5HWBA

Aspergillus fumigatus fkbp12 apo protein in p212121 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
b'MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGINNKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
molecule tags Isomerase
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwbA00
3KAFA 3O5MA 4G50A 4DZ2A 3UI6A 2XP7A 3B7XA 4W9PA 1QPLA 4ODNA 3UQBA 4ODRA 5HW8A 2PV3A 1FKBA 3IKGA 1ZCNA 1D6OA 3FAPA 3KAIA 4ODLA 4QIBA 3O5OA 4DRHA 1FKKA 2RSEA 2OFNA 3KACA 4DRIA 1FJDA 4IPXA 3PRBA 3O5RA 4QT3A 1FKJA 2F21A 3KADA 4G2PA 2RUCA 1FKRA 3O5PA 1Q6IA 2L2SA 4JFKA 3O5LA 3WH0A 4NNRA 2XPBA 5B8IC 4JYSA 3UQAA 2MNTA 2DG3A 4DZ3A 3RFWA 1BL4A 4TW7A 5HUAA 4IQ2A 4O2TA 5BXJA 5HWCA 1QPFA 3NI6A 5HKGA 5HW6A 4JFJA 2XP6A 4ODMA 2KFWA 4IQCA 1F40A 1PBKA 3TDBA 2KI3A 3CGMA 1D7JA 2PPOA 1J4IA 1FKIA 3EY6A 4ODPA 3LUOA 2MLYA 4N19A 2KR7A 3JXVA 4DH0A 4DT4A 3UQIA 3CGNA 3OOBA 1FKDA 2LPVA 2IF4A 4LAYA 5HW7A 4J4NA 1C9HA 3ODKA 3UF8A 1FKLA 4DRNA 5J6EA 4U86A 1KT1A 1Q6UA 1FKTA 2ZR4A 1FAPA 1FKGA 4DROA 1ZK6A 2ZQUA 1A7XA 5I98A 1B6CA 1HXVA 3O5JA 5DIVA 3JYJA 3O5GA 5HT1A 2XP3A 1YW5A 4DRQA 1J4RA 4DRPA 3KAGA 3O5KA 4ODKA 5HWBA 3I6CA 4TYOA 3MDYB 1JNTA 2K8IA 2KGJA 4ODQA 4TW8A 1Q6HA 1Q1CA 2RQSA 4TNSA 2M08A 2F2DA 4W9OA 3UI4A 2RURA 1M5YA 1FKSA 4DIPA 1NMWA 2PV2A 4LAVA 2XP5A 3O5QA 2D9FA 2FAPA 3RGCA 4DRMA 5HTGA 2KE0A 2LJ4A 4MSPA 1FD9A 1NMVA 2PPNA 2RUDA 1ROUA 1F8AB 1D7HA 3PRDA 1W26A 1N1AA 2UZ5A 4R0XA 1TCOC 2XPAA 2RUQA 2PBCA 4DRKA 2ZR5A 3KAHA 2DG9A 1FKFA 2M1IA 2XP8A 2JZVA 1BKFA 2MPHA 5DITA 1EYMA 2F4EA 2ITKA 4TW6A 5GPGA 3VAWA 2XP4A 2MF9A 4FN2A 1J4HA 2FKEA 4BF8A 1P5QA 4GIVA 2MLZA 2N87A 2Y78A 1PINA 2LGOA 4U84A 2ZQVA 3PA7A 2ZQTA 4JFIA 2MLXA 3IHZA 3IKDA 2Q5AA 3H9RB 1J6YA 4U85A 3NRKA 1NSGA 5D75A 1FKHA 2VN1A 3O5DA 4C02B 4LAXA 1D7IA 3JYMA 1R9HA 4J4OA 2LKNA 1U79A 4ODOA 3TCZA 2M2AA 2PPPA 1Y0OA 4JFLA 4FAPA 4QT2A 2AWGA 2ZR6A 2XP9A 2KO7A 3GPKA 3KABA 3O5IA 5DIUA 3TC5A 3NTPA 2VCDA 1JNSA 3O5FA 3O5EA 1KT0A 3KZ7A 4MGVA 1EQ3A 1YATA 2DG4A 1JVWA 4W9QA 4JFMA 4DRJA 4LAWA 3IK8A 1T11A 2PV1A 4GGQA 4ITZA 4TX0A 1L1PA 3UI5A 2ZQSA 3KCEA 1ROTA 1QZ2A
chains in the Genus database with same CATH superfamily
