BA 1X19A 1C8KA 3PDIB 4PBSA 3G82C 3N58A 5ADWA 1BDMA 2QXUA 1A04A 1SCDA 4NAHA 1BKYA 5BSHA 1X13A 1E7MA 2MR5A 2WHPA 2OL4A 3W05A 4JBGA 1HT1E 1JX6A 4LC1A 2PCLA 3QPDA 1Z62A 1AZWA 2CUZA 2V97A 2WSBA 3PL5A 4RVNA 4FEAA 1QAMA 1NQ5A 2QI9F 3BQMB 1IEXA 1SEPA 4DJ5X 3I4LA 5J5CA 5JCPA 4TS4A 2YJ6A 2YN4A 5TGDA 2ZIAA 3PP8A 3WBFA 4YYZA 1KVQA 4JT8A 3SX2A 1FVOA 2QVXX 3QFSA 2QIPA 2DBQA 3IQHX 3PEVA 2CBGA 3B36A 4E11A 2XZOA 3BIWA 3H1GA 4JT2A 1NIJA 5JD5A 4MRPA 1V8OA 3IE0A 1L3CA 2UVPA 3E3NA 1E63A 1FFXB 3DVLA 1D4AA 3PE6A 2JAOA 5IYZF 6ABPA 1PCXA 3TLAA 1ETHA 2F62A 3ZTTA 4LISA 3NATA 3TZCA 2CKDA 4XYGA 4QTTB 1I14A 1ZA2A 3I3SR 3R3JA 4QAJA 4EDFA 1DAFA 5B37A 2BEWB 2WMNB 4KR7A 3DT6A 3OECA 1FNMA 3CLTD 3UWPA 2FSIA 3IERA 2VPQA 4YS6A 1II8B 5AVJA 4CL3A 5BQXA 2PQMA 4OB6A 1X1RA 1TMGE 2YZKA 3ILYA 4E5PA 2P9JA 5JJCA 1ESNA 1V7PC 1VBFA 2C9ZA 8ATCA 2V5AA 3A6KA 3I01M 1JQDA 3MUNA 4MVYA 2C5BA 4ZO7A 4KQFA 5HKOA 1B6GA 4I8IA 2AKAB 3EGOA 3MGBA 5CUQA 2B6HA 4GXTA 5A5GA 1N5RA 4CKWA 1CQJB 2WJYA 5G3ZA 1SHZA 2Q6OA 1F12A 1N0UA 3W90A 3GJ5A 4IHJF 3OOEA 3PFHA 5ALUA 3D8RA 2ZQYA 3PX2A 2ISSD 4M0DA 3SM3A 3OTOB 3L43A 4HAWA 1GCIA 2CGEA 3WYCA 5JHGB 4DA8A 2IS2A 1MTOA 1MZVA 2A0KA 1OV6A 1ZH8A 2QGNA 2WAOA 2AZ4A 5EESA 4Z6KA 3NBZC 4CTJA 4HT3B 2HBQA 2NO7A 1U9ZA 3C3JA 3FYCA 4KFSA 4RMGA 5LBTA 3FHTA 2WR8A 3I5AA 3GZNB 2YUIA 1L5MA 2BDEA 4AP9A 1ZHHA 1R6BX 3RIGA 5JRJA 1YKSA 3G5AA 1AUXA 4IIBA 4KODA 5BR4A 1JHUA 3TUZC 3Q3JB 3VNQA 3ZJ5A 3LGAA 4PQRA 1Q74A 3JYLA 3WK6A 3N6XA 4AD8A 3EX7C 2Q9CA 3A0UA 3BIFA 1I4LD 3BMOA 3BJMA 5ULLA 1CVRA 5J4KA 3OZWA 2PLNA 3KR1A 3ZBQA 4EX7A 1DHTA 1QF9A 1JIJA 5IJ9B 3AIIA 2YYYA 3U7EB 1E0DA 4B6EA 1LC3A 2BLLA 2Q0QA 4UU8A 2Q3HA 3UAWA 4BP8A 4HS4A 4BVEA 4L3WA 4EHIA 5ARBA 2P67A 2VDWA 3JQ9C 3ZE6A 4N3AA 4QJ3A 1P61B 3A1FA 2A3RA 3ENNA 1GSAA 3LGXA 4OH7A 4M46A 5BMVB 1NBHA 3MFYA 4HQLA 2WUGA 1O95A 2DQYA 2H51A 3GA0A 1EQUA 4M0FA 5JAPA 3HKBB 1I7QB 4TRRA 2HAEA 3T6KA 3EUEA 4OHYA 2KB0A 3G5LA 4TWJA 4UAVA 2EBWA 5L3QA 1QRDA 3REGA 4N0EA 1C3EA 1MNAA 2CLCX 4X97A 4C4RA 4URZR 5CFPA 1HZZC 2ISQA 2YASA 1JILA 4K03A 1H6CA 1LJLA 3O4RA 2B4KA 3C15C 1XMXA 3LV8A 4BLVA 1J6UA 2B61A 3NNNA 3PR1A 4QUBA 3K8QA 1ONNA 2IUYA 3STXA 2L69A 2ZB7A 2I4OA 4O02B 3FOFC 2XZDA 2WAAA 5H3CA 1XDDA 5AM3A 4IRXA 1M34B 3DOFA 2OMEA 4GG1A 5KIAA 1XEAA 4JVNA 3HYNA 1F9EA 1ZC3A 2JNWA 1YFKA 3BHJA 4ARZB 1JXMA 3DNMA 3AOGA 1D7AA 3EGEA 1UT5A 1UXOA 3A04A 1N2EA 2YHAA 4YRDA 4PN3A 2JFOA 1YJAA 4JU9A 3QVGA 5G40A 2E55A 2O0JA 3OQ1A 2DPHA 2RGAA 2XMDA 3TOZA 3PFWO 4I55A 4F8YA 2BLNA 4KQKA 2HXGA 4TM7A 1R0RE 2WOJA 4B73A 3ZDCA 1R0KA 4R1NA 1NRWA 2WTAA 1UJCA 4CMAA 4URVR 1YH3A 5LMCA 2EOAA 1L3BA 1R9NA 1EG2A 1HE3A 1CEQA 4NATA 1CY1A 5FJIA 1KEWA 1D5WA 2QK4A 3QMVA 3MTBA 4F06A 2NUTB 1KC3A 2NV0A 1JGTA 1P7CA 3P0HA 4YFVA 1XYYA 3L6RA 3Q4GA 4G25A 4INZA 3D54D 2X0IA 5EUQB 1SWVA 2CSXA 1ML3A 5L3SA 1D7OA 2Q9AA 1RQRA 3PF8A 4LPSA 3VKVA 4MDFA 3SF0A 5DN6D 4R40A 2TRSB 4AMGA 4EVIA 1T13A 4YYEA 2WNHA 3VZSA 1B2LA 1H69A 2BKLA 2RBKA 4MR9B 4Q1AA 3OJLA 4FLFA 1O03A 3REQB 1KKMA 3GJTA 3FTFA 1UMDB 4LIPD 1AK9A 4OJYA 3DBLB 4W9NC 1EZ1A 3HV0A 3V3KA 2PE5A 3UGKA 1E1MA 4DL9A 2UKDA 1RYBA 3UAOA 3KS9A 4Z0PA 1NJFA 2FR8A 2R84A 4WCVA 4U3JB 4Y2UA 1D4OA 1RWXA 3O1HB 5IAEA 4HR7A 5AM0A 1KXJA 3RVMA 3L4JA 2KWIA 1JPVA 1U0HC 4JELA 1AUQA 5K0TA 4G5RA 5BR8B 1NNLA 1CS0B 1W34A 3LUGA 1M6EX 2CVOA 1WZ2A 4J0DA 4ESHA 4ENUA 5CB4F 2R6AA 3FRHA 4BE7B 4DLVA 1U65A 3KYDA 4D41A 3NHAA 1G5IA 1ZGHA 2OCIA 1XPJA 3OBBA 2IPOA 5LP6C 1D9ZA 1QYCA 1SJ9A 3JR7A 4D8XA 1E5TA 4GMFA 4QGHA 4WKCA 4HNAA 1OI2A 2PWYA 2AG5A 5C8XA 2CC2A 1XP5A 1F5SA 2FPGA 2XWQA 3IHLA 4MW7A 4CM8B 3GLFE 1OU0A 1DKLA 3V1LA 3VXKA 4Q3DA 1UJ6A 3C24A 4TM8A 3ROGA 4XX1A 1E60A 3GCXA 4AQ7A 1NUTA 4MCIA 5FTJA 4KAXA 2XMPA 2C7QA 3AI1A 5LMUB 2ZRCA 3CINA 2WTNA 3F6PA 3ROXA 4EJSC 2D5CA 4INAA 1TIKA 1GUFA 1XAIA 2PYIA 3JZAA 2UZIR 3WMXA 4QGBA 1XZHA 2GILA 2A5GA 3D2LA 1DAOA 2G9UA 4UU0A 1MC5A 3JQQA 4DY6A 2BV3A 3TX2A 2DKNA 2Q99A 4KRGA 4B47A 4F7WA 4RK6A 1Q44A 3N2GB 5CA1F 3QVMA 2VH1A 3QIAA 4N49A 4DPLA 1ZD1A 3DFIA 1SC4A 3S2FA 4LDAA 5H4GA 2QE6A 5IFKA 4N65A 3VUFA 2HU2A 5ITZB 4UBMA 5IUNC 