5HW8A

Candida albicans fkbp12 p104g protein bound with fk506 in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
b'LPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPGIIGPNETLVFEVELLGVNGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 25
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw8A00
2PPPA 4TW7A 5J6EA 3UQBA 2F4EA 2MPHA 3UQIA 2PBCA 1T11A 2FAPA 2PV1A 3EY6A 1PBKA 2M2AA 2KI3A 1EQ3A 1N1AA 2ZQTA 1BKFA 4U85A 4DRIA 2XPAA 3UI5A 2ZQUA 3IHZA 2DG9A 4JFKA 4QT3A 3KZ7A 2XP9A 5HT1A 2XP5A 2MNTA 5HWBA 4U84A 2Q5AA 3IKDA 1YATA 5I98A 3FAPA 3VAWA 1M5YA 1FKFA 2KO7A 3NTPA 3O5LA 1J6YA 4JFIA 2ZR4A 4GIVA 2AWGA 4JFJA 1F40A 4FN2A 2KR7A 1FJDA 2MLXA 1BL4A 1Q6HA 2KGJA 1FKBA 2MF9A 1FKKA 3PRDA 4NNRA 4O2TA 4ITZA 1QPLA 2DG3A 4ODPA 4QIBA 3TCZA 5D75A 4DRHA 1FKTA 3KAFA 4JYSA 4ODMA 4R0XA 5DIUA 1FKDA 4LAVA 5GPGA 5BXJA 1FKRA 1FKSA 3PA7A 1PINA 2L2SA 1U79A 4DRNA 5HW7A 1NMVA 1C9HA 1D7HA 1FKHA 1Y0OA 1JNSA 3NRKA 1FKIA 3O5RA 1ZK6A 4DRMA 4ODKA 1QZ2A 3CGMA 4DRJA 4DZ2A 2MLYA 1FAPA 4C02B 5HW6A 3B7XA 1TCOC 3KAHA 3KADA 2ZQVA 3KABA 4ODRA 2MLZA 2M08A 4JFLA 3KAIA 3UI4A 5HW8A 3I6CA 1FKGA 2DG4A 1YW5A 1Q1CA 3O5PA 2IF4A 3O5DA 1EYMA 4W9OA 2RSEA 3KAGA 2F2DA 4LAWA 1JVWA 1JNTA 1B6CA 4DZ3A 2XP4A 2VN1A 2M1IA 4MSPA 1FD9A 3JYJA 1D6OA 2RQSA 1HXVA 2D9FA 2PPOA 2OFNA 2XP7A 3KCEA 3O5FA 1NSGA 3ODKA 4IPXA 1R9HA 4DRQA 2XPBA 2LGOA 1FKJA 4TW6A 3O5JA 3MDYB 4N19A 5HUAA 4DIPA 4ODNA 2RUDA 2XP6A 4DROA 4DRKA 3O5KA 4TNSA 3H9RB 5HWCA 3O5OA 3JYMA 3UQAA 2F21A 3O5QA 2PV2A 2KFWA 3O5IA 3UF8A 4LAXA 4MGVA 3OOBA 4GGQA 3IKGA 5B8IC 1D7JA 1ROTA 4DH0A 2RURA 4G50A 4U86A 1L1PA 2ZQSA 2ZR5A 3UI6A 1ROUA 4W9QA 3RGCA 1J4RA 2PPNA 3TC5A 4W9PA 2ITKA 1NMWA 2RUCA 3O5GA 5DITA 4FAPA 5HKGA 5HTGA 2JZVA 3JXVA 4ODLA 1ZCNA 1A7XA 1F8AB 1FKLA 3GPKA 1KT0A 1QPFA 3O5MA 2KE0A 4IQCA 2FKEA 4J4NA 4ODOA 3TDBA 2RUQA 5DIVA 2Y78A 3KACA 2LKNA 2VCDA 4TYOA 1P5QA 3WH0A 3CGNA 2LJ4A 1KT1A 2XP8A 4DT4A 1J4IA 2PV3A 3PRBA 4TX0A 1Q6UA 2N87A 3O5EA 3NI6A 2UZ5A 4ODQA 3IK8A 4BF8A 1J4HA 2ZR6A 4G2PA 1Q6IA 2LPVA 4J4OA 3LUOA 1D7IA 4IQ2A 4JFMA 1W26A 4LAYA 2K8IA 3RFWA 4TW8A 4DRPA 2XP3A 4QT2A
chains in the Genus database with same CATH superfamily
4MNKA 3UQBA 3B9DA 1LG2A 1OWQA 1D2KA 1PBKA 2M2AA 1E9LA 4HARA 1EQ3A 4U85A 3IHZA 2OLHA 3KZ7A 5HT1A 1HKIA 1E6RA 1HJVA 2Q5AA 4IT4A 1W1PA 2DSZA 1M5YA 3NTPA 3VAWA 1E15A 4JFJA 1H0IA 1FJDA 1BL4A 1Q6HA 3PRDA 1SR0A 4ODPA 3TCZA 1NWSA 2ETNA 3AQUA 4DRHA 4ODMA 3AS0A 1GUVA 1FKSA 1HKMA 1FKHA 1FKIA 4WKHA 2EULA 4MNMA 3CGMA 4Q22A 4DWSA 1ITXA 3KADA 3KABA 3WL1A 4JFLA 4P8WA 2F2DA 3ARPA 2WM0A 4DZ3A 3AS1A 2M1IA 1X6LA 4ZPVR 3O5FA 2XP7A 2P4VA 1R9HA 4ZPWR 1NWRA 3O5JA 4DRKA 4ODNA 2RUDA 