3KAFA 4ZPWR 2DT1A 3UI6A 3B7XA 4W9PA 1GOIA 4ODRA 1FKBA 1ZBWA 1ZCNA 1D6OA 3W4RA 1K9TA 4DRHA 3AS1A 2RSEA 3KACA 1E6PA 1ZBKA 1FKJA 2F21A 3CHDA 4G2PA 4IT6A 4Z2GA 1Q6IA 2L2SA 2PN0A 2XPBA 4IQ2A 1QPFA 2DSVA 2XP6A 1PBKA 2KI3A 3CHCA 2PPOA 1J4IA 3EY6A 3LUOA 1UR8A 3CGNA 1IX5A 2LPVA 2IF4A 4P8XA 3ODKA 1FKLA 1FKTA 2EULA 2DT3A 5I98A 4MTVA 4KR0B 1W1YA 2DT0A 1HXVA 5DIVA 1FFQA 2XP3A 4ODKA 3MDYB 2KGJA 2DSWA 4ODQA 3WL1A 1Q6HA 2RQSA 4W9OA 2F2DA 1E6NA 5DEZA 4DIPA 2PV2A 1LL6A 2KE0A 3AS3A 4MSPA 1FD9A 4WIWA 1F8AB 1D7HA 2UZ5A 4R0XA 3QOKA 2XPAA 4DRKA 1E6ZA 2JZVA 4URIA 1BKFA 3VAWA 2F4EA 1SYTA 4FN2A 1J4HA 1HJVA 2FKEA 2YBTA 4MNKA 3ARVA 2LGOA 2ZQVA 3IKDA 1J6YA 3NRKA 1ZBVA 4LGXA 1D7IA 1W9PA 3TCZA 2M2AA 1Y0OA 1X6NA 4DWSC 1E9LA 3PR9A 4QT2A 2KO7A 3ARQA 2ESCA 3KABA 1XRVA 2VCDA 1JNSA 1VF8A 3ARSA 4DRJA 3ARZA 3IK8A 1L1PA 4GGQA 4ITZA 4TX0A 2ZQSA 2FDMA 4L3NA 4DZ2A 4NSBA 1QPLA 4ODNA 4AY1A 3UQBA 5HW8A 3FAPA 3KAIA 4QIBA 3O5OA 2OFNA 4DRIA 4QT3A 3PRBA 3RMEA 1LL7A 2RUCA 3WH0A 2A3BA 2DG3A 2O9OA 5DF0A 4ZPTR 1E15A 4JFJA 4IQCA 5HBFA 4ODPA 1HKMA 3OA5A 1NWRA 2KR7A 3OOBA 1FKDA 3WD0A 3AROA 3UF8A 4XAKA 1ZB5A 1ZBCA 2PI6A 3ARPA 4W5UA 1FAPA 2ZQUA 3B8SA 1A7XA 1E44A 3O5JA 4QZVB 3JYJA 1O6IA 3O5KA 4MPKA 3ARTA 3UI4A 1FKSA 3O5QA 4R5EA 2D9FA 5HTGA 2PPNA 5GQBA 1ROUA 3GTYX 4DWSD 3PRDA 1N1AA 2WK2A 1X6LA 2O92A 3CH9A 4Q7NA 2ITKA 2ETNA 1GRJA 3ARRA 1W1PA 4WKAA 4BF8A 1W1TA 3G6LA 4U84A 2ZQTA 4JFIA 3IHZA 1NWUA 1W1VA 4U85A 1NSGA 3O5DA 1SR0A 2LKNA 1FFRA 2DT2A 2PPPA 1CTNA 2XP9A 3GPKA 1WB0A 5GPRA 3WD3A 3O5FA 1HKIA 1KT0A 4MGVA 3GU0A 1JVWA 4JFMA 3WKZA 3KCEA 1ROTA 1J4RA 3O5MA 4G50A 1NWSA 2XP7A 4PTMA 2PV3A 4ODLA 2B5UB 1FKKA 1FJDA 4IPXA 1OGGA 3KADA 2OLHA 1ZL1A 3O5PA 4NNRA 5B8IC 3RFWA 1BL4A 3ARUA 4NZCA 3NI6A 5HKGA 2KFWA 3WL0A 1F40A 1ITXA 3EIPA 1D7JA 4Q22A 4N19A 3JXVA 4DH0A 4DT4A 4KQZA 3UQIA 3B9DA 1EDQA 4LAYA 2G8ZA 5JH8A 1C9HA 3ALGA 1HJXA 5J6EA 1WNOA 4U86A 4ZPVR 1KT1A 1H0IA 2ZR4A 1UR9A 1LG2A 1ZK6A 2WLYA 1B6CA 1XHGA 5HT1A 3O5GA 5HWBA 3I6CA 4TYOA 3BXWA 4P8VA 1Q1CA 2B31A 1WAWA 4Z2IA 1KFWA 1HKJA 1GPFA 1M5YA 1LJYA 2RURA 2XP5A 2FAPA 3RGCA 1E6RA 1OGBA 3WIJA 3RM4A 1ZU8A 1TCOC 3ARYA 2RUQA 2ZR5A 2M1IA 2XP8A 4WK9A 2MPHA 5DITA 1EYMA 4MNLA 2XP4A 2MF9A 4ZS6A 1JCHB 3WD2A 3AQUA 1P5QA 2MLZA 2N87A 2Y78A 1PINA 3PA7A 3WQVA 2IUZA 3ARWA 1HJWA 4Z2KA 4C02B 4WJXA 4LAXA 4J4OA 1R9HA 4ML4A 4JFLA 2A3EA 3FXYA 3CZ8A 4DWSA 3O5IA 3TC5A 3O5EA 1EQ3A 3KZ7A 1LL4A 4S3JA 4W9QA 2DPEA 2PV1A 1W9VA 1QZ2A 2A3AA 4L72B 2F23A 3IKGA 3BMBA 3B9AA 2QF8A 3O5RA 1JNDA 4Z2LA 1FKRA 4JFKA 3O5LA 4JYSA 3UQAA 2MNTA 4DZ3A 2WM0A 4TW7A 5HUAA 4O2TA 5HWCA 5BXJA 1JNEA 5HW6A 4ODMA 4HBEA 3RM9A 3TDBA 3CGMA 1FKIA 2MLYA 4P8UA 3FY1A 2G41A 5HW7A 4J4NA 2AOSA 4DWSB 4DRNA 1Q6UA 3PRAA 1RD6A 3RM8A 1FKGA 4DROA 2YBUA 4DRQA 1YW5A 1EIBA 3KAGA 4DRPA 1JNTA 2K8IA 2WLZA 4TW8A 4UDMA 4TNSA 