4AZWA 3BIXA 4L6CA 3G6KA 3H5AA 3A06A 2VCEA 5FP0A 1MQAA 3TSAA 2WM8A 4K6KA 2XB2A 1GG9A 3VR1A 2XBUA 1Y5MA 4DUPA 3PTLA 1QFMA 3KT8A 3K6JA 4QQFA 3TSZA 1SU6A 1Z4JA 2DPYA 5TSDA 1M2VB 3KDPA 1LV7A 4IJMA 4C7XA 4ADSG 4EAQA 4JYCA 4EB6A 1RQNA 4MQ4A 3TD6A 4AO8A 1D4ZA 1R6DA 5JZOA 3BE8A 1KKLA 1Y8RA 1B0ZA 4JJ7A 1PJRA 1MPTA 2HCFA 4KAAA 4KIJA 1E2BA 2N3ZA 1R9GA 1T3TA 4IJ5A 2C96A 2Q5HA 3WKBA 1UPXA 3SR4A 4LE2A 2QTZA 3KQNA 5BN1A 1DIOB 1YZVA 2MT9A 1I2ZA 2D2EA 1W25A 4QFBA 1K5HA 2D1YA 1W47A 1DQPA 4N8DA 2CBZA 2PO5A 2P3QA 3OICA 4EHJA 4WXPA 4H0FA 1VGRA 2GN1A 5F51A 1NPDA 1EFUA 3EOBI 4MWDA 3OWHA 3I61A 1I4OA 3HWSA 1WQ1R 3JVIA 3R0QA 3TLXA 4OSOA 3SHOA 5AI8A 4QOJA 4KREA 3F7TA 1ISFA 4OHZA 3JWEA 1DFIA 2OORC 2YJZA 4NCXA 4EFKA 1BA3A 1CNMA 4OBEA 1BVYF 1I24A 1SOMA 3F67A 3RU2A 5BRJA 3GLGA 5L6MB 4DYVA 4JQOA 2EG9A 2W4IA 5AH0A 1NQAO 4Q93A 2IUTA 2PX5A 3M34A 4LHXA 1XMQB 1YCDA 4HV4A 5A5FA 2XOXA 2D5BA 4HDRB 2DQSA 1C41A 4H7HA 1Q7CA 3RIYA 5J2UF 3S3TA 1KYWA 5H3LA 3TXAA 2ZBDA 1FDSA 3CNLA 4PO1A 4M7PA 1ZX1A 2NMVA 1AK2A 1C4WA 1Q17A 3LPNA 2WFLA 2CLEB 2YV2A 2VJCA 4IIJB 2M6RA 4ZQIA 1B8UA 1GGFA 3IP8A 3PS9A 5I7FA 3K0EA 1UCFA 3RLFA 5JFOA 2X3YA 3P4UA 2CVQA 1NW3A 1Q3TA 2V7EA 4LECA 3QX7A 4N54A 1OOEA 2R8BA 5IZCC 1QCCA 2IEAA 3DBRA 3O3MB 4R83A 1T25A 5C8YB 4HVCA 1YE5A 2VL7A 1IBCA 2NXNA 3BMQB 4XDYA 2MDTA 2C4VA 3T5DA 4FYPA 1KJJA 4FCTA 4CLXA 1JHYA 2HBYA 2ZREA 3CX6A 5B4VA 4RULA 3TBFA 1Y4SA 3G79A 4F4CA 3RC3A 5DNYB 4XWWA 3D6NB 4PZDA 2FPLA 2O3UA 3M3PA 1D0IA 3C2QA 3C5EA 1E20A 1IONA 2R8PA 4NH4A 3VDRA 5FWYB 4TL7A 1SOWA 1UPFA 4XR4A 5ECGC 4DLPA 2ZAYA 3TEMA 1T1JA 1WSWA 1GZUA 3AW9A 3UGJA 1CQPA 1SMKA 1ZIXA 3Q8LA 2O7QA 2AW5A 1YBHA 1K3UB 1FRZA 4JLVA 4YV0A 1NY6A 1D6JA 2ZYHA 4YX9A 3QVJA 2O8FA 2IS1A 1IXYA 3FRIA 4B48A 1M6VB 3N1UA 4BKRA 3OM0A 4H59A 2I4MA 3ZV7A 3ZR4B 4MA5A 2XOKD 5E2IA 4ASUD 3WV4A 3EPPA 2CMFA 1KO4A 4HDKA 1QHEA 2PYZA 3DOEA 1KOJA 2Y0PA 4LNHA 5EPEA 5T41A 4QASA 1EDZA 2NVUA 1KARA 4BO9A 4RPCA 4DV3B 1U9CA 4D2IA 3AU8A 2FRDC 3ROEA 2FLKA 3LVRE 1KI9A 5CB0A 2GCGA 2GM3A 2RI6A 3PD0A 1EM8B 1WMFA 1QCZA 2RSLA 2HQSA 2R97A 3HXTA 3LL4A 4UOQA 5HZHA 4RIHA 5C2JB 1R8JA 1E4OA 1VCOA 3JQ8B 3PENA 4I8XA 1T6XA 3WGKA 2O8DB 3K73O 4YRAA 3RUEA 1E0JA 3K0HA 2VNAA 1X15A 3UJBA 4D9GA 5JXIA 1M5TA 4MXDA 5KYGA 3U0VA 3ZIUA 2UXBB 4YXWA 4FR0A 4MOWA 4X41A 1VBKA 1ONBA 2WT9A 4LMBA 4KXYA 1OZFA 4PAWA 2H7XA 4LRUA 1ND6A 2WIDA 4BVGA 4JOCA 2OZEA 4YNBA 3C97A 3HCAA 1S3SA 5F3RA 4D9JA 2XMBA 2YKGA 2C7OA 2Q3CA 2VT2A 4M37A 2BEUB 1NM5C 4EMTA 3GFSA 2W0SA 4H31A 2DSTA 3IEXA 4MS3B 4PHCA 4QG3A 2X2EA 4O59O 2VRCD 1ZRMA 2BFBA 4LI0A 4CM3A 3OZDA 4FFSA 3E53A 3RUDA 4PRYA 4E2XA 7ABPA 2WBLC 2XYGA 2AFHB 5JJBA 1Y7LA 3OE7A 3WAJA 1ORHA 2PA3A 1Q50A 3G9UA 2OLEA 3S5UA 1EDDA 3LKZA 4IDPA 5H0IA 4A8TA 2HWWA 2LGJA 1P4JA 3K9GA 2GF9A 2WILA 1RFLA 1XMIA 3QSGA 4MVJA 1TIPA 3NCTA 5I47A 1PUJA 2WYHA 1NX6A 4DMLA 3IL2A 4ND5A 1JT9A 1XTIA 1W2HA 3KJNA 4K6MA 2WKWA 3F1LA 1I6WA 3TTSA 3TNJA 5AVZA 3G0HA 3ETLA 1EE9A 3RARA 5JJKA 1SQGA 5AW6A 1AM4D 1JHOA 1YS7A 2B3TA 2QM8A 4DB4A 3C1AA 4QUEA 4YRPA 4A16A 3Q0IA 3FFWA 3JQGB 3RKSA 4DE5A 4O33A 1RWMA 2W2OA 3HVJA 2JZCA 1Y1TA 4O4JB 3E1GA 1KZ6A 3VHLB 1Q6ZA 1S8AA 1HL3A 1VPEA 4ZRMA 4KV7A 1HOTA 2B4TO 5IJAA 3TAXA 1R8QA 2F1IA 5DWDA 5HA5A 1A9XA 5K8IA 4FOLA 4JSTA 1BX3A 4BQEA 2VK4A 1H8HD 2IITA 3S7TA 1HA3A 1CJVC 2R7AA 5HDQA 3Q3CA 3G7SA 2K7FA 1XHEA 2YOFA 5EY5B 4D8UA 1DTWA 3I30X 1D6NA 4Z3OA 4LF8B 3AG6A 1LSSA 2QROA 3E5MA 2E82A 2C42A 1FXSA 2QRPA 2ACWA 4HH0A 4QBIA 2QT0A 3UH0A 4DB2A 3VVMA 1J7KA 3PXGA 1WB5A 3X2SA 2Q4TA 3OM8A 2P75A 5JCZA 1H4QA 4UBJA 1L5YA 3CLUC 1RPNA 1CPYA 2F3TA 2FQXA 1P33A 2G6TA 2W2VA 3CRNA 2GYUA 5CFQA 4FMDF 4V1CB 5HKBA 3F6RA 1REQB 1FQOA 2AI3A 3TR0A 4DV0B 4HEA1 1LJUA 4G0VA 1E9RA 5EJGA 1XELA 3L18A 3TG8A 1Q0LA 4KYVA 1HNWB 1W5FA 3LQ4A 4BV8A 1C0IA 2VJYA 1VIDA 4KUEA 1G98A 4PM4A 5JV5A 1MW8X 2YV5A 1Q3HA 3ZQKA 3VU0A 1ZAYA 3UPUA 3LL7A 3ESRA 3HSYA 2GZ2A 1PS9A 3SHTA 2FUCA 4AP5A 4ZYYA 3UHFA 3NC0C 3I1YA 1R12A 2XCLA 3AHGA 4GBGA 4LKRA 2A3NA 4KKXB 4LCBA 5KS2A 2X1HA 4P7KA 1JJFA 1L7OA 4WUTA 3KZOA 1IL0A 3RE1A 2WA2A 3MK31 1C9JA 1TCUA 2PPVA 4OY3A 