2XP6A 3RM4A 3JYMA 3O5QA 1GPFA 2KFWA 3O5IA 2IUZA 2DT1A 3ARUA 2DSVA 3IKGA 1D7JA 4AY1A 1ROTA 4DH0A 4G50A 1L1PA 2ZR5A 3UI6A 3RGCA 2DSUA 3TC5A 4KR0B 1FFRA 2DPEA 3O5GA 5HTGA 5HKGA 3QOKA 1A7XA 1F8AB 1FKLA 1LG1A 1QPFA 2FKEA 1NWTA 5DIVA 2Y78A 4QZVB 3ARYA 3KACA 2A3EA 2F23A 4TYOA 2DT3A 2N87A 4DWSD 1ZBVA 2DSWA 4HBEA 3O5EA 2DT0A 3IK8A 1J4HA 4NZCA 1EHNA 4G2PA 2WK2A 3LUOA 4LAYA 4TW8A 4MGVA 3ARWA 2PBCA 4DWSC 1IX5A 4L72B 2KI3A 2ZQTA 3AROA 3ALFA 1ZB5A 3CHEA 2DG9A 3WD2A 1ZU8A 2XP9A 4WK9A 1HKKA 2FDMA 1FFQA 1CTNA 1YATA 4Z2JA 2AWGA 3G6LA 1WAWA 2KGJA 1FKKA 2DG3A 3GTYX 1LL4A 2O92A 1FKTA 4JYSA 4R0XA 2B31A 5DIUA 2A3CA 1FKRA 1PINA 1U79A 1D7HA 3B9AA 1JNSA 1X6NA 3NRKA 3O5RA 1ZK6A 4DRMA 3CHFA 1QZ2A 1GOIA 4W5UA 4DRJA 1W1VA 2MLYA 1FAPA 4C02B 4MPKA 5HW6A 3B7XA 1TCOC 4P8VA 4ODRA 2WLYA 3KAIA 1FKGA 4Z2IA 1Q1CA 3O5DA 1EYMA 3KAGA 2PI6A 4LAWA 1SYTA 1JNTA 1RD6A 2VN1A 1FD9A 3JYJA 1HXVA 2PPOA 3KCEA 4DRQA 3RM9A 4TW6A 5HWCA 3O5KA 4TNSA 1E44A 1LL6A 3O5OA 3UQAA 3UF8A 5B8IC 3FXYA 3WD1A 1H0GA 2RURA 2ZQSA 3ARTA 1ROUA 4W9QA 2ITKA 2RUCA 5DITA 3JXVA 3O5MA 4J4NA 3TDBA 1P5QA 3WH0A 4WKFA 4WIWA 2PV3A 4TX0A 2DT2A 1EDQA 3WQVA 4ODQA 2ZR6A 1E6ZA 1D7IA 4IQ2A 2K8IA 3RFWA 2A3AA 2XP3A 4IPXA 4QT2A 3AS2A 4TW7A 3WD3A 4URIA 4DWSB 1T11A 2PV1A 3EY6A 1HJWA 1BKFA 4DRIA 3CH9A 2XPAA 3ARXA 4JFKA 4KQZA 2QF8A 4HBOA 4R5EA 2MNTA 1OGGA 5DEZA 5I98A 3FAPA 1J6YA 2KO7A 4GIVA 2KR7A 2O9OA 2MLXA 1FKBA 4NNRA 4O2TA 1QPLA 3GU0A 2B5UB 5D75A 5BXJA 4LGXA 5GPGA 4LAVA 4S3KA 3PA7A 4Z2HA 5GPRA 3W4RA 1Y0OA 1NWUA 1ZL1A 2ESCA 4XAKA 4ODKA 1XRVA 1K9TA 4DZ2A 3KAHA 4WKAA 2ZQVA 2MLZA 1ZBCA 3UI4A 5HW8A 3I6CA 1W1TA 1JNDA 2IF4A 2RSEA 5JH8A 2G41A 1E6NA 1JVWA 4P8UA 2XP4A 4MSPA 2D9FA 3WD4A 3ODKA 1NSGA 2LGOA 3MDYB 5HUAA 1LL7A 4DIPA 4ML4A 4DROA 3H9RB 1W9VA 3OOBA 1E6PA 4GGQA 2PN0A 4L3NA 3BMBA 4U86A 4ZS6A 4PTMA 3WIJA 1J4RA 1NH6A 2PPNA 4W9PA 3ARQA 1ZBKA 3ARZA 4Q7NA 1NMWA 3B9EA 2JZVA 3EIPA 4ODLA 1ZCNA 3ARRA 3FY1A 2YBUA 2KE0A 1W9UA 1JCHB 2VCDA 4Z2LA 3CGNA 1KT1A 2XP8A 1J4IA 3PRBA 1Q6UA 3NI6A 4BF8A 4J4OA 2YBTA 1HKJA 3RMEA 4DRPA 3WKZA 2PPPA 5J6EA 2F4EA 2MPHA 3UQIA 5DO2A 4IT6A 2FAPA 1LJYA 1N1AA 1O6IA 3UI5A 2ZQUA 4QT3A 1ZBWA 2XP5A 5HWBA 4U84A 3IKDA 1FKFA 3O5LA 1W1YA 4WJXA 4JFIA 2ZR4A 4ZPTR 1OGBA 3WQWA 1F40A 4FN2A 3ALGA 1UR9A 2MF9A 3ARVA 4ITZA 4QIBA 3KAFA 1FKDA 4UDMA 4Z2GA 2L2SA 4DRNA 5HW7A 1NMVA 1C9HA 3CZ8A 1GRJA 3OA5A 3CHCA 2AOSA 1TFVA 4Z2KA 2M08A 1WB0A 3ARSA 2DG4A 1YW5A 3O5PA 4W9OA 4MTVA 1B6CA 3CHDA 1D6OA 1W9PA 2RQSA 3PR9A 2OFNA 3PRAA 1VF8A 2XPBA 1WNOA 1FKJA 1JNEA 4N19A 1EIBA 3WD0A 2F21A 2PV2A 4LAXA 4NSBA 4MNLA 1UR8A 5DF0A 3BXWA 5GQBA 5HBFA 1XHGA 1HJXA 3WL0A 4FAPA 3G6MA 4IQCA 3GPKA 4ODOA 1KT0A 2RUQA 4MAVA 3AS3A 2WLZA 2A3BA 2LKNA 2LJ4A 4DT4A 3RM8A 4MNJA 2G8ZA 3B8SA 2UZ5A 1Q6IA 2LPVA 1LQ0A 4P8XA 4JFMA 1W26A 4S3JA 1KFWA