4HARA 2M08A 3ALFA 1GUVA 3CHEA 1HKKA 1NWTA 1NMWA 4LAVA 4DRMA 2P4VA 2LJ4A 1LG1A 1NMVA 2RUDA 4WKHA 1LQ0A 1TFVA 2DSZA 1W26A 3ARXA 1D2KA 2PBCA 3KAHA 2DG9A 1FKFA 1EHNA 4MNJA 4TW6A 5GPGA 1OWQA 3AS2A 5DO2A 4Z2JA 4MAVA 1W9UA 4GIVA 3B9EA 3AS0A 2MLXA 2Q5AA 3H9RB 3WD4A 3WD1A 5D75A 4P8WA 1FKHA 2DSUA 2VN1A 4IT4A 4S3KA 1H0GA 3JYMA 4ODOA 1U79A 1NH6A 3CHFA 4FAPA 2AWGA 2ZR6A 3G6MA 5DIUA 2A3CA 3NTPA 4HBOA 3WQWA 1YATA 2DG4A 4WKFA 4MNMA 4LAWA 1T11A 3UI5A 4Z2HA
chains in the Genus database with same CATH topology
3KAFA 4ZPWR 2DT1A 3UI6A 3B7XA 4W9PA 1GOIA 4ODRA 1FKBA 1ZBWA 1ZCNA 1D6OA 3W4RA 1K9TA 4DRHA 3AS1A 2RSEA 3KACA 1E6PA 1ZBKA 1FKJA 2F21A 3CHDA 4G2PA 4IT6A 4Z2GA 1Q6IA 2L2SA 2XPBA 4IQ2A 1QPFA 2DSVA 2XP6A 1PBKA 2KI3A 3CHCA 2PPOA 1J4IA 3EY6A 3LUOA 1UR8A 3CGNA 1IX5A 2LPVA 2IF4A 4P8XA 3ODKA 1FKLA 1FKTA 2DT3A 5I98A 4MTVA 4KR0B 1W1YA 2DT0A 1HXVA 5DIVA 1FFQA 2XP3A 4ODKA 3MDYB 2KGJA 2DSWA 4ODQA 3WL1A 1Q6HA 2RQSA 4W9OA 2F2DA 1E6NA 5DEZA 4DIPA 2PV2A 1LL6A 2KE0A 3AS3A 4MSPA 1FD9A 4WIWA 1F8AB 1D7HA 2UZ5A 4R0XA 3QOKA 2XPAA 4DRKA 1E6ZA 2JZVA 4URIA 1BKFA 3VAWA 2F4EA 1SYTA 4FN2A 1J4HA 1HJVA 2FKEA 2YBTA 4MNKA 3ARVA 2LGOA 2ZQVA 3IKDA 1J6YA 3NRKA 1ZBVA 4LGXA 1D7IA 1W9PA 3TCZA 2M2AA 1Y0OA 1X6NA 4DWSC 1E9LA 3PR9A 4QT2A 2KO7A 3ARQA 2ESCA 3KABA 1XRVA 2VCDA 1JNSA 1VF8A 3ARSA 4DRJA 3ARZA 3IK8A 1L1PA 4GGQA 4ITZA 4TX0A 2ZQSA 2FDMA 4L3NA 4DZ2A 4NSBA 1QPLA 4ODNA 4AY1A 3UQBA 5HW8A 3FAPA 3KAIA 4QIBA 3O5OA 2OFNA 4DRIA 4QT3A 3PRBA 3RMEA 1LL7A 2RUCA 3WH0A 2A3BA 2DG3A 2O9OA 5DF0A 4ZPTR 1E15A 4JFJA 4IQCA 5HBFA 4ODPA 1HKMA 3OA5A 1NWRA 2KR7A 3OOBA 1FKDA 3WD0A 3AROA 3UF8A 4XAKA 1ZB5A 1ZBCA 2PI6A 3ARPA 4W5UA 1FAPA 2ZQUA 3B8SA 1A7XA 3O5JA 4QZVB 3JYJA 1O6IA 3O5KA 4MPKA 3ARTA 3UI4A 1FKSA 3O5QA 4R5EA 2D9FA 5HTGA 2PPNA 5GQBA 1ROUA 4DWSD 3PRDA 1N1AA 2WK2A 1X6LA 2O92A 3CH9A 4Q7NA 2ITKA 3ARRA 1W1PA 4WKAA 4BF8A 1W1TA 3G6LA 4U84A 2ZQTA 4JFIA 3IHZA 1NWUA 1W1VA 4U85A 1NSGA 3O5DA 1SR0A 2LKNA 1FFRA 2DT2A 2PPPA 1CTNA 2XP9A 3GPKA 1WB0A 5GPRA 3WD3A 3O5FA 1HKIA 1KT0A 4MGVA 1JVWA 4JFMA 3WKZA 3KCEA 1ROTA 1J4RA 3O5MA 4G50A 1NWSA 2XP7A 4PTMA 2PV3A 4ODLA 1FKKA 1FJDA 4IPXA 1OGGA 3KADA 2OLHA 1ZL1A 3O5PA 4NNRA 5B8IC 3RFWA 1BL4A 3ARUA 4NZCA 3NI6A 5HKGA 2KFWA 3WL0A 1F40A 1ITXA 1D7JA 4Q22A 4N19A 3JXVA 4DH0A 4DT4A 4KQZA 3UQIA 3B9DA 1EDQA 4LAYA 2G8ZA 5JH8A 1C9HA 3ALGA 1HJXA 5J6EA 1WNOA 4U86A 4ZPVR 1KT1A 1H0IA 2ZR4A 1UR9A 1LG2A 1ZK6A 2WLYA 1B6CA 1XHGA 5HT1A 3O5GA 5HWBA 3I6CA 4TYOA 3BXWA 4P8VA 1Q1CA 2B31A 1WAWA 