5GJCA 3TECE 2OVBA 1VHWA 3RS2A 1XZEA 2ZJOA 1DKRA 1UJ4A 3AEXA 3COYA 1SAYA 4YI3A 4BMNA 4I4TA 1HT3A 1W5BA 3L7CA 4MQ5A 4CM5A 2IPXA 5IK2A 4EI7A 1ZWLA 3JRWA 1ZJWA 1V6AA 4M83A 1IJBA 4QSHA 3AB7A 2RGBA 2W0MA 4ITVA 1RM0A 1MX1A 2HJGA 3LCMA 1RJ9A 1VJGA 4K9RA 4WOCA 4DLYA 2ZUTA 5EJ2A 4HVTA 3I6ZA 3R3HA 1T5OA 1V9LA 5CIQA 5AR1A 3J81k 1BMTA 1MO6A 4IKEA 3SZMA 4KUHA 4DXDA 3ONEA 1Y3DE 1N1DA 4DGQA 1UAYA 3MMPA 4KPYA 1Z5NA 1S1CA 1V5WA 3KSDO 3RK1A 1HDCA 1P17A 5JSYA 1TO1E 4QYSA 3EMDA 1SRRA 4J4TA 4URUR 3ZX5A 3DHVA 4YJDA 4G4JA 4E08A 5DNDA 2QN3A 4FGJA 3HWRA 1DPGA 3M33A 3MELA 4XSVA 3NHBA 4ZEXA 2XTZA 4C7VA 5L4LA 4PZYA 4BY9E 2G40A 1VE9A 3U3XA 5CAEA 2DP4E 1MX9A 1KRHA 3DF9A 4HMPA 3ZLUA 5LIRA 3RBXA 1ZS9A 4YUVA 1QLWA 5BV1A 4S1PA 3ORYA 1EK5A 3IT1A 1P62B 1M8KA 1TUEA 3DTVB 5H1YA 3T1VA 1IY8A 4RTNA 4YAEA 4YPVA 5IG2A 1XRMA 1DMSA 1GITA 1L7DA 4OAOA 4P3XA 1I2CA 3P0RA 1O5IA 1GT6A 5E9WA 4BXOB 3R9IA 2E2WA 2JZOA 5F1KA 4O3FA 5JSHA 1OJ7A 3AV3A 5TVKA 2FA9A 5H70A 1YUNA 2GK3A 3R77A 4OUDA 3FNHA 2WTMA 1NJ2A 4QGAA 3MG9A 4BQOA 4EUFA 4PGGA 2IU4A 4V0SA 4HD8A 5KOJB 1N7GA 1GQRA 1N5IA 5H81A 4EBBA 5EJEA 2PX3A 4IPTA 3AZPA 3QU4A 4K9OA 4KXXA 3T9EA 2H2HA 1N8NA 4ZMRA 1GNVA 5TY0A 4OK3A 5I7AA 5C0OE 3TJRA 1U4NA 1UK6A 2C9OA 2P0EA 3AXSA 2I0FA 4Y1RB 4YCCA 1OI4A 2QM7A 2SCUB 1RYDA 1K8RA 1M1YA 3HNRA 3NOXA 5FUXA 1IAQA 1OBCA 5FFFA 1O6BA 4QPNA 5TMPA 4LX0A 1WV1A 2IV2X 3LT1A 1J7JA 2F8LA 5JAZA 5G0SA 4E2WA 4ND3A 2BSQA 3G0GA 3QKTA 2L82A 4JODA 3CSDA 1BX0A 1QH0A 1GYQA 2R8XA 2XT0A 1DUIA 2SICE 1SWWA 3DZCA 2ATIA 3M6XA 3OEYA 4GIBA 2XT9A 2YOHA 3I72A 3KHKA 2IC5A 4UVIA 2OQ2A 3K70C 1R4MB 3MMSA 3DB1A 2Q9BA 3L0YA 2FG6C 2IIBA 4HZUA 5JYDA 4TWRA 1U1EA 1BWRA 4JC5A 3C3XA 3PXDA 5B64A 4B3TB 3ANMA 2VP2A 4N5MA 1Z88A 5IYZB 4MYTA 1JDUA 3ZGLA 4GLBA 2ZJ5A 3K0AA 4Y7CA 1QG4A 4NRDA 1DCFA 1UPUA 3AESB 3GJ3A 4PY2A 1KE1A 5J4YA 1PDOA 2V3CC 3RWBA 2WSSA 3CZQA 3VNRA 1P8JA 3KVVA 3MS2A 4WCDA 4KN8A 1CJKC 3Q6IA 1U9IA 3U3KA 4F04A 1CBUA 1QOQB 4YJKA 3EZ6A 1UPTA 1P6UA 1QC5A 3B6KA 3LQFA 4JL5A 1KYZA 5BNZA 1IXKA 4KMRA 5G4KB 1SKQA 1B7GO 1GUYA 2BFDB 3CPHA 3RH0A 1YNSA 3OT1B 5CLHA 2ZB4A 1LDBA 1SUAA 2DU8A 4IUDS 4L8FA 5DEIA 1NR1A 5K8LA 3SEZA 1G19A 2PR2A 5AOBA 2WM3A 2VQDA 1QYIA 4PZ9A 1V3QE 4JYZA 4QQNA 1UBGA 3CX7A 1GU7A 2XYQA 3O26A 1JIXA 1X1CA 3A1SA 1LBEA 2XB8A 4IHJB 2R4UA 1DKQA 3TLYA 1CULC 3QXGA 2C5GA 4XWGA 3R44A 1DTSA 3H17A 3S5JA 3ZVKA 1YXMA 3SXUA 2O3RA 4JVLA 3E3AA 2ZWMA 4Q05A 5C52B 1Z0UA 1T36B 2PUBA 1K75A 1Q16A 2FFQA 3S55A 1IM5A 1MFZA 1WEKA 3QEJA 1SXJC 1YZGA 2FAXA 3BZUA 1XLVA 3C1TA 2R65A 3ANTA 5F7OA 2K4MA 1V9CA 2ZOSA 4K9MA 4UE3S 5IS2A 4HC4A 3KQOA 2YV3A 3KJEA 3GRPA 1JNYA 3ETNA 1PV4A 3HLYA 3R8XA 1CEEA 1U1GA 1FP4B 1T1RA 3OOHA 3G2QA 1ZR4A 2MSWA 3ZDQA 1KJIA 4WN3A 1E1RD 2JJ1D 4BLPA 3W8RA 3P9NA 2QJOA 4QDKA 3C1OA 4KMMA 4I9HA 3SR0A 4BTEA 4C0BA 4ZICA 5J1SB 3HN2A 1KI1A 3I9FA 1E0SA 3MJCA 1DSSG 3TTWA 5CEJA 4P3PA 4MQUA 4ZTZB 4LF9B 3DSRA 1UFRA 2WUDA 1Q6YA 2I2WA 1MA0A 2K6GA 2OCBA 2QLLA 2V4MA 2W37A 4LJ5A 3PJGA 4L4XA 2QW8A 4M7RA 2W2LD 5D1NA 4YV2A 4CMIB 3KTAB 4X1IA 3FMGA 3GIWA 4FYXA 3UNXA 2JAXA 1BOOA 3C6ZA 4HWGA 4R1PA 4C7JA 5I3ZA 3GLQA 1LA2A 1NLYA 1TX4B 3KLOA 4OGLA 1RXVA 1Q12A 4OHKA 1FL9A 4R3NA 2PGNA 4KC0A 1P60A 2PXCA 1OX6A 5CTJA 2CV2A 3W6NA 1K7FB 1U7ZA 1X7ZB 5CLJA 1JFFB 3T1NA 5IANA 3FVTA 1EBBA 4ABTA 2KX7A 2JAHA 1SHTX 4GMDA 2QJTA 3OM1A 4L4ZA 5GADl 1ULUA 2VK8A 4G0YA 2JLWA 2CL6X 2Q0XA 5DK6A 1KAEA 1C3LA 2PS3A 2XNJA 2ZRFA 4GWLA 4GOMD 1ZOPA 5K3SA 1PR1A 1UXIA 3JYQA 2IYAA 2F3UA 2WJZB 3R6GA 2JCYA 1TZCA 2OHOA 1V8DA 4UEQA 1W76A 3R7BA 1Z8HA 4CN8A 2EW2A 1IATA 2QD3A 2X42A 3KD3A 3U40A 5J4LA 4OYHA 1R1DA 1D2GA 4PXSA 1I6LA 2QMZA 3RVRA 1HSZA 2RGXA 3K9CA 4JQYA 3K0CC 1KY5A 3G2KA 3NUZA 4RXTA 4R7ZA 2BM1A 3CH5A 4JR0A 4KO1S 5CM2Z 1EFPB 3UUEA 4M8KA 4WW0A 5BNWA 2NADA 1Z18A 3F6BX 3H4MA 1VRVA 1NMEA 3MAJA 1LY1A 1YB6A 1USKA 4BATA 2A9QA 3G5MA 3DLHA 3FHCB 5IXSA 1WM1A 4CCSA 4UM9D 2XXJA 1WXWA 2HI0A 1D1PA 4YRBA 3FCXA 4L8WB 5FD8A 1KDTA 3P2JA 4K3UA 3UJAA 2VP9A 5CYGA 3GLGE 1X38A 3AUYA 4PCAA 4ZU6X 3FLBA 3U62A 1OYVA 1WCXA 4DZTA 1SCKA 1OSNA 2I71A 2CJPA 1R0LA 1KI8A 2BFEB 