chains in the Genus database with same CATH topology
4MNKA 3UQBA 3B9DA 1LG2A 1OWQA 1D2KA 1PBKA 2M2AA 1E9LA 4HARA 1EQ3A 4U85A 3IHZA 2OLHA 3KZ7A 5HT1A 1HKIA 1E6RA 1HJVA 2Q5AA 4IT4A 1W1PA 2DSZA 1M5YA 3NTPA 3VAWA 1E15A 4JFJA 1H0IA 1FJDA 1BL4A 1Q6HA 3PRDA 1SR0A 4ODPA 3TCZA 1NWSA 3AQUA 4DRHA 4ODMA 3AS0A 1GUVA 1FKSA 1HKMA 1FKHA 1FKIA 4WKHA 4MNMA 3CGMA 4Q22A 4DWSA 1ITXA 3KADA 3KABA 3WL1A 4JFLA 4P8WA 2F2DA 3ARPA 2WM0A 4DZ3A 3AS1A 2M1IA 1X6LA 4ZPVR 3O5FA 2XP7A 1R9HA 4ZPWR 1NWRA 3O5JA 4DRKA 4ODNA 2RUDA 2XP6A 3RM4A 3JYMA 3O5QA 1GPFA 2KFWA 3O5IA 2IUZA 2DT1A 3ARUA 2DSVA 3IKGA 1D7JA 4AY1A 1ROTA 4DH0A 4G50A 1L1PA 2ZR5A 3UI6A 3RGCA 2DSUA 3TC5A 4KR0B 1FFRA 2DPEA 3O5GA 5HTGA 5HKGA 3QOKA 1A7XA 1F8AB 1FKLA 1LG1A 1QPFA 2FKEA 1NWTA 5DIVA 2Y78A 4QZVB 3ARYA 3KACA 2A3EA 4TYOA 2DT3A 2N87A 4DWSD 1ZBVA 2DSWA 4HBEA 3O5EA 2DT0A 3IK8A 1J4HA 4NZCA 1EHNA 4G2PA 2WK2A 3LUOA 4LAYA 4TW8A 4MGVA 3ARWA 2PBCA 4DWSC 1IX5A 4L72B 2KI3A 2ZQTA 3AROA 3ALFA 1ZB5A 3CHEA 2DG9A 3WD2A 1ZU8A 2XP9A 4WK9A 1HKKA 2FDMA 1FFQA 1CTNA 1YATA 4Z2JA 2AWGA 3G6LA 1WAWA 2KGJA 1FKKA 2DG3A 1LL4A 2O92A 1FKTA 4JYSA 4R0XA 2B31A 5DIUA 2A3CA 1FKRA 1PINA 1U79A 1D7HA 3B9AA 1JNSA 1X6NA 3O5RA 3NRKA 1ZK6A 4DRMA 3CHFA 1QZ2A 1GOIA 4W5UA 4DRJA 1W1VA 2MLYA 1FAPA 4C02B 4MPKA 5HW6A 3B7XA 1TCOC 4P8VA 4ODRA 2WLYA 3KAIA 1FKGA 4Z2IA 1Q1CA 3O5DA 1EYMA 3KAGA 2PI6A 4LAWA 1SYTA 1JNTA 1RD6A 2VN1A 1FD9A 3JYJA 1HXVA 2PPOA 3KCEA 4DRQA 3RM9A 4TW6A 5HWCA 3O5KA 4TNSA 1LL6A 3O5OA 3UQAA 3UF8A 5B8IC 3FXYA 3WD1A 1H0GA 2RURA 2ZQSA 3ARTA 1ROUA 4W9QA 2ITKA 2RUCA 5DITA 3JXVA 3O5MA 4J4NA 3TDBA 1P5QA 3WH0A 4WKFA 4WIWA 2PV3A 4TX0A 2DT2A 1EDQA 3WQVA 4ODQA 2ZR6A 1E6ZA 1D7IA 4IQ2A 2K8IA 3RFWA 2A3AA 2XP3A 4IPXA 4QT2A 3AS2A 4TW7A 3WD3A 4URIA 4DWSB 1T11A 2PV1A 3EY6A 1HJWA 1BKFA 4DRIA 3CH9A 2XPAA 3ARXA 4JFKA 4KQZA 2QF8A 4HBOA 4R5EA 2MNTA 1OGGA 5DEZA 5I98A 3FAPA 1J6YA 2KO7A 4GIVA 2KR7A 2O9OA 2MLXA 1FKBA 4NNRA 4O2TA 1QPLA 5D75A 5BXJA 4LGXA 5GPGA 4LAVA 4S3KA 3PA7A 4Z2HA 5GPRA 3W4RA 1Y0OA 1NWUA 1ZL1A 2ESCA 4XAKA 4ODKA 1XRVA 1K9TA 4DZ2A 3KAHA 4WKAA 2ZQVA 2MLZA 1ZBCA 3UI4A 5HW8A 3I6CA 1W1TA 1JNDA 2IF4A 2RSEA 5JH8A 2G41A 1E6NA 1JVWA 4P8UA 2XP4A 4MSPA 2D9FA 3WD4A 3ODKA 1NSGA 2LGOA 3MDYB 5HUAA 1LL7A 4DIPA 4ML4A 4DROA 3H9RB 1W9VA 3OOBA 1E6PA 4GGQA 4L3NA 4U86A 4ZS6A 4PTMA 3WIJA 1J4RA 1NH6A 2PPNA 4W9PA 3ARQA 1ZBKA 3ARZA 4Q7NA 1NMWA 3B9EA 2JZVA 4ODLA 1ZCNA 3ARRA 3FY1A 2YBUA 2KE0A 1W9UA 2VCDA 4Z2LA 3CGNA 1KT1A 2XP8A 1J4IA 3PRBA 1Q6UA 3NI6A 4BF8A 4J4OA 2YBTA 1HKJA 3RMEA 4DRPA 3WKZA 2PPPA 5J6EA 