4Z2IA 1KFWA 1HKJA 1GPFA 1M5YA 1LJYA 2RURA 2XP5A 2FAPA 3RGCA 1E6RA 1OGBA 3WIJA 3RM4A 1ZU8A 1TCOC 3ARYA 2RUQA 2ZR5A 2M1IA 2XP8A 4WK9A 2MPHA 5DITA 1EYMA 4MNLA 2XP4A 2MF9A 4ZS6A 3WD2A 3AQUA 1P5QA 2MLZA 2N87A 2Y78A 1PINA 3PA7A 3WQVA 2IUZA 3ARWA 1HJWA 4Z2KA 4C02B 4WJXA 4LAXA 4J4OA 1R9HA 4ML4A 4JFLA 2A3EA 3FXYA 3CZ8A 4DWSA 3O5IA 3TC5A 3O5EA 1EQ3A 3KZ7A 1LL4A 4S3JA 4W9QA 2DPEA 2PV1A 1W9VA 1QZ2A 2A3AA 4L72B 3IKGA 3B9AA 2QF8A 3O5RA 1JNDA 4Z2LA 1FKRA 4JFKA 3O5LA 4JYSA 3UQAA 2MNTA 4DZ3A 2WM0A 4TW7A 5HUAA 4O2TA 5HWCA 5BXJA 1JNEA 5HW6A 4ODMA 4HBEA 3RM9A 3TDBA 3CGMA 1FKIA 2MLYA 4P8UA 3FY1A 2G41A 5HW7A 4J4NA 2AOSA 4DWSB 4DRNA 1Q6UA 3PRAA 1RD6A 3RM8A 1FKGA 4DROA 2YBUA 4DRQA 1YW5A 1EIBA 3KAGA 4DRPA 1JNTA 2K8IA 2WLZA 4TW8A 4TNSA 4HARA 2M08A 3ALFA 1GUVA 3CHEA 1HKKA 1NWTA 1NMWA 4LAVA 4DRMA 2LJ4A 1LG1A 1NMVA 2RUDA 4WKHA 1LQ0A 1TFVA 2DSZA 1W26A 3ARXA 1D2KA 2PBCA 3KAHA 2DG9A 1FKFA 1EHNA 4MNJA 4TW6A 5GPGA 1OWQA 3AS2A 5DO2A 4Z2JA 4MAVA 1W9UA 4GIVA 3B9EA 3AS0A 2MLXA 2Q5AA 3H9RB 3WD4A 3WD1A 5D75A 4P8WA 1FKHA 2DSUA 2VN1A 4IT4A 4S3KA 1H0GA 3JYMA 4ODOA 1U79A 1NH6A 3CHFA 4FAPA 2AWGA 2ZR6A 3G6MA 5DIUA 2A3CA 3NTPA 4HBOA 3WQWA 1YATA 2DG4A 4WKFA 4MNMA 4LAWA 1T11A 3UI5A 4Z2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAF A;  3O5M A;  4G50 A;  4DZ2 A;  3UI6 A;  2XP7 A;  3B7X A;  4W9P A;  1QPL A;  4ODN A;  3UQB A;  4ODR A;  5HW8 A;  2PV3 A;  1FKB A;  3IKG A;  1ZCN A;  1D6O A;  3FAP A;  3KAI A;  4ODL A;  4QIB A;  3O5O A;  4DRH A;  1FKK A;  2RSE A;  2OFN A;  3KAC A;  4DRI A;  1FJD A;  4IPX A;  3PRB A;  3O5R A;  4QT3 A;  1FKJ A;  2F21 A;  3KAD A;  4G2P A;  2RUC A;  1FKR A;  3O5P A;  1Q6I A;  2L2S A;  4JFK A;  3O5L A;  3WH0 A;  4NNR A;  2XPB A;  5B8I C;  4JYS A;  3UQA A;  2MNT A;  2DG3 A;  4DZ3 A;  3RFW A;  1BL4 A;  4TW7 A;  5HUA A;  4IQ2 A;  4O2T A;  5BXJ A;  5HWC A;  1QPF A;  3NI6 A;  5HKG A;  5HW6 A;  4JFJ A;  2XP6 A;  4ODM A;  2KFW A;  4IQC A;  1F40 A;  1PBK A;  3TDB A;  2KI3 A;  3CGM A;  1D7J A;  2PPO A;  1J4I A;  1FKI A;  3EY6 A;  4ODP A;  3LUO A;  2MLY A;  4N19 A;  2KR7 A;  3JXV A;  4DH0 A;  4DT4 A;  3UQI A;  3CGN A;  3OOB A;  1FKD A;  2LPV A;  2IF4 A;  4LAY A;  5HW7 A;  4J4N A;  1C9H A;  3ODK A;  3UF8 A;  1FKL A;  4DRN A;  5J6E A;  4U86 A;  1KT1 A;  1Q6U A;  1FKT A;  2ZR4 A;  1FAP A;  1FKG A;  4DRO A;  1ZK6 A;  2ZQU A;  1A7X A;  5I98 A;  1B6C A;  1HXV A;  3O5J A;  5DIV A;  3JYJ A;  3O5G A;  5HT1 A;  2XP3 A;  1YW5 A;  4DRQ A;  1J4R A;  4DRP A;  3KAG A;  3O5K A;  4ODK A;  5HWB A;  3I6C A;  4TYO A;  3MDY B;  1JNT A;  2K8I A;  2KGJ A;  4ODQ A;  4TW8 A;  1Q6H A;  1Q1C A;  2RQS A;  4TNS A;  2M08 A;  2F2D A;  4W9O A;  3UI4 A;  2RUR A;  1M5Y A;  1FKS A;  4DIP A;  1NMW A;  2PV2 A;  4LAV A;  2XP5 A;  3O5Q A;  2D9F A;  2FAP A;  3RGC A;  4DRM A;  5HTG A;  2KE0 A;  2LJ4 A;  4MSP A;  1FD9 A;  1NMV A;  2PPN A;  2RUD A;  1ROU A;  1F8A B;  1D7H A;  3PRD A;  1W26 A;  1N1A A;  2UZ5 A;  4R0X A;  1TCO C;  2XPA A;  2RUQ A;  2PBC A;  4DRK A;  2ZR5 A;  3KAH A;  2DG9 A;  1FKF A;  2M1I A;  2XP8 A;  2JZV A;  1BKF A;  2MPH A;  5DIT A;  1EYM A;  2F4E A;  2ITK A;  4TW6 A;  5GPG A;  3VAW A;  2XP4 A;  2MF9 A;  4FN2 A;  1J4H A;  2FKE A;  4BF8 A;  1P5Q A;  4GIV A;  2MLZ A;  2N87 A;  2Y78 A;  1PIN A;  2LGO A;  4U84 A;  2ZQV A;  3PA7 A;  2ZQT A;  4JFI A;  2MLX A;  3IHZ A;  3IKD A;  2Q5A A;  3H9R B;  1J6Y A;  4U85 A;  3NRK A;  1NSG A;  5D75 A;  1FKH A;  2VN1 A;  3O5D A;  4C02 B;  4LAX A;  1D7I A;  3JYM A;  1R9H A;  4J4O A;  2LKN A;  1U79 A;  4ODO A;  3TCZ A;  2M2A A;  2PPP A;  1Y0O A;  4JFL A;  4FAP A;  4QT2 A;  2AWG A;  2ZR6 A;  2XP9 A;  2KO7 A;  3GPK A;  3KAB A;  3O5I A;  5DIU A;  3TC5 A;  3NTP A;  2VCD A;  1JNS A;  3O5F A;  3O5E A;  1KT0 A;  3KZ7 A;  4MGV A;  1EQ3 A;  1YAT A;  2DG4 A;  1JVW A;  4W9Q A;  4JFM A;  4DRJ A;  4LAW A;  3IK8 A;  1T11 A;  2PV1 A;  4GGQ A;  4ITZ A;  4TX0 A;  1L1P A;  3UI5 A;  2ZQS A;  3KCE A;  1ROT A;  1QZ2 A; 
#chains in the Genus database with same CATH topology
 3KAF A;  4ZPW R;  2DT1 A;  3UI6 A;  3B7X A;  4W9P A;  1GOI A;  4ODR A;  1FKB A;  1ZBW A;  1ZCN A;  1D6O A;  3W4R A;  1K9T A;  4DRH A;  3AS1 A;  2RSE A;  3KAC A;  1E6P A;  1ZBK A;  1FKJ A;  2F21 A;  3CHD A;  4G2P A;  4IT6 A;  4Z2G A;  1Q6I A;  2L2S A;  2PN0 A;  2XPB A;  4IQ2 A;  1QPF A;  2DSV A;  2XP6 A;  1PBK A;  2KI3 A;  3CHC A;  2PPO A;  1J4I A;  3EY6 A;  3LUO A;  1UR8 A;  3CGN A;  1IX5 A;  2LPV A;  2IF4 A;  4P8X A;  3ODK A;  1FKL A;  1FKT A;  2EUL A;  2DT3 A;  5I98 A;  4MTV A;  4KR0 B;  1W1Y A;  2DT0 A;  1HXV A;  5DIV A;  1FFQ A;  2XP3 A;  4ODK A;  3MDY B;  2KGJ A;  2DSW A;  4ODQ A;  3WL1 A;  1Q6H A;  2RQS A;  4W9O A;  2F2D A;  1E6N A;  5DEZ A;  4DIP A;  2PV2 A;  1LL6 A;  2KE0 A;  3AS3 A;  4MSP A;  1FD9 A;  4WIW A;  1F8A B;  1D7H A;  2UZ5 A;  4R0X A;  3QOK A;  2XPA A;  4DRK A;  1E6Z A;  2JZV A;  4URI A;  1BKF A;  3VAW A;  2F4E A;  1SYT A;  4FN2 A;  1J4H A;  1HJV A;  2FKE A;  2YBT A;  4MNK A;  3ARV A;  2LGO