1BIFA 3QHQA 3L02A 3QI7A 4OQLA 4Q39A 3MWFA 5CITA 1SB9A 1U2ZA 4R7GA 3IAM6 2RHHA 3KWJA 2OEPA 3TFOA 1FMLA 4ROTA 1BWQA 1KP3A 3WGZA 3WJ1A 5IXJA 1RJGA 4R0NA 1EEXB 4QPJC 1SRQA 4PX2A 4MRAA 3TVYA 1E6WA 2XE6A 1DPFA 1OFHA 3QH4A 3GEGA 3GXOA 1YJXA 2XTNA 4OKNA 5HZMA 1B3BA 5DZSA 1P74A 2UVQA 3ORQA 2WFZA 3AZQA 4KBYA 2B0CA 2F59A 3NFYA 2Z5FA 3DZKA 4JP5A 4MKHA 4LXXA 1UAGA 1BJTA 1NXSA 4YCDA 3W6ZA 1ATZA 1UDBA 4GVXA 1XTZA 4F45A 3V48A 2RGRA 3FPKA 1ATIA 1YE3A 5ISMA 2PRSA 1N5OX 2X22A 5FNVF 2X0NA 1LX7A 4GOND 3V00A 1TM5E 3GO4A 5GZ6A 1GZ5A 4ITRC 3OQHA 1TJ3A 3G2IA 1CQJA 3EZNA 4G01B 2ACEA 4KAFA 5FA5A 1GTJ1 3WK9A 4DLBA 2C3UA 4GRDA 5LZ2A 5FI5A 3FMOB 1Z15A 3C8ZA 3N8IA 4PQFA 1G2QA 2PRJA 4DXAA 3VR5A 4RFSA 2JBWA 5D1HA 4L2IB 2XMGA 3ZS8A 3OTGA 3FDZA 1LB1B 1PK7A 3SCZA 3JV7A 3B1WA 4X95A 3BX1A 5DT2A 1L4LA 1SXHA 1CS4C 1TCVA 1N1EA 2AX4A 3PI7A 1JR6A 3IR7A 4N5NA 1U31A 1W1WA 2HA6A 3L0CA 3DMNA 4F8JA 3FKSA 3T0GA 4L95C 4XYMA 4PO3X 5K05A 2FJPA 3AEZA 5DI3A 2ZDGA 4DPMA 2V6FA 1O87A 2QRKA 3V4OA 4UAGA 1EX6A 5HGXA 5F12A 4TT3D 4MKRA 2BM8A 4CUZA 4DZRA 5CA1B 3JWJA 5BV0A 2DB3A 3QOWA 3JQAB 4LBVA 5DBEX 3TEJA 4OF4A 3ZIAD 2HHCA 3AY6A 4P6VF 1EMDA 1QVRA 2V6MA 1RIFA 3E27A 2V0GA 1EESA 2OZPA 1QP4A 5A5DA 3FWHA 4B79A 1E1NA 4LHSA 1RKBA 3DZFA 3NGLA 3EZ2A 1N3YA 4WE3A 4HEJA 3KQYA 5ADUS 5K7SA 3TTUA 1IZYA 2JK0A 1TMOA 3KB2A 1QF6A 1JB1A 2GPAA 2FWRA 2DMRA 2FMHA 3BEOA 1DJOA 3H5IA 1VMKA 3ZH2A 4L27A 3SS8A 2DT8A 2PGAA 4RORA 4U2EA 4UDYX 3RF7A 1S3IA 2J32A 2HOQA 1QRAA 3A05A 3AF3A 4LXGA 5EFZA 2XCRB 2VSOA 3HA5A 4QGGA 2ZRIA 4TV9F 4C08A 5BN5A 4NJOA 1U8AA 1CKEA 6GPBA 5KHLB 1WLYA 1XKLA 2ECQA 2EBUA 1T43A 2G1AA 1YNOA 2QLJA 4H18A 3KWFA 4M1OA 2D5LA 4PLVA 4YRFA 5EWJB 2IH5A 4ARCA 2P1DA 1YBAA 2WMYA 3IMCA 4BAUA 3PCRB 1J49A 1KH2A 4ETMA 1EIZA 5JMOA 2QLTA 3EWNA 4OM8A 1KF0A 2ATEA 2GJ8A 3KHSA 4GX2A 2Q3MA 4X54A 1I9CA 4DVGA 2BONA 4DR6B 1ML4A 1SA0B 1XR3A 4XYEA 2PGLA 4QBKA 2YVAA 1E3WB 4NBWA 1Z4QA 4MJ7A 2AVNA 4MVJE 3RTGA 5BVHB 4HAYA 2A0UA 1W96A 5JYBA 2PWZA 1Z6AA 3NT2A 4Y0NA 2CSUA 4RJIA 3V1TC 1IQ0A 4P82A 1NW8A 3HXQA 1ZVVA 4KQCA 4ZVSA 3PUIA 1KIAA 2FR0A 3HJBA 5JI2E 3NHUA 3FETA 1D2RA 3QVKA 4ZRNA 4AN0A 5J2UB 5DCYA 4D0SA 1E4YA 2E18A 4DUGD 3JWPA 2ZUDA 5HOEA 3KQSA 3P20A 4JH0A 2FSSA 5G41A 1AT1A 5H5JA 4GGMX 3N2LA 4BEJA 4ZN6A 2YWHA 5CA0F 5I7EA 1K7SN 3GGDA 3N8KA 3UK0A 5DBOA 2BMEA 3QPAA 1B43A 2CN1A 3WHKA 1XNQB 4EB3A 2A94A 2NUTA 3W8NA 2AHOA 2PM8A 4DANA 5K3OA 5F1OA 5KYTA 1PJ2A 3FPAA 4NU8X 5GIOE 2H06A 4KK3A 2FEPA 4XIGS 4MHTA 4BMVA 3CB4A 1TZJA 1TTTA 3CTMA 4FXPA 4J75A 4F12A 1FSFA 3NTUA 4HFJA 4D1YA 2CHQA 3PHLA 4WA7A 4NQZA 2Y66A 1JB9A 1N8KA 3BB4A 2E4VA 4MYSA 3HADA 3UXEA 4YR7A 2H2FA 4KRXA 2BW0A 4S2UA 4UOEA 4YJFB 1CXZA 4MR9A 4DMCA 3Q5DA 2FH5B 3VFDA 3ZU5A 5FBRB 1QUFA 1QQTA 1BHSA 1K8YB 2EKQA 4HRVA 2PFSA 3M1LA 4CJXA 3T9CA 5LLSA 2XCSB 5J59A 3DMDA 4KLCA 4KFCA 1MB0A 4K28A 1KI7A 2RH5A 4LXHA 1AUOA 4N9QA 4YQFA 2RGNA 1RP1A 2R66A 2V5VA 5BUCA 4EHKA 1EGQA 2Z9BA 2A1TR 3H2JA 4XRGA 3FKJA 3CG0A 1HDIA 1WW8A 5EMJA 2LPMA 5D2CA 3WIOA 4WXHA 1B0AA 5F23A 3IUMA 4ZK2A 1DG1G 5LJIA 3EC7A 1P3Y1 3F4LA 3PIRA 1SBCA 1H22A 4LQ4A 3OZVA 1BGXT 1F2TB 1FMFA 1R15A 1J8FA 5JS1A 2X2PA 3QBJA 4OXXA 1C0LA 3V4PB 4MW0A 4D9IA 2VUUA 2PX2A 1KSFX 1FS5A 3M6IA 3H5WA 2DX7A 3UMSA 5E4YA 4DJJA 3ZEIA 3C3PA 3GVHA 2ZI5A 1G17A 1CZKA 4JVSB 4RDHA 2FI1A 4PE5B 5LKAA 1UBRS 2H52A 3CPEA 3ELWA 2QZ9A 3QX8A 4WDQA 5KCZA 1IUKA 5KYYB 4LGCA 1TZMA 2I3ZA 4FNGA 3ZX4A 4E46A 3DONA 1JG6A 2DTDA 1I0IA 1XEWX 1QF7A 2R1UA 2RGEA 3HYLA 3PUHA 4QQ8A 4QYIB 1IUNA 2TS1A 1WIWA 5BW6B 3BDAA 1QKJA 1ZCAA 1K1EA 2ENUA 4FM9A 2XSZD 5DGIA 3VSAA 1RRMA 1R64A 6REQA 2HF9A 3NTRA 4EO9A 4KSYA 1DBIA 3FOCA 5BYKA 2FEWB 4H7EA 4L74A 1R50A 2HNBA 4G1UC 3QV1A 4Y2HA 2DR2A 4ARAA 4ERNA 1SC9A 1FJ2A 3RYHA 3DOJA 4CVNA 3BWEA 1PEDA 3N2GA 5TF4A 4D42A 3QU5A 3G9TA 4N76A 2NGRA 2YH2A 3I5MA 2RAUA 5AKKA 1D1SA 1T8PA 3HQ4O 3OPMA 4L5CA 4WY8A 2AFIB 3WDLA 4X90A 3M6MD 4ROSA 1RVDA 2JI4A 1DLJA 2P8SA 1IC6A 3MRXA 1BFKA 4NFYA 1RXSA 1OZAA 2FRXA 4L28A 4QUIA 3I9LA 2KW5A 3AJEA 3CVUA 3S70A 1Z17A 4NJEA 4EFDA 4I1RA 3WWZA 2I54A 4EM6A 4TQ9A 3LUHA 5TQ2A 2QYTA 1YR2A 