2F4EA 2MPHA 3UQIA 5DO2A 4IT6A 2FAPA 1LJYA 1N1AA 1O6IA 3UI5A 2ZQUA 4QT3A 1ZBWA 2XP5A 5HWBA 4U84A 3IKDA 1FKFA 3O5LA 1W1YA 4WJXA 4JFIA 2ZR4A 4ZPTR 1OGBA 3WQWA 1F40A 4FN2A 3ALGA 1UR9A 2MF9A 3ARVA 4ITZA 4QIBA 3KAFA 1FKDA 4Z2GA 2L2SA 4DRNA 5HW7A 1NMVA 1C9HA 3CZ8A 3OA5A 3CHCA 2AOSA 1TFVA 4Z2KA 2M08A 1WB0A 3ARSA 2DG4A 1YW5A 3O5PA 4W9OA 4MTVA 1B6CA 3CHDA 1D6OA 1W9PA 2RQSA 3PR9A 2OFNA 3PRAA 1VF8A 2XPBA 1WNOA 1FKJA 1JNEA 4N19A 1EIBA 3WD0A 2F21A 2PV2A 4LAXA 4NSBA 4MNLA 1UR8A 5DF0A 3BXWA 5GQBA 5HBFA 1XHGA 1HJXA 3WL0A 4FAPA 3G6MA 4IQCA 3GPKA 4ODOA 1KT0A 2RUQA 4MAVA 3AS3A 2WLZA 2A3BA 2LKNA 2LJ4A 4DT4A 3RM8A 4MNJA 2G8ZA 3B8SA 2UZ5A 1Q6IA 2LPVA 1LQ0A 4P8XA 4JFMA 1W26A 4S3JA 1KFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPP A;  4TW7 A;  5J6E A;  3UQB A;  2F4E A;  2MPH A;  3UQI A;  2PBC A;  1T11 A;  2FAP A;  2PV1 A;  3EY6 A;  1PBK A;  2M2A A;  2KI3 A;  1EQ3 A;  1N1A A;  2ZQT A;  1BKF A;  4U85 A;  4DRI A;  2XPA A;  3UI5 A;  2ZQU A;  3IHZ A;  2DG9 A;  4JFK A;  4QT3 A;  3KZ7 A;  2XP9 A;  5HT1 A;  2XP5 A;  2MNT A;  5HWB A;  4U84 A;  2Q5A A;  3IKD A;  1YAT A;  5I98 A;  3FAP A;  3VAW A;  1M5Y A;  1FKF A;  2KO7 A;  3NTP A;  3O5L A;  1J6Y A;  4JFI A;  2ZR4 A;  4GIV A;  2AWG A;  4JFJ A;  1F40 A;  4FN2 A;  2KR7 A;  1FJD A;  2MLX A;  1BL4 A;  1Q6H A;  2KGJ A;  1FKB A;  2MF9 A;  1FKK A;  3PRD A;  4NNR A;  4O2T A;  4ITZ A;  1QPL A;  2DG3 A;  4ODP A;  4QIB A;  3TCZ A;  5D75 A;  4DRH A;  1FKT A;  3KAF A;  4JYS A;  4ODM A;  4R0X A;  5DIU A;  1FKD A;  4LAV A;  5GPG A;  5BXJ A;  1FKR A;  1FKS A;  3PA7 A;  1PIN A;  2L2S A;  1U79 A;  4DRN A;  5HW7 A;  1NMV A;  1C9H A;  1D7H A;  1FKH A;  1Y0O A;  1JNS A;  3NRK A;  1FKI A;  3O5R A;  1ZK6 A;  4DRM A;  4ODK A;  1QZ2 A;  3CGM A;  4DRJ A;  4DZ2 A;  2MLY A;  1FAP A;  4C02 B;  5HW6 A;  3B7X A;  1TCO C;  3KAH A;  3KAD A;  2ZQV A;  3KAB A;  4ODR A;  2MLZ A;  2M08 A;  4JFL A;  3KAI A;  3UI4 A;  5HW8 A;  3I6C A;  1FKG A;  2DG4 A;  1YW5 A;  1Q1C A;  3O5P A;  2IF4 A;  3O5D A;  1EYM A;  4W9O A;  2RSE A;  3KAG A;  2F2D A;  4LAW A;  1JVW A;  1JNT A;  1B6C A;  4DZ3 A;  2XP4 A;  2VN1 A;  2M1I A;  4MSP A;  1FD9 A;  3JYJ A;  1D6O A;  2RQS A;  1HXV A;  2D9F A;  2PPO A;  2OFN A;  2XP7 A;  3KCE A;  3O5F A;  1NSG A;  3ODK A;  4IPX A;  1R9H A;  4DRQ A;  2XPB A;  2LGO A;  1FKJ A;  4TW6 A;  3O5J A;  3MDY B;  4N19 A;  5HUA A;  4DIP A;  4ODN A;  2RUD A;  2XP6 A;  4DRO A;  4DRK A;  3O5K A;  4TNS A;  3H9R B;  5HWC A;  3O5O A;  3JYM A;  3UQA A;  2F21 A;  3O5Q A;  2PV2 A;  2KFW A;  3O5I A;  3UF8 A;  4LAX A;  4MGV A;  3OOB A;  4GGQ A;  3IKG A;  5B8I C;  1D7J A;  1ROT A;  4DH0 A;  2RUR A;  