A;  2ZQV A;  3IKD A;  1J6Y A;  3NRK A;  1ZBV A;  4LGX A;  1D7I A;  1W9P A;  3TCZ A;  2M2A A;  1Y0O A;  1X6N A;  4DWS C;  1E9L A;  3PR9 A;  4QT2 A;  2KO7 A;  3ARQ A;  2ESC A;  3KAB A;  1XRV A;  2VCD A;  1JNS A;  1VF8 A;  3ARS A;  4DRJ A;  3ARZ A;  3IK8 A;  1L1P A;  4GGQ A;  4ITZ A;  4TX0 A;  2ZQS A;  2FDM A;  4L3N A;  4DZ2 A;  4NSB A;  1QPL A;  4ODN A;  4AY1 A;  3UQB A;  5HW8 A;  3FAP A;  3KAI A;  4QIB A;  3O5O A;  2OFN A;  4DRI A;  4QT3 A;  3PRB A;  3RME A;  1LL7 A;  2RUC A;  3WH0 A;  2A3B A;  2DG3 A;  2O9O A;  5DF0 A;  4ZPT R;  1E15 A;  4JFJ A;  4IQC A;  5HBF A;  4ODP A;  1HKM A;  3OA5 A;  1NWR A;  2KR7 A;  3OOB A;  1FKD A;  3WD0 A;  3ARO A;  3UF8 A;  4XAK A;  1ZB5 A;  1ZBC A;  2PI6 A;  3ARP A;  4W5U A;  1FAP A;  2ZQU A;  3B8S A;  1A7X A;  1E44 A;  3O5J A;  4QZV B;  3JYJ A;  1O6I A;  3O5K A;  4MPK A;  3ART A;  3UI4 A;  1FKS A;  3O5Q A;  4R5E A;  2D9F A;  5HTG A;  2PPN A;  5GQB A;  1ROU A;  3GTY X;  4DWS D;  3PRD A;  1N1A A;  2WK2 A;  1X6L A;  2O92 A;  3CH9 A;  4Q7N A;  2ITK A;  2ETN A;  1GRJ A;  3ARR A;  1W1P A;  4WKA A;  4BF8 A;  1W1T A;  3G6L A;  4U84 A;  2ZQT A;  4JFI A;  3IHZ A;  1NWU A;  1W1V A;  4U85 A;  1NSG A;  3O5D A;  1SR0 A;  2LKN A;  1FFR A;  2DT2 A;  2PPP A;  1CTN A;  2XP9 A;  3GPK A;  1WB0 A;  5GPR A;  3WD3 A;  3O5F A;  1HKI A;  1KT0 A;  4MGV A;  3GU0 A;  1JVW A;  4JFM A;  3WKZ A;  3KCE A;  1ROT A;  1J4R A;  3O5M A;  4G50 A;  1NWS A;  2XP7 A;  4PTM A;  2PV3 A;  4ODL A;  2B5U B;  1FKK A;  1FJD A;  4IPX A;  1OGG A;  3KAD A;  2OLH A;  1ZL1 A;  3O5P A;  4NNR A;  5B8I C;  3RFW A;  1BL4 A;  3ARU A;  4NZC A;  3NI6 A;  5HKG A;  2KFW A;  3WL0 A;  1F40 A;  1ITX A;  3EIP A;  1D7J A;  4Q22 A;  4N19 A;  3JXV A;  4DH0 A;  4DT4 A;  4KQZ A;  3UQI A;  3B9D A;  1EDQ A;  4LAY A;  2G8Z A;  5JH8 A;  1C9H A;  3ALG A;  1HJX A;  5J6E A;  1WNO A;  4U86 A;  4ZPV R;  1KT1 A;  1H0I A;  2ZR4 A;  1UR9 A;  1LG2 A;  1ZK6 A;  2WLY A;  1B6C A;  1XHG A;  5HT1 A;  3O5G A;  5HWB A;  3I6C A;  4TYO A;  3BXW A;  4P8V A;  1Q1C A;  2B31 A;  1WAW A;  4Z2I A;  1KFW A;  1HKJ A;  1GPF A;  1M5Y A;  1LJY A;  2RUR A;  2XP5 A;  2FAP A;  3RGC A;  1E6R A;  1OGB A;  3WIJ A;  3RM4 A;  1ZU8 A;  1TCO C;  3ARY A;  2RUQ A;  2ZR5 A;  2M1I A;  2XP8 A;  4WK9 A;  2MPH A;  5DIT A;  1EYM A;  4MNL A;  2XP4 A;  2MF9 A;  4ZS6 A;  1JCH B;  3WD2 A;  3AQU A;  1P5Q A;  2MLZ A;  2N87 A;  2Y78 A;  1PIN A;  3PA7 A;  3WQV A;  2IUZ A;  3ARW A;  1HJW A;  4Z2K A;  4C02 B;  4WJX A;  