1JQ5A 2C95A 4PC7A 4GPEA 3TVTA 1CR1A 2J5XA 1ZN2A 4JI7B 3K0BA 2PH1A 2PV0A 4QBHA 4TUYF 5IF3A 5DEOA 1XHFA 4URYR 5LP6B 3I5YA 4OREX 3LT2A 2C83A 2HADA 2H1WA 3CO0S 5EQTA 3G7NA 1A88A 2P9BA 2VOEA 3PNSA 1KH1A 4UDXX 4EVSA 3JQDA 1F7UA 4OPMA 2KMLA 1PK9A 1YQDA 4EKGA 1U8UA 5C8VA 2X1LA 4L22A 2GEJA 4YAFA 1OXSC 1NLFA 2K2QB 3TMAA 1EK2A 3M83A 2QORA 3WWEA 1VDMA 3I9KA 2P9QA 2Q5IA 4INPA 4NBKA 3RC9A 1EVKA 1B6SA 1L7EA 2EU8A 2UZ3A 1CC1S 1G4UR 2VS1A 4TWAA 4YRRA 2OILA 2QAGC 4G0OA 1ESDA 1BX1A 3H2YA 1HETA 1V3TA 2F1JA 2RJOA 2OZLB 3JASB 2Y1KA 3WNVA 3GI1A 3RVJA 5H3HA 2XWJI 3P9ZA 1OUMA 2J5BA 2Q4DA 5CJ2A 1V5FA 3TD9A 3NW9A 3RS8A 1ELOA 3CZCA 3BWDD 3D8SA 3ZXIA 4BN0A 4C06A 4C3VA 4C0LA 4ECAA 3I01A 1XG5A 2FOIA 1PNQA 3OTWA 1VE7A 4Q4HA 1JPUA 4YMHA 1BXZA 3I2FA 1OHHD 5CD9A 1JA1A 3MCTA 1U0BB 1L5RA 2DY0A 4R68A 4COOA 3BL5A 3UN1A 4K9NA 2R6R1 3K0FA 5B7NA 5FLKA 1JSCA 2X9GA 3AJAA 2I03A 3E5HA 1LUAA 3GCZA 2H29A 4W5QA 4E5MA 3X1DA 3EZ9A 1HYQA 2AZTA 5JPIA 5KTMA 1EVEA 1AURA 2GN9A 1QE5A 2J6HA 2VNSA 4A10A 4CL8A 5BWNA 5K01A 1LVGA 2XWSA 4BTLA 1NNI1 1T6BY 5EC8A 1TXGA 3EEIA 2G9RA 4EW3A 1JIUA 3TZHA 3RSHA 1P7VA 1T10A 2P3LA 1XSEA 1AV6A 2K5UA 3VV2A 4IRMA 2OHIA 2AC7A 3OU7A 4LC0A 2YJNA 5DWQA 3FLEA 3O5AA 2CB9A 5ICSA 2CEAA 4AZ3B 2QMYA 3E5NA 3EWAA 1QMGA 2QX4A 2IE8A 4RMNA 3DZBA 4GVLA 2JVJA 1K97A 1QXSA 3TNFA 4NY1A 3FWYA 1YS1X 1DIAA 1DC6A 3EF1A 1MB4A 3EHDA 3KVOA 3RB8A 3S1AB 3GDFA 1JU9A 1DAHA 4YN3A 4QQKA 3L8DA 5CLQA 1J23A 2QR5A 3BBPA 1G20B 4JSYA 4KSBA 5I9SA 5HK8A 2OO5A 1WXQA 2ZAOA 1KZGB 2F48A 4QEKA 1SCBA 4ZAZA 4ZKEA 4W5JA 1WY7A 5BXYA 5EJ7A 4MV6A 1FYXA 1I1NA 1QDLB 3ZW9A 3ZXXA 2QLBA 3FDIA 5AJUA 1M73E 1XA0A 4DC9A 3NWPA 4O2RA 1CFJA 2B1IA 3A6JA 3WLHA 2GTIA 5DCLA 1KRXA 4Y9UA 1G8JA 2O8DA 4MO2A 3KHUA 4GBMA 4X7PA 1YAHA 2J4DA 4K9SA 1Z06A 2BR5A 1DJQA 2F2TA 2VWGA 3CLKA 3LCJA 2V0CA 3NXKA 4WOBA 4XLLA 1N3BA 3FZQA 3WIUA 1KQGA 4TYNA 2QVCA 5LU8A 5IW8A 3F2IA 1XMJA 4IRUB 3H1AA 4PNZA 4O4LB 1Q1QA 3W7VA 3BMXA 4IMJB 1EWKA 4BL5A 1ZVQA 4CQLB 5C35A 1OVMA 4FZVA 3HWWA 3E8SA 1JDSA 3L04A 3IIKA 3H1EA 4WY2A 2WIAA 3AKEA 5CDFE 3UHJA 3STUA 3TIIA 1J0BA 5HK9A 4TZ6A 1KK3A 1VL1A 2BEUA 2JIMA 1AKWA 3VHQA 3WKAA 3RD5A 3W5AA 1E1QA 5ALKA 4D8VA 3D2AA 2V7VA 1OTXA 1T9ZA 3E18A 1VHQA 4ANFA 4RMJA 5IT5A 3L4BA 3PX3A 4YT4A 1GADO 2XBMA 2Z5VA 2PZLA 3IUQA 2AFHA 2ZTLA 2H59A 4ZCLA 2GRJA 2OV6A 4X84A 3LLUA 2H2GA 1A76A 3MN1A 4JXZA 5F98A 3NDBB 2VXBA 3ELDA 1GPDG 5DYNA 1L5KA 1AHHA 3GH3A 1JA0A 1UJ5A 4MUIA 5FI1B 1TADA 2YQ4A 3HCFA 3INTA 4LSZA 5F21A 4EL0A 2AEMA 3BTSA 5F35A 5H80A 4B3GA 3PQCA 3BILA 2Y76A 3FZGA 4FHDA 5AKHA 4O3MA 4GSYA 4D25A 2DECA 1QRSA 2YMLA 2PBFA 1U6IA 4P58A 1GN9A 4FE4A 3RTCA 5KVCA 3HFGA 3W79A 3HVUA 4A6EA 4KH0A 1PJLA 4FHGA 1FNNA 1GGNA 2XGGA 5LQSA 2OLJA 2VK1A 1JDZA 3DEYX 4ND4A 3JQGA 3UJDA 1XZDA 4D8TA 4ZHQA 3BFXA 4AJLA 3THXB 1Y8AA 5IF9A 2J85A 3VPFA 2A9FA 4NI5A 5IAKA 4ALKA 2JLBA 3ZU4A 1M54A 3W5IA 1KH3A 4OG2A 2XA9A 1PO7A 1RRPA 1FVHA 5I6DA 4R1OA 2WZQA 4AT1A 1GQQA 3C7DB 3EIEA 1FE8A 4TT8A 4J6FA 1K4YA 1YBMA 4Y1GA 5ILGA 2Y1WA 2D62A 4JCCA 1BS2A 1MH1A 1N5KA 3VPDA 5T4FA 4QKQA 5IKPA 5HYVA 3EFOA 1VQ1A 2G8LA 4J7AA 5TPZD 4AS2A 1M3SA 2V6JA 2ZR9A 1E8NA 5T4EA 1N8SA 5EIWA 5FB3A 1RLMA 2EQ5A 5A6VA 3U4AA 2Q7OE 2JLQA 4EA9A 1P1BA 1QHGA 1CUWA 4CF4A 1R00A 1XKTA 3WHPA 4C7OA 5BNIA 4NICA 1X7WB 2CVPA 4BFLA 1N3IA 3N0VA 2ZAIA 4JZYA 1QFSA 4MUKA 4V1CA 1WE2A 3G17A 3OQJA 1QB7A 1RTTA 1L1FA 5JZBA 3LRXA 4OHVA 3DDWA 1JE0A 3ZWPA 1U1FA 2R5WA 4RQBA 3T95A 4BRUA 3C41J 2DFPA 2HDOA 3O9VA 3B3QA 1Z13A 1ZGGA 3HJAA 3MS7A 5DYWA 1MAWA 1GL3A 1QYDA 1G8KA 4C4YA 1VHJA 2QXTA 3KPUA 4XH9B 1Z6QA 5T8KC 2WSLA 1G5FA 3AR8A 4J2HA 5B1DA 4I1SA 4S1TA 2HH9A 2VSYA 3T1OA 1Z63A 3E2PA 3OZIA 1FU8A 1N9KA 2NSJA 2VYFA 4M76B 1YD7A 3NI2A 2IYNA 2P0AA 4GLJA 2BT4A 4WOPA 4D9MA 1L8XA 5MGNA 1SQSA 4ZAWA 1NBAA 2FB9A 3EXIA 4FINA 10MHA 2QG6A 1QIEA 4U2CA 3VX4A 1Z56C 1NBMA 3TLGA 4IM7A 4US0R 2B34A 4E51A 5I3CA 3ER9A 2CV0A 2DETA 3SC2A 3M9XA 4ZEVA 5SV2A 5TMEA 3TW8B 4ER6A 3BGOS 3ZWNA 2PMBA 5TT0A 4JB0A 1KZ4A 5TDHA 1FPMA 4R2HA 5JMPA 1MFPA 1ONSA 4ZO6A 3B53X 5ARCA 5DGHA 2CCJA 5HRUA 2I4RA 4BWVA 4LZOA 5KAMA 4BCBA 