4G50 A;  4U86 A;  1L1P A;  2ZQS A;  2ZR5 A;  3UI6 A;  1ROU A;  4W9Q A;  3RGC A;  1J4R A;  2PPN A;  3TC5 A;  4W9P A;  2ITK A;  1NMW A;  2RUC A;  3O5G A;  5DIT A;  4FAP A;  5HKG A;  5HTG A;  2JZV A;  3JXV A;  4ODL A;  1ZCN A;  1A7X A;  1F8A B;  1FKL A;  3GPK A;  1KT0 A;  1QPF A;  3O5M A;  2KE0 A;  4IQC A;  2FKE A;  4J4N A;  4ODO A;  3TDB A;  2RUQ A;  5DIV A;  2Y78 A;  3KAC A;  2LKN A;  2VCD A;  4TYO A;  1P5Q A;  3WH0 A;  3CGN A;  2LJ4 A;  1KT1 A;  2XP8 A;  4DT4 A;  1J4I A;  2PV3 A;  3PRB A;  4TX0 A;  1Q6U A;  2N87 A;  3O5E A;  3NI6 A;  2UZ5 A;  4ODQ A;  3IK8 A;  4BF8 A;  1J4H A;  2ZR6 A;  4G2P A;  1Q6I A;  2LPV A;  4J4O A;  3LUO A;  1D7I A;  4IQ2 A;  4JFM A;  1W26 A;  4LAY A;  2K8I A;  3RFW A;  4TW8 A;  4DRP A;  2XP3 A;  4QT2 A; 
#chains in the Genus database with same CATH topology
 4MNK A;  3UQB A;  3B9D A;  1LG2 A;  1OWQ A;  1D2K A;  1PBK A;  2M2A A;  1E9L A;  4HAR A;  1EQ3 A;  4U85 A;  3IHZ A;  2OLH A;  3KZ7 A;  5HT1 A;  1HKI A;  1E6R A;  1HJV A;  2Q5A A;  4IT4 A;  1W1P A;  2DSZ A;  1M5Y A;  3NTP A;  3VAW A;  1E15 A;  4JFJ A;  1H0I A;  1FJD A;  1BL4 A;  1Q6H A;  3PRD A;  1SR0 A;  4ODP A;  3TCZ A;  1NWS A;  2ETN A;  3AQU A;  4DRH A;  4ODM A;  3AS0 A;  1GUV A;  1FKS A;  1HKM A;  1FKH A;  1FKI A;  4WKH A;  2EUL A;  4MNM A;  3CGM A;  4Q22 A;  4DWS A;  1ITX A;  3KAD A;  3KAB A;  3WL1 A;  4JFL A;  4P8W A;  2F2D A;  3ARP A;  2WM0 A;  4DZ3 A;  3AS1 A;  2M1I A;  1X6L A;  4ZPV R;  3O5F A;  2XP7 A;  2P4V A;  1R9H A;  4ZPW R;  1NWR A;  3O5J A;  4DRK A;  4ODN A;  2RUD A;  2XP6 A;  3RM4 A;  3JYM A;  3O5Q A;  1GPF A;  2KFW A;  3O5I A;  2IUZ A;  2DT1 A;  3ARU A;  2DSV A;  3IKG A;  1D7J A;  4AY1 A;  1ROT A;  4DH0 A;  4G50 A;  1L1P A;  2ZR5 A;  3UI6 A;  3RGC A;  2DSU A;  3TC5 A;  4KR0 B;  1FFR A;  2DPE A;  3O5G A;  5HTG A;  5HKG A;  3QOK A;  1A7X A;  1F8A B;  1FKL A;  1LG1 A;  1QPF A;  2FKE A;  1NWT A;  5DIV A;  2Y78 A;  4QZV B;  3ARY A;  3KAC A;  2A3E A;  2F23 A;  4TYO A;  2DT3 A;  2N87 A;  4DWS D;  1ZBV A;  2DSW A;  4HBE A;  3O5E A;  2DT0 A;  3IK8 A;  1J4H A;  4NZC A;  1EHN A;  4G2P A;  2WK2 A;  3LUO A;  4LAY A;  4TW8 A;  4MGV A;  3ARW A;  2PBC A;  4DWS C;  1IX5 A;  4L72 B;  2KI3 A;  2ZQT A;  3ARO A;  3ALF A;  1ZB5 A;  3CHE A;  2DG9 A;  3WD2 A;  1ZU8 A;  2XP9 A;  4WK9 A;  1HKK A;  2FDM A;  1FFQ A;  1CTN A;  1YAT A;  4Z2J A;  2AWG A;  3G6L A;  1WAW A;  2KGJ A;  1FKK A;  2DG3 A;  3GTY X;  1LL4 A;  2O92 A;  1FKT A;  4JYS A;  4R0X A;  2B31 A;  5DIU A;  2A3C A;  1FKR A;  1PIN A;  1U79 A;  1D7H A;  3B9A A;  1JNS A;  1X6N A;  3NRK A;  3O5R A;  1ZK6 A;  4DRM A;  3CHF A;  1QZ2 A;  1GOI A;  4W5U A;  4DRJ A;  1W1V A;  2MLY A;  1FAP A;  4C02 B;  4MPK A;  5HW6 A;  3B7X A;  1TCO C;  4P8V A;  4ODR A;  2WLY A;  3KAI A;  1FKG A;  4Z2I A;  1Q1C A;  3O5D A;  1EYM A;  3KAG A;  2PI6 A;  4LAW A;  1SYT A;  1JNT A;  1RD6 A;  2VN1 A;  1FD9 A;  3JYJ A;  1HXV A;  2PPO A;  3KCE A;  4DRQ A;  3RM9 A;  4TW6 A;  5HWC A;  3O5K A;  4TNS A;  1E44 A;  1LL6 A;  3O5O A;  3UQA A;  3UF8 A;  5B8I C;  3FXY A;  3WD1 A;  1H0G A;  2RUR A;  2ZQS A;  3ART A;  1ROU A;  4W9Q A;  2ITK A;  2RUC A;  5DIT A;  3JXV A;  3O5M A;  4J4N A;  3TDB A;  1P5Q A;  3WH0 A;  4WKF A;  4WIW A;  2PV3 A;  4TX0 A;  2DT2 A;  1EDQ A;  3WQV A;  4ODQ A;  2ZR6 A;  1E6Z A;  1D7I A;  4IQ2 A;  2K8I A;  3RFW A;  2A3A A;  2XP3 A;  4IPX A;  4QT2 A;  3AS2 A;  4TW7 A;  3WD3 A;  4URI A;  4DWS B;  1T11 A;  2PV1 A;  3EY6 A;  1HJW A;  1BKF A;  4DRI A;  3CH9 A;  2XPA A;  3ARX A;  4JFK A;  4KQZ A;  2QF8 A;  4HBO A;  4R5E A;  2MNT A;  1OGG A;  5DEZ A;  5I98 A;  3FAP A;  1J6Y A;  2KO7 A;  4GIV A;  2KR7 A;  2O9O A;  2MLX A;  1FKB A;  4NNR A;  4O2T A;  1QPL A;  3GU0 A;  2B5U B;  5D75 A;  5BXJ A;  4LGX A;  5GPG A;  4LAV A;  4S3K A;  3PA7 A;  4Z2H A;  5GPR A;  3W4R A;  1Y0O A;  1NWU A;  1ZL1 A;  2ESC A;  4XAK A;  4ODK A;  1XRV A;  1K9T A;  4DZ2 A;  3KAH A;  4WKA A;  2ZQV A;  2MLZ A;  1ZBC A;  3UI4 A;  5HW8 A;  3I6C A;  1W1T A;  1JND A;  2IF4 A;  2RSE A;  5JH8 A;  2G41 A;  1E6N A;  1JVW A;  4P8U A;  2XP4 A;  4MSP A;  2D9F A;  3WD4 A;  3ODK A;  1NSG A;  2LGO A;  3MDY B;  5HUA A;  1LL7 A;  4DIP A;  4ML4 A;  4DRO A;  3H9R B;  1W9V A;  3OOB A;  1E6P A;  4GGQ A;  2PN0 A;  4L3N A;  3BMB A;  4U86 A;  4ZS6 A;  4PTM A;  3WIJ A;  1J4R A;  1NH6 A;  2PPN A;  4W9P A;  3ARQ A;  1ZBK A;  3ARZ A;  4Q7N A;  1NMW A;  3B9E A;  2JZV A;  3EIP A;  4ODL A;  1ZCN A;  3ARR A;  3FY1 A;  2YBU A;  2KE0 A;  1W9U A;  1JCH B;  2VCD A;  4Z2L A;  3CGN A;  1KT1 A;  2XP8 A;  1J4I A;  3PRB A;  1Q6U A;  3NI6 A;  4BF8 A;  4J4O A;  2YBT A;  1HKJ A;  3RME A;  4DRP A;  3WKZ A;  2PPP A;  5J6E A;  2F4E A;  2MPH A;  3UQI A;  5DO2 A;  4IT6 A;  2FAP A;  1LJY A;  1N1A A;  1O6I A;  3UI5 A;  2ZQU A;  4QT3 A;  1ZBW A;  2XP5 A;  5HWB A;  4U84 A;  3IKD A;  1FKF A;  3O5L A;  1W1Y A;  4WJX A;  4JFI A;  2ZR4 A;  4ZPT R;  1OGB A;  3WQW A;  1F40 A;  4FN2 A;  3ALG A;  1UR9 A;  2MF9 A;  3ARV A;  4ITZ A;  4QIB A;  3KAF A;  1FKD A;  4UDM A;  4Z2G A;  2L2S A;  4DRN A;  5HW7 A;  1NMV A;  1C9H A;  3CZ8 A;  1GRJ A;  3OA5 A;  3CHC A;  2AOS A;  1TFV A;  4Z2K A;  2M08 A;  1WB0 A;  3ARS A;  2DG4 A;  1YW5 A;  3O5P A;  4W9O A;  4MTV A;  1B6C A;  3CHD A;  1D6O A;  1W9P A;  2RQS A;  3PR9 A;  2OFN A;  3PRA A;  1VF8 A;  2XPB A;  1WNO A;  