4LAX A;  4J4O A;  1R9H A;  4ML4 A;  4JFL A;  2A3E A;  3FXY A;  3CZ8 A;  4DWS A;  3O5I A;  3TC5 A;  3O5E A;  1EQ3 A;  3KZ7 A;  1LL4 A;  4S3J A;  4W9Q A;  2DPE A;  2PV1 A;  1W9V A;  1QZ2 A;  2A3A A;  4L72 B;  2F23 A;  3IKG A;  3BMB A;  3B9A A;  2QF8 A;  3O5R A;  1JND A;  4Z2L A;  1FKR A;  4JFK A;  3O5L A;  4JYS A;  3UQA A;  2MNT A;  4DZ3 A;  2WM0 A;  4TW7 A;  5HUA A;  4O2T A;  5HWC A;  5BXJ A;  1JNE A;  5HW6 A;  4ODM A;  4HBE A;  3RM9 A;  3TDB A;  3CGM A;  1FKI A;  2MLY A;  4P8U A;  3FY1 A;  2G41 A;  5HW7 A;  4J4N A;  2AOS A;  4DWS B;  4DRN A;  1Q6U A;  3PRA A;  1RD6 A;  3RM8 A;  1FKG A;  4DRO A;  2YBU A;  4DRQ A;  1YW5 A;  1EIB A;  3KAG A;  4DRP A;  1JNT A;  2K8I A;  2WLZ A;  4TW8 A;  4UDM A;  4TNS A;  4HAR A;  2M08 A;  3ALF A;  1GUV A;  3CHE A;  1HKK A;  1NWT A;  1NMW A;  4LAV A;  4DRM A;  2P4V A;  2LJ4 A;  1LG1 A;  1NMV A;  2RUD A;  4WKH A;  1LQ0 A;  1TFV A;  2DSZ A;  1W26 A;  3ARX A;  1D2K A;  2PBC A;  3KAH A;  2DG9 A;  1FKF A;  1EHN A;  4MNJ A;  4TW6 A;  5GPG A;  1OWQ A;  3AS2 A;  5DO2 A;  4Z2J A;  4MAV A;  1W9U A;  4GIV A;  3B9E A;  3AS0 A;  2MLX A;  2Q5A A;  3H9R B;  3WD4 A;  3WD1 A;  5D75 A;  4P8W A;  1FKH A;  2DSU A;  2VN1 A;  4IT4 A;  4S3K A;  1H0G A;  3JYM A;  4ODO A;  1U79 A;  1NH6 A;  3CHF A;  4FAP A;  2AWG A;  2ZR6 A;  3G6M A;  5DIU A;  2A3C A;  3NTP A;  4HBO A;  3WQW A;  1YAT A;  2DG4 A;  4WKF A;  4MNM A;  4LAW A;  1T11 A;  3UI5 A;  4Z2H A; 
#chains in the Genus database with same CATH homology
 3KAF A;  4ZPW R;  2DT1 A;  3UI6 A;  3B7X A;  4W9P A;  1GOI A;  4ODR A;  1FKB A;  1ZBW A;  1ZCN A;  1D6O A;  3W4R A;  1K9T A;  4DRH A;  3AS1 A;  2RSE A;  3KAC A;  1E6P A;  1ZBK A;  1FKJ A;  2F21 A;  3CHD A;  4G2P A;  4IT6 A;  4Z2G A;  1Q6I A;  2L2S A;  2XPB A;  4IQ2 A;  1QPF A;  2DSV A;  2XP6 A;  1PBK A;  2KI3 A;  3CHC A;  2PPO A;  1J4I A;  3EY6 A;  3LUO A;  1UR8 A;  3CGN A;  1IX5 A;  2LPV A;  2IF4 A;  4P8X A;  3ODK A;  1FKL A;  1FKT A;  2DT3 A;  5I98 A;  4MTV A;  4KR0 B;  1W1Y A;  2DT0 A;  1HXV A;  5DIV A;  1FFQ A;  2XP3 A;  4ODK A;  3MDY B;  2KGJ A;  2DSW A;  4ODQ A;  3WL1 A;  1Q6H A;  2RQS A;  4W9O A;  2F2D A;  1E6N A;  5DEZ A;  4DIP A;  2PV2 A;  1LL6 A;  2KE0 A;  3AS3 A;  4MSP A;  1FD9 A;  4WIW A;  1F8A B;  1D7H A;  2UZ5 A;  4R0X A;  3QOK A;  2XPA A;  4DRK A;  1E6Z A;  2JZV A;  4URI A;  1BKF A;  3VAW A;  2F4E A;  1SYT A;  4FN2 A;  1J4H A;  1HJV A;  2FKE A;  2YBT A;  4MNK A;  3ARV A;  2LGO A;  2ZQV A;  3IKD A;  