2GAJA 1FYEA 1MAVA 1BRMA 2CUKA 3NH9A 4S12A 5GV8A 4KQ9A 1FUIA 1HTBA 1Q1BA 1RWWA 3R7WB 1UBNA 4D4GA 1RJFA 1H5QA 4AYWA 2Q45A 1E32A 1L5QA 3O4FA 1PQPA 1O0BA 2XXAB 4JVMA 2IZ7A 3JQCA 1X77A 3PNLA 4E5UA 4FI3C 3CEPB 2NTYC 2A1TS 2C7BA 2B2NA 3LY9A 4CNQA 4BIMA 2MMCA 3RV3A 3ZUPA 3VH3A 2J33A 1DBVO 2XDAA 3WGGA 1JYSA 4ZVLA 1H4SA 3F7NA 4B80A 2FPMA 4HVAA 1U9JA 4JLBA 1MP0A 4QDOA 4GOOD 3DHNA 2I4IA 1E6LA 1EXWA 2R00C 3OG9A 4L8GA 3BERA 4JLKA 3VU9A 4I50A 3DTVA 4XGRA 5IABA 5CNIA 5E1OA 3UOGA 2BJHA 3KSUA 1GNLA 2F3RA 5MDHA 3H2KA 2I80A 1C1XB 2QTWB 5FYQA 3OTHA 4X71A 1U7UA 4WWHA 4EF4A 1T3ZA 3MFQA 2ZSEA 1E9CA 2HIMA 3QLUC 2A6PA 1WLSA 3GGGA 4G5FA 3C3BA 4I9FA 4Q15A 3ZQUA 5L7WA 2YBEA 5JNLA 1AKRA 5AHWA 1ZG3A 2Y71A 3L9XA 2DC1A 2ZITA 3T8YA 1XLTC 2WP0A 5THXA 5CLLA 5EYPB 2IYRA 5KOJA 2IL1A 1IDOA 4FC6A 4RZXA 3VAAA 4LGVA 1M8PA 2HLDA 1H2YA 1JR3A 3X3HA 5JCOA 1CNFA 1OVGA 1YJCA 3JQBC 3EOZA 1FW8A 4YJ2F 5EP4A 5L95A 4Z0TA 1L7BA 3HP1A 5DBFA 2JI7A 3EUWA 3EGWA 1KAHA 1KJ8A 4MDHA 2EJVA 2FWBA 4IMRA 2IYFA 5AKLA 3MWDB 3B82A 4KAJA 2V8OA 5P21A 2CDAA 1VYVA 1JSRA 4GX1A 1EFDN 4AJPA 1VPWA 1C2TA 1E6UA 2Q4OA 2XYHA 3FUWA 3SEAA 4ZO9A 3RRYA 5ES4B 3EULA 3V1NA 1E2UA 2GAFA 2QMUA 3ACBA 3WRYC 1VI6A 3AIKA 1ODIA 2GO7A 2G5TA 1WTCA 4XM0A 5IZ4A 2GM4A 3MEQA 3AFIA 1X9IA 1DXHA 2P6PA 3G0IA 1W29A 3IP9A 3QVSA 4KR9A 5IUJC 4J8PA 2XE8A 3OJFA 3AJ9A 4NZYA 1F9AA 3C7KA 3IHWA 3LPMA 3DS8A 3O8CA 2KHZA 3RSZA 4BB9A 2DPGA 3TB6A 1U98A 4EFLA 3DDCA 4KVZA 4JLPA 3GRFA 1P6QA 2V5UA 2FEXA 1P44A 3A6ZA 4BPBA 1ACLA 3GDOA 3OZUA 1ZI6A 3VR3A 3S1SA 1R2QA 3S7ZA 1PAUA 2FPIB 3WSWA 5BSVA 3D7RA 3E81A 2G04A 2ZIWB 4BDTA 2Z8ZA 4U6QA 2H1SA 1NV9A 1G6HA 3ESYA 5FNVB 4Q7KA 3OT1A 4Q34A 4CM9D 4Z0NA 2VNJA 1V1JA 3V33A 2IQIA 4KL8S 3UWSA 5AP9A 4YRLA 1VE1A 2CJFA 5KSYA 1VGVA 1Z34A 1GPKA 1MABB 4PS0A 4M55A 1W93A 2HV8A 3P2IA 1EG7A 3H18A 5D3MB 2VQEB 1CYDA 1RYFA 3AJRA 1Z5OA 3GFGA 4BLQA 4FGKA 4B7ZA 2CNBA 2AMFA 4D3XA 2FSPA 4G1FA 4KPEC 5C51B 1E2HA 1LK5A 2FDXA 2FP3A 3Q11A 3U4DA 4TS3A 5SZJA 3THWB 1PT5A 3EG9A 5E95A 4F9EA 1K6JA 3AOEA 4EGQA 1IHOA 5ALQA 5A03A 2HRBA 3LBFA 3MJTA 1X2EA 3ESDA 5IN4A 4V0OA 1MRZA 1NQWA 3AGQA 3GD5A 3LC1O 3G1UA 3PNBA 4U5XA 4WASA 4AJIA 1XRLA 2Y1LA 3O84A 2OSBA 1P9NA 5C8DA 3LCUA 1JW9B 1FC0A 5AJWA 4PFSA 2EG5A 4NPHA 1FP4A 1SIOA 4IO0A 3JZDA 1Q1AA 2JPDA 2IW3A 2Z1DA 4NXNB 3JQAD 3RVBA 4JI2B 2OB2A 3E23A 1T8SA 4M2LA 1EHCA 2W4MA 3F3SA 3CPJB 5LKRA 4PHGA 3U5TA 4YMVA 1UMBA 3ERCA 1WZNA 1ABFA 3U3MA 2BGRA 1GNQA 2JD0A 5B7GA 2H07A 1E6MA 1PW7A 3BC1A 5LUAA 4DV6B 1DGQA 1FFYA 4YCMA 5HKAA 2ASEA 2XGJA 1YRQA 3LHKA 3AF4A 3TNYA 4CMIA 2D1RA 2NVOA 1Q22A 3S2UA 2HMAA 2YNMD 3AILA 3ZD6A 3KDSE 3PXAA 4K3VA 4YBRA 3DV0B 1OREA 3PC8A 4NMLA 4MWCA 2B4YA 4TV9B 1SU8A 4GXRA 5KU1A 4AAYA 4MV4A 2QTCA 1VC2A 3IAEA 3EIHA 1ZD9A 3MCWA 4RTMA 1RW4A 2OOSA 4X64B 1B26A 2J41A 4Q3LA 4XPZA 2AVDA 1YF3A 3ABIA 4HVLA 3KV1A 3RUPA 3T3NA 3C6QA 1X7ZA 3Q8MA 1IRIA 2ST1A 4PW0A 2JC3A 3EN0A 3IEMA 4IH4A 3FPLA 1YTLA 2NVBA 3WX0A 3WFZA 1U63A 1SXJB 1TRKA 3C6MA 4E13A 3C7CB 4PO8A 1VCIA 4D9FA 1Y7IA 4IDAA 2Y68A 1HDEA 3FNGA 3DBIA 1JBEA 3NAMA 1KKUA 1Y1SA 3AR7A 3VAZA 4AXBA 5JPCA 3ADCA 3HFSA 4EYQA 3OH8A 4F9FA 1ZL0A 2QYHA 2GD1O 1ISJA 1YCFA 1RVV1 4OI2A 4UBLA 5E3IA 4X66B 1UF9A 1GYPA 2YRWA 4JLMA 3O38A 5EPUA 2ROQA 3IH5A 3VSEA 4OFWA 3CUSA 2O05A 4RZHA 3Q1KA 1T1SA 3VDNB 4LVOA 3D3KA 4F72A 3DM5A 3MMZA 1N6OA 4C0KA 5BN3B 2KM1A 3QG5A 4ETIA 4DCPA 4EG8A 4EY3A 4UQLA 1G59A 4H6WA 4NULA 1LXCA 3GRZA 5EKTA 2QVYX 1P29A 1XYGA 5IM4F 5CA0B 5EE5B 4CMJA 2B2CA 1MZPA 2QBYB 2BD0A 5SYNA 3GUYA 4N03A 1NYQA 4DC1A 1ZCFA 1TQ4A 5B7PA 3TF5A 4J0FA 1PBTA 1PR4A 3PKIA 3ZWQA 4TN1A 2VH5R 3FDXA 5LQAA 2W43A 3K2QA 4IZ6A 4NHEA 4V3BA 1PVVA 1SCNE 1GD1O 1TF2A 1XCBA 2BVNA 2D13A 3EAFA 4IY1A 4P7JA 1C9DB 1TT5A 1MO5A 4DTIA 2AJBA 2YFYA 4Q3NA 1WSAA 3PPYA 5ETJA 3VOAA 4D81A 1EGVB 4D5EA 1XVIA 1M2HA 3LQYA 3TM4A 2Z4TA 2W2XA 1K5DA 3W2HA 4W5HA 2BFEA 3BXXA 3IQXA 5H82A 2AS0A 3I5UA 3PPXA 3MGAA 4QDZA 3WGMA 1FQKA 4CFYA 4X6XA 2Y1GA 2IHKA 2Z2XA 1F2UA 4IKOA 4JP8A 3KX2A 4ND7A 2I62A 5CK4A 1ECBA 1AS3A 1CQIA 1VG1A 2VKTA 3BFVA 4J6EA 3PTAA 4DMKA 4BS9A 3BGIA 1TUBB 