1FKJ A;  1JNE A;  4N19 A;  1EIB A;  3WD0 A;  2F21 A;  2PV2 A;  4LAX A;  4NSB A;  4MNL A;  1UR8 A;  5DF0 A;  3BXW A;  5GQB A;  5HBF A;  1XHG A;  1HJX A;  3WL0 A;  4FAP A;  3G6M A;  4IQC A;  3GPK A;  4ODO A;  1KT0 A;  2RUQ A;  4MAV A;  3AS3 A;  2WLZ A;  2A3B A;  2LKN A;  2LJ4 A;  4DT4 A;  3RM8 A;  4MNJ A;  2G8Z A;  3B8S A;  2UZ5 A;  1Q6I A;  2LPV A;  1LQ0 A;  4P8X A;  4JFM A;  1W26 A;  4S3J A;  1KFW A; 
#chains in the Genus database with same CATH homology
 4MNK A;  3UQB A;  3B9D A;  1LG2 A;  1OWQ A;  1D2K A;  1PBK A;  2M2A A;  1E9L A;  4HAR A;  1EQ3 A;  4U85 A;  3IHZ A;  2OLH A;  3KZ7 A;  5HT1 A;  1HKI A;  1E6R A;  1HJV A;  2Q5A A;  4IT4 A;  1W1P A;  2DSZ A;  1M5Y A;  3NTP A;  3VAW A;  1E15 A;  4JFJ A;  1H0I A;  1FJD A;  1BL4 A;  1Q6H A;  3PRD A;  1SR0 A;  4ODP A;  3TCZ A;  1NWS A;  3AQU A;  4DRH A;  4ODM A;  3AS0 A;  1GUV A;  1FKS A;  1HKM A;  1FKH A;  1FKI A;  4WKH A;  4MNM A;  3CGM A;  4Q22 A;  4DWS A;  1ITX A;  3KAD A;  3KAB A;  3WL1 A;  4JFL A;  4P8W A;  2F2D A;  3ARP A;  2WM0 A;  4DZ3 A;  3AS1 A;  2M1I A;  1X6L A;  4ZPV R;  3O5F A;  2XP7 A;  1R9H A;  4ZPW R;  1NWR A;  3O5J A;  4DRK A;  4ODN A;  2RUD A;  2XP6 A;  3RM4 A;  3JYM A;  3O5Q A;  1GPF A;  2KFW A;  3O5I A;  2IUZ A;  2DT1 A;  3ARU A;  2DSV A;  3IKG A;  1D7J A;  4AY1 A;  1ROT A;  4DH0 A;  4G50 A;  1L1P A;  2ZR5 A;  3UI6 A;  3RGC A;  2DSU A;  3TC5 A;  4KR0 B;  1FFR A;  2DPE A;  3O5G A;  5HTG A;  5HKG A;  3QOK A;  1A7X A;  1F8A B;  1FKL A;  1LG1 A;  1QPF A;  2FKE A;  1NWT A;  5DIV A;  2Y78 A;  4QZV B;  3ARY A;  3KAC A;  2A3E A;  4TYO A;  2DT3 A;  2N87 A;  4DWS D;  1ZBV A;  2DSW A;  4HBE A;  3O5E A;  2DT0 A;  3IK8 A;  1J4H A;  4NZC A;  1EHN A;  4G2P A;  2WK2 A;  3LUO A;  4LAY A;  4TW8 A;  4MGV A;  3ARW A;  2PBC A;  4DWS C;  1IX5 A;  4L72 B;  2KI3 A;  2ZQT A;  3ARO A;  3ALF A;  1ZB5 A;  3CHE A;  2DG9 A;  3WD2 A;  1ZU8 A;  2XP9 A;  4WK9 A;  1HKK A;  2FDM A;  1FFQ A;  1CTN A;  1YAT A;  4Z2J A;  2AWG A;  3G6L A;  1WAW A;  2KGJ A;  1FKK A;  2DG3 A;  1LL4 A;  2O92 A;  1FKT A;  4JYS A;  4R0X A;  2B31 A;  5DIU A;  2A3C A;  1FKR A;  1PIN A;  1U79 A;  1D7H A;  3B9A A;  1JNS A;  1X6N A;  3O5R A;  3NRK A;  1ZK6 A;  4DRM A;  3CHF A;  1QZ2 A;  1GOI A;  4W5U A;  4DRJ A;  1W1V A;  2MLY A;  1FAP A;  4C02 B;  4MPK A;  5HW6 A;  3B7X A;  1TCO C;  4P8V A;  4ODR A;  2WLY A;  3KAI A;  1FKG A;  4Z2I A;  1Q1C A;  3O5D A;  1EYM A;  3KAG A;  2PI6 A;  4LAW A;  1SYT A;  1JNT A;  1RD6 A;  2VN1 A;  1FD9 A;  3JYJ A;  1HXV A;  2PPO A;  3KCE A;  4DRQ A;  3RM9 A;  4TW6 A;  5HWC A;  3O5K A;  4TNS A;  1LL6 A;  3O5O A;  3UQA A;  3UF8 A;  5B8I C;  3FXY A;  