1J6Y A;  3NRK A;  1ZBV A;  4LGX A;  1D7I A;  1W9P A;  3TCZ A;  2M2A A;  1Y0O A;  1X6N A;  4DWS C;  1E9L A;  3PR9 A;  4QT2 A;  2KO7 A;  3ARQ A;  2ESC A;  3KAB A;  1XRV A;  2VCD A;  1JNS A;  1VF8 A;  3ARS A;  4DRJ A;  3ARZ A;  3IK8 A;  1L1P A;  4GGQ A;  4ITZ A;  4TX0 A;  2ZQS A;  2FDM A;  4L3N A;  4DZ2 A;  4NSB A;  1QPL A;  4ODN A;  4AY1 A;  3UQB A;  5HW8 A;  3FAP A;  3KAI A;  4QIB A;  3O5O A;  2OFN A;  4DRI A;  4QT3 A;  3PRB A;  3RME A;  1LL7 A;  2RUC A;  3WH0 A;  2A3B A;  2DG3 A;  2O9O A;  5DF0 A;  4ZPT R;  1E15 A;  4JFJ A;  4IQC A;  5HBF A;  4ODP A;  1HKM A;  3OA5 A;  1NWR A;  2KR7 A;  3OOB A;  1FKD A;  3WD0 A;  3ARO A;  3UF8 A;  4XAK A;  1ZB5 A;  1ZBC A;  2PI6 A;  3ARP A;  4W5U A;  1FAP A;  2ZQU A;  3B8S A;  1A7X A;  3O5J A;  4QZV B;  3JYJ A;  1O6I A;  3O5K A;  4MPK A;  3ART A;  3UI4 A;  1FKS A;  3O5Q A;  4R5E A;  2D9F A;  5HTG A;  2PPN A;  5GQB A;  1ROU A;  4DWS D;  3PRD A;  1N1A A;  2WK2 A;  1X6L A;  2O92 A;  3CH9 A;  4Q7N A;  2ITK A;  3ARR A;  1W1P A;  4WKA A;  4BF8 A;  1W1T A;  3G6L A;  4U84 A;  2ZQT A;  4JFI A;  3IHZ A;  1NWU A;  1W1V A;  4U85 A;  1NSG A;  3O5D A;  1SR0 A;  2LKN A;  1FFR A;  2DT2 A;  2PPP A;  1CTN A;  2XP9 A;  3GPK A;  1WB0 A;  5GPR A;  3WD3 A;  3O5F A;  1HKI A;  1KT0 A;  4MGV A;  1JVW A;  4JFM A;  3WKZ A;  3KCE A;  1ROT A;  1J4R A;  3O5M A;  4G50 A;  1NWS A;  2XP7 A;  4PTM A;  2PV3 A;  4ODL A;  1FKK A;  1FJD A;  4IPX A;  1OGG A;  3KAD A;  2OLH A;  1ZL1 A;  3O5P A;  4NNR A;  5B8I C;  3RFW A;  1BL4 A;  3ARU A;  4NZC A;  3NI6 A;  5HKG A;  2KFW A;  3WL0 A;  1F40 A;  1ITX A;  1D7J A;  4Q22 A;  4N19 A;  3JXV A;  4DH0 A;  4DT4 A;  4KQZ A;  3UQI A;  3B9D A;  1EDQ A;  4LAY A;  2G8Z A;  5JH8 A;  1C9H A;  3ALG A;  1HJX A;  5J6E A;  1WNO A;  4U86 A;  4ZPV R;  1KT1 A;  1H0I A;  2ZR4 A;  1UR9 A;  1LG2 A;  1ZK6 A;  2WLY A;  1B6C A;  1XHG A;  5HT1 A;  3O5G A;  5HWB A;  3I6C A;  4TYO A;  3BXW A;  4P8V A;  1Q1C A;  2B31 A;  1WAW A;  4Z2I A;  1KFW A;  1HKJ A;  1GPF A;  1M5Y A;  1LJY A;  2RUR A;  2XP5 A;  2FAP A;  3RGC A;  1E6R A;  1OGB A;  3WIJ A;  3RM4 A;  1ZU8 A;  1TCO C;  3ARY A;  2RUQ A;  2ZR5 A;  2M1I A;  2XP8 A;  4WK9 A;  2MPH A;  5DIT A;  1EYM A;  4MNL A;  2XP4 A;  2MF9 A;  4ZS6 A;  3WD2 A;  3AQU A;  1P5Q A;  2MLZ A;  2N87 A;  2Y78 A;  1PIN A;  3PA7 A;  3WQV A;  2IUZ A;  3ARW A;  1HJW A;  4Z2K A;  4C02 B;  4WJX A;  4LAX A;  4J4O A;  1R9H A;  4ML4 A;  4JFL A;  2A3E A;  3FXY A;  3CZ8 A;  4DWS A;  3O5I A;  3TC5 A