4HNUA 3SZUA 5LWQA 1DOHA 4LY0A 3G02A 5EJMA 2C4WA 1CUCA 1JVSA 3LYHA 2E4XA 2QP4A 2CXOA 1J21A 1E0KA 3NVAA 4NWIA 1ADCA 4OV6B 1XNJA 1RNLA 4QXAA 4E03A 3IVXA 4EKYA 3TGPA 1MG5A 2NP7A 1ZJ6A 3K2IA 4HMOA 4HLCA 2F90A 1E7WA 3DMTA 5IH7A 5AHKA 1L5WA 4OAPA 5HXAA 3UMFA 2BHSA 1JPNA 2WD7A 4KLZA 5AHXA 2CXQA 2ZJ3A 2BFFA 3R0IA 2WF8A 1HT2E 5JVDF 1JKXA 1ZNZA 2W6OA 3RRBA 2Z95A 1U3DA 2I66A 1TK3A 3DV2A 3RWOA 1GPJA 2FQWA 5B5SA 2CDBA 1V4NA 1J33A 2DUUA 4C29A 1OB5A 1EUQA 5JCJA 2ZJ0A 3ENZA 1NFRA 5C37A 3EXEA 4TXMA 4JIGA 4Q18A 3FE2A 1WCWA 1LC0A 4ZT4A 4N41A 1QSGA 3AKCA 3PUXA 4LXTA 4DLRA 4AKHA 3DL4A 5ADHA 2VP0A 4XARA 3ETJA 5FJJA 3GFQA 4W99A 2ZS8A 1DOAA 4O8CA 1SKAA 4UXIA 4QTUB 1RHRA 3TL3A 4XJTA 2XF2A 4H4DA 4R84A 1LRJA 4K6HA 5A2QA 1YI8A 5AVXA 2FWAA 4X1KB 3C8MA 4HEHA 1K4MA 1RLJA 1XBTA 4HDSB 3M7IA 4J29A 5HF9A 3U56A 1S1MA 2XA1A 3AERB 3IKMB 4UZEA 2OM2A 1JFTA 1U2PA 4JX9A 3HU5A 5J63A 3DOHA 3FAKA 4IYJA 1Y3IA 4A1OA 1I7SB 3B9RA 2P69A 3KUXA 1C30B 4TWZA 3L4SO 4GS5A 1YHZA 1F14A 3HVIA 4LYEA 4REMA 1KOFA 4O0LA 4BCCA 3P5SA 1ZU5A 2VYCA 1Y89A 3KZ1E 3OMXA 4DCJA 3SD7A 5AUNB 1JDNA 5ED4A 4B3RB 3ISJA 4C3OB 1M1UA 1NPYA 1E18A 2DBYA 3DTTA 2I1QA 2NTEA 3IYLW 1MKYA 4KNWA 3N53A 5DTIA 2WJVA 1I0ZA 2E37A 1NVVR 2H5JA 2NUPB 3LOPA 1ZJ5A 3O2NA 1E9AA 2HJ9A 2XUHA 4NOKA 5FLEX 2IIVA 3M9WA 4Y6LA 4F93B 1JU3A 2DT5A 1HG1A 2BGKA 3KQLA 3DWIA 2C4HA 4LS3A 5FPPA 2E3JA 2HXSA 4ZVNA 2WNIA 3ZWWA 3U44B 2PKWA 2G4VA 3E8MA 3M4XA 3PD7A 3ONVA 4NBUA 2Y2VA 1DX9A 4L50A 4TUYB 4TV8A 4JC4A 4L3OA 4TXJA 3WWDA 4RTPA 1MMFB 2L17A 3DPIA 3HJCA 4C6TB 4ER3A 1KQNA 4LE1A 3L05A 1Z36A 2B83A 3OWOA 2P2NA 2WKQA 3EIQA 2JI9A 4EKDA 4IOLA 4BQFA 2VG8A 4PQEA 4BFWA 2X7JA 4RHUA 3KVRA 3GCGA 3I2HA 4LHYA 4YP9A 2AFHE 2JBAA 3GRYA 2VT6A 4KV9A 3SDZA 3PICA 4Y9SA 4BFYA 4MRNA 2WWVD 4RD6A 3MXTA 3K7EA 4V24A 4RNCA 2WK1A 4IDEA 1V16B 3PXUA 4X8OA 1H2RS 4R5MA 2N42A 1IN6A 1WVIA 4KQWA 2WU4A 3WWOA 4OOEA 2G08A 3A37A 4CI0B 1BA2A 2E4UA 5DH9A 4XVUA 3DE2X 4HXGA 4Q12A 4DLZA 2NUAA 3PFKA 4INJA 3VNBA 4YTEA 3FLAA 3LTNC 1S8NA 2OFPA 3AF6A 3H0CA 5JSZB 4KO4S 3DDNA 3LP6A 5CDGA 2J7KA 4GSKA 2NX2A 3CIOA 4KQ6A 5FL7D 3FZEA 4CIDA 5LYJF 2X9VA 4DLAA 4IDFA 4A82A 2Z2IA 3KU4A 1COWA 3BD6A 2BOVA 3IQWA 2DEUA 2LXNA 2Z08A 2GNPA 3LPDA 4LWZA 1YFLA 4P81A 1FUEA 1XAHA 3WJ2A 1FQJA 3R5KA 1ZH4A 3LQRA 4QXQA 3DMHA 3M3DA 1KYQA 3II6X 4J4HA 5JJ5A 1NW7A 3AR3A 2IZOA 2PUJA 1YIOA 3IP1A 3PUKA 2KSQA 4FWBA 4MLPA 1CZNA 1R6UA 3FWKA 3UF0A 5BPHA 2IDKA 2GPTA 3KOZA 5CTAA 1MGOA 1Y5LA 5AK3A 1ZR2A 3KVYA 2YWCA 3LX5A 1ICEA 1OXVA 1VFNA 1THMA 3T4UA 1C14A 4QPDA 4YMUA 4Y9RA 4CMKA 3ZTWA 1HZZA 2ZRBA 3LY5A 4JWKA 3RC1A 1TYBE 3A1NA 3PT5A 2CLHB 5BYJA 1EDBA 3QLJA 2B1RA 4EABA 2PZFA 1V11B 4ZTUB 1U2GA 1MJGA 3LUFA 5ITSA 1QPGA 1WUYA 1GYRA 3R9XB 1YHYA 2FWIA 2QRHA 1BDJA 4TYWA 3GLSA 2LNDA 1UBLS 2L18A 4I4NA 4TVBA 4WJKB 4CBVA 1MXHA 1JLKA 1WB6A 1WD5A 1XEFA 2FF7A 2FR1A 1NMYA 3DDOA 3LVQE 1G5HA 4LPKA 4HP8A 1WF3A 5LBUA 1JTFA 5JHHB 1C9NA 3EY4A 1OROA 3B7GA 2WSSD 4D6XA 4KO2S 1NQUA 4O2BF 2AJTA 1DAPA 1FDOA 3CXUA 3W5JA 1EFAA 1W48A 2GQ0A 3L7BA 3R23A 4BGIA 4OD0A 4C89A 4C0JA 1YT5A 4MLDA 1V45E 1US8A 1ENPA 1NP7A 3F47A 5HBGA 4G4SO 1AS0A 1JFRA 2YFKA 3V34A 5T7BA 3ZV4A 4QBFA 1DX4A 1F2TA 4XVHA 3GLIA 4ZYLA 4KYUA 3HJGA 4U7WA 1H0RA 2C31A 1UPCA 2GAOA 1FZTA 4O2LA 4BC0A 5CDYA 4RCVA 4BJ3A 2FZVA 2RMKA 3OF2A 5HIMA 4UMDA 1YVPA 4F46A 4PNHA 1DUVG 4BKPA 1RYHA 4DAOA 1JAYA 1NBME 5CM9C 5FUMA 3LZ6A 4RFVA 3PZRA 2CFOA 2W2QA 4XCXA 3QU9A 2V7BA 3ZKWA 3L40A 4KQJA 5EN4A 2XKKA 3UV3A 1PW5A 4NJMA 4XEUA 1MN6A 1EGAA 3L7KA 4DBZA 4M89A 2GD2A 1LS6A 1PUXA 3C48A 2BUBA 2XCOA 5CCEA 5F2NA 1V5IA 2X6QA 4OFBA 5BW8A 2HUNA 3EXFB 3F73A 2HMVA 2XHEA 3C45A 1IM8A 2ODTX 3D0OA 2ZDHA 1W36B 3LMKA 4W9NA 5LQRA 1VYUA 1YRLA 2L2QA 3ROQA 5AI4A 2G7ZA 4E94A 4LYJA 1T6ZA 2AFIA 2V8BA 2YMQA 1QGED 3B5EA 3I9NA 3K8YA 4E09A 3VH4A 5DLQC 3QF4B 1XJWA 2X23A 4E21A 3CW2A 1SUPA 4RTOA 1RPTA 4DJAA 3OIFA 2GCNA 3CBGA 4A4DA 1QE0A 3GPIA 2C8LA 3CNEA 3PU6A 2BTEA 3LWDA 3PDUA 1F3LA 2IYUA 3CLTC 3DPSA 3O91A 4AYTA 3TQCA 3SC6A 1DRWA 2WB4A 4W82A 4RSGA 2C9DA 4M1ZA 4YUZA 2XMRA 4Z7OB 2GETA 2H3HA 4LF7B 4Z3DA 3CRW1 4A5OA 