3WD1 A;  1H0G A;  2RUR A;  2ZQS A;  3ART A;  1ROU A;  4W9Q A;  2ITK A;  2RUC A;  5DIT A;  3JXV A;  3O5M A;  4J4N A;  3TDB A;  1P5Q A;  3WH0 A;  4WKF A;  4WIW A;  2PV3 A;  4TX0 A;  2DT2 A;  1EDQ A;  3WQV A;  4ODQ A;  2ZR6 A;  1E6Z A;  1D7I A;  4IQ2 A;  2K8I A;  3RFW A;  2A3A A;  2XP3 A;  4IPX A;  4QT2 A;  3AS2 A;  4TW7 A;  3WD3 A;  4URI A;  4DWS B;  1T11 A;  2PV1 A;  3EY6 A;  1HJW A;  1BKF A;  4DRI A;  3CH9 A;  2XPA A;  3ARX A;  4JFK A;  4KQZ A;  2QF8 A;  4HBO A;  4R5E A;  2MNT A;  1OGG A;  5DEZ A;  5I98 A;  3FAP A;  1J6Y A;  2KO7 A;  4GIV A;  2KR7 A;  2O9O A;  2MLX A;  1FKB A;  4NNR A;  4O2T A;  1QPL A;  5D75 A;  5BXJ A;  4LGX A;  5GPG A;  4LAV A;  4S3K A;  3PA7 A;  4Z2H A;  5GPR A;  3W4R A;  1Y0O A;  1NWU A;  1ZL1 A;  2ESC A;  4XAK A;  4ODK A;  1XRV A;  1K9T A;  4DZ2 A;  3KAH A;  4WKA A;  2ZQV A;  2MLZ A;  1ZBC A;  3UI4 A;  5HW8 A;  3I6C A;  1W1T A;  1JND A;  2IF4 A;  2RSE A;  5JH8 A;  2G41 A;  1E6N A;  1JVW A;  4P8U A;  2XP4 A;  4MSP A;  2D9F A;  3WD4 A;  3ODK A;  1NSG A;  2LGO A;  3MDY B;  5HUA A;  1LL7 A;  4DIP A;  4ML4 A;  4DRO A;  3H9R B;  1W9V A;  3OOB A;  1E6P A;  4GGQ A;  4L3N A;  4U86 A;  4ZS6 A;  4PTM A;  3WIJ A;  1J4R A;  1NH6 A;  2PPN A;  4W9P A;  3ARQ A;  1ZBK A;  3ARZ A;  4Q7N A;  1NMW A;  3B9E A;  2JZV A;  4ODL A;  1ZCN A;  3ARR A;  3FY1 A;  2YBU A;  2KE0 A;  1W9U A;  2VCD A;  4Z2L A;  3CGN A;  1KT1 A;  2XP8 A;  1J4I A;  3PRB A;  1Q6U A;  3NI6 A;  4BF8 A;  4J4O A;  2YBT A;  1HKJ A;  3RME A;  4DRP A;  3WKZ A;  2PPP A;  5J6E A;  2F4E A;  2MPH A;  3UQI A;  5DO2 A;  4IT6 A;  2FAP A;  1LJY A;  1N1A A;  1O6I A;  3UI5 A;  2ZQU A;  4QT3 A;  1ZBW A;  2XP5 A;  5HWB A;  4U84 A;  3IKD A;  1FKF A;  3O5L A;  1W1Y A;  4WJX A;  4JFI A;  2ZR4 A;  4ZPT R;  1OGB A;  3WQW A;  1F40 A;  4FN2 A;  3ALG A;  1UR9 A;  2MF9 A;  3ARV A;  4ITZ A;  4QIB A;  3KAF A;  1FKD A;  4Z2G A;  2L2S A;  4DRN A;  5HW7 A;  1NMV A;  1C9H A;  3CZ8 A;  3OA5 A;  3CHC A;  2AOS A;  1TFV A;  4Z2K A;  2M08 A;  1WB0 A;  3ARS A;  2DG4 A;  1YW5 A;  3O5P A;  4W9O A;  4MTV A;  1B6C A;  3CHD A;  1D6O A;  1W9P A;  2RQS A;  3PR9 A;  2OFN A;  3PRA A;  1VF8 A;  2XPB A;  1WNO A;  1FKJ A;  1JNE A;  4N19 A;  1EIB A;  3WD0 A;  2F21 A;  2PV2 A;  4LAX A;  4NSB A;  4MNL A;  1UR8 A;  5DF0 A;  3BXW A;  5GQB A;  5HBF A;  1XHG A;  1HJX A;  3WL0 A;  4FAP A;  3G6M A;  4IQC A;  3GPK A;  4ODO A;  1KT0 A;  2RUQ A;  4MAV A;  3AS3 A;  2WLZ A;  2A3B A;  2LKN A;  2LJ4 A;  4DT4 A;  3RM8 A;  4MNJ A;  2G8Z A;  3B8S A;  2UZ5 A;  1Q6I A;  2LPV A;  1LQ0 A;  4P8X A;  4JFM A;  1W26 A;  4S3J A;  1KFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...