The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
119
|
sequence length |
362
|
structure length |
354
|
Chain Sequence |
b'SNAMISKLSVNPTFSPSYNIIVDSVLDFSHILEYVTNKQVLVVTNTTVAKLYLTKFLAALVDDLDVRTCILEDGEQYKSQQSLDKILSTLLENHFTRNSTVLVALGGGVIGDITGFAAAIYQRGIDFIQIPTTLLSQVDSSVGGKTAINHQLGKNMIGAFYQPKVVYTSIEFYKTLPQREYIAGMAEVVKYAFISKDFYLWLDSNRDKILAKDSVTLIEMVKRSCQIKAQVVAMDTGARAILNFGHTFGHAIEKCQNYRGLKHGEAVGVGMAQAIDFSHYLGLISQQQAKDFNDFIVSFGISIDFPNDICQKEFLEAMLLDNKELKFILIENIGSLSLQKQSKNELEQFLDISR'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
3.0 Angstrom Crystal Structure of 3-dehydroquinate Synthase (AroB) from Francisella tularensis in Complex with NAD.
rcsb |
| molecule keywords |
3-dehydroquinate synthase
|
| source organism |
Francisella tularensis subsp. tularensis (strain schu s4 / schu 4)
|
| molecule tags |
Lyase
|
| total genus |
119
|
| structure length |
354
|
| sequence length |
362
|
| ec nomenclature |
ec
4.2.3.4: 3-dehydroquinate synthase. |
| pdb deposition date | 2016-01-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01761 | DHQ_synthase | 3-dehydroquinate synthase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Dehydroquinate synthase-like, alpha domain | Dehydroquinate synthase-like - alpha domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