1WETA 4BO5A 2Q6VA 4QBTA 5LP6A 1EUYA 2GCIA 2QTVA 2RB5A 1E8DA 3LWBA 3R5TA 3CE9A 4L6AA 1RMYA 2FF5A 3UAGA 4CR7A 1FNBA 4NK5A 4B40A 2ZM5A 1Q20A 4F1JA 2FX3A 3OPVA 2IJGX 4E32A 4HATA 2R62A 4Q82A 1U5BB 1N36B 2AMYA 1DEOA 3WGOA 5A4FS 2R9VA 3FMFA 3FBGA 3NV7A 5BWOA 3MD0A 1HQCA 3SYKA 3WQRA 3HS3A 1J5PA 3MJVA 3IA7A 4PX5A 5TQJA 3SZOA 1ZY2A 1LLFA 3ZJVA 3P4XA 1I30A 3B6EA 4GOXA 3BJRA 2ZIXB 1JR3E 1MB2A 1P5HA 3W2GA 1X7GA 1JEQB 3JD0A 9LDBA 1OLUA 2WU0A 3ITNA 2YCLA 1EI9A 1KIFA 2J0QA 1ZM4A 2JFZA 2OQVA 2Y6UA 4N3BA 2J0UB 2JD2A 4JUBA 5DTMA 1X70A 1G2OA 2YY5A 4OA8A 3DTYA 2PXAA 2AXNA 3OURA 3PC6A 4R1LA 1Y6GA 2Z9DA 4B83A 4A7PA 2OV4A 3CWCA 1E7RA 3PJEA 4ND2A 4DREA 3ETCA 2ZIEA 3GG2A 4K9DA 1GUBA 4IF6A 2O19A 2R96A 3IMGA 5JFGA 2OT3B 2NNLD 2Q6TA 1VMEA 2CEKA 1RLIA 2HA4A 3LI2A 4WH0A 2YY7A 3G3EA 3P2YA 3WL5A 2QW1A 1OWNA 3L1JA 2GDJA 4BQNA 1SUFA 1TIBA 3NIBA 2M98A 3ECCA 3UOWA 3V6MA 3ENQA 3A1DA 4C4OA 5DCUA 4JBHA 3FF4A 1V96A 4W1QA 5M5BA 2IYSA 5JQGF 2REOA 3MTEA 4PANA 4JENA 4EGJA 3K9LA 4ZCTA 2IPLA 1RI3A 2FG5A 1CR4A 2PGXA 3HBMA 5KYWB 3RANA 3AG5A 4NU0A 4OMFG 4WI1A 2I55A 2IBTA 4D45A 1OILA 4C76A 4WK6A 1KO1A 3FN4A 1XFDA 3NRBA 3H5LA 3HJUA 3EY9A 3A3NA 4TRMA 2ISCA 2KYRA 5EMHA 1KMCA 3C3DA 3E9EA 4RH0A 4BNYA 4AZ3A 2AB0A 3AEUB 4BVBA 3JAMA 4JBYA 1JE1A 3CB2A 1TJ4A 4LC9A 1QTIA 4M1EA 3G23A 5REQB 2JFYA 1VB3A 2XT6A 1GCGA 3CU5A 2OORA 1AQ6A 1JDJA 4FQ8A 5EINA 3LHDA 4YACA 3H8JA 2ONCA 2QAGB 2X4IA 3GFTA 5KOHB 1CUIA 3C85A 2NPIA 3GJRA 4RV9A 4X1YB 1Y5IA 3RRJA 3B52X 1V3VA 4GVPA 4OI0A 2BELA 1YBVA 3TH5A 4B3XA 5GIPE 4C0XA 5AW8A 3RVNA 4ZOBA 2FWJA 5TJHA 3T1QA 4CV3A 5JECA 3GYGA 1UP7A 2R4QA 2VO1A 3CR7A 1ESEA 2FZ5A 2AIRA 1HFJA 2W8BA 3R0VA 2OAP1 2O4CA 1IN4A 1QIFA 2AN3A 1ESMA 3LUCA 5FUWA 5TPWB 5BW5A 1HO3A 3BFKA 4DV4B 2ZWOA 1E2MA 3X1YA 4A8HA 5FOQA 2W42A 1QYXA 1HK7A 2ODEA 1F1JA 1GCOA 3JYNA 2EJWA 5IZCA 1KDOA 3JZMA 4L15A 4OX9Y 2OHHA 1EA7A 5D6OA 2HJWA 3JAKB 4X3OA 1ARZA 2CBXA 4UD2A 1OTYA 1KAOA 3TL6A 3OM9A 3PC4A 2WTBA 4O4LA 4Y2YA 1X7XA 1IQPA 1YDWA 4HX5A 2OP0A 5CP8A 3RABA 1NBWB 2RBEA 2FP4A 4H2DA 4MUBA 3E4CA 3S2ZA 1JTEA 3R0XA 4I81A 4C4TA 5KREA 4YJGB 1B16A 5HW0A 4YJHA 4QM7A 3FKSD 1DARA 2WJIA 4OATA 1IZ7A 3OY2A 4EW1A 1XAJA 2BFCA 3F8WA 1I7PA 3NKLA 3QEKA 4HWSA 3SBXA 3V7UA 1IOZA 4F1KA 3NMUF 4WGFA 1JWLA 4ZQCB 3KUKA 3CQ9A 3AU9A 2QXYA 2PAAA 4RK1A 3RR2A 1WW2A 4POAA 1KMHB 4C5AA 1C9EA 4LRWA 3OF3A 4F9GA 1XQ1A 1LPSA 3OFKA 1Q7RA 4DQLA 1P1CA 3LGSA 5HTKA 3X1MA 3WLPA 4PCLA 3VHXB 2R8RA 1FX0B 1XJ5A 3JWIA 3OMLA 3DBHA 1XRSB 2IVFA 2J30A 3V8RA 4RA9B 4DJEC 1KU6A 2H2IA 3GN1A 1Z5WA 1JLRA 4B4VA 2FRDA 5DOVA 2Q9UA 4JZKA 4YJ2B 3IA2A 3SZGA 4MPPA 4G23A 3BSFA 3O4HA 1LTQA 2C8JA 2WJ6A 3VJMA 4B7XA 1BYIA 5SY6A 1DCMA 1EZZA 3G2PA 1KYVA 3QM1A 3TQTA 1COZA 5I9LA 4TQUS 1O6FA 4KFTA 2ZBPA 4MB6A 1TU4A 1QB8A 1L9KA 4NCHA 4QOIA 3DT9A 4RHCA 4JR2A 5KDLA 2JGFA 4QJ5A 3BXPA 2PGJA 4K0RA 3U16A 3RUCA 1QGZA 1T4BA 2XD9A 1P2TA 3KO8A 4N7RA 3WGHA 3GQBB 1NMSA 1T0BA 4GICA 1XB2A 2OMKA 2BZGA 2QE7A 3ESAA 3K31A 4Y67A 3KZNA 3RIXA 2R1VB 3GJ7A 2CVHA 2JDID 2VDNB 4GOJA 4K88A 3KKLA 3I6QA 2JCXA 3AM4A 2P4UA 1R16A 1XPUA 3HJRA 1QIKA 2OFXA 4PLHA 1HE1C 3MRTA 2G17A 4JLSA 3R8CA 2J5QA 1P9LA 3KE8A 5D86A 5B2FA 1SBQA 5AVVA 1LI5A 3WO0A 3UAZA 5C1BA 3WP1B 4BBPA 3DDUA 4PQGA 2JG3A 4RA6B 2P6MA 1ZN7A 2BMJA 2Q28A 2W58A 4P9NA 5JY1A 1GPAA 1OA1A 1IQRA 3O4IA 1Z2CA 1YJ8A 2OVFA 1LK0A 4BRSA 3UV6A 2XUOA 1XDUA 4BQSA 3PRYA 4PAGA 4ZXFA 1XUOA 3D6AA 2H48A 1RHJA 4I36A 1UFVA 1Y1KE 1G291 5FQOA 3GY0A 2IEDA 1FLAA 1X7WA 2HYDA 1WZEA 3R3WA 3WBBA 3ZU6A 5IKEA 4IYRA 4B3DA 1ZHOA 3MHPA 4F11A 2OC9A 1ST3A 4Y1FA 2Q50A 3JAWA 3WICA 1B93A 2Y1DA 3U9SA 3PRJA 5C9ZA 4MUHA 3INRA 2IDZA 2VP3A 3ONDA 5FPQA 2HV9A 4QUJA 4GMKA 1IK4A 2XLCA 5KKNB 4CEHB 3BSYA 4JXJA 4B6SA 1BXGA 2X0RA 3DCIA 4BP1A 3SK0A 4LZZA 3WKDA 3NBUA 3BSWA 1PFVA 2VJQA 3G8DA 1JNXX 1K7EB 1U7WA 2RIRA 2GA8A 2VYNA 3LBYA 3R4CA 4HI0E 1HMPA 1XZ8A 4NE2A 2GRUA 1YRAA 1OX4B 4H3HB 2B9VA 1Z7EA 2OQIA 3DC2A 1KFKB 4LTNA 3STHA 5JADA 1WHTB 5KYUB 3RRZA 2PX8A 5HG0A 2O2SA 3GFFA 1W4AA 2QRVB 1U0RA 3M6AA 1E66A 1Q57A 1T9GS 3OUUA 3NDJA 4H9GA 1SKBA 1Z6PA 3NEPX 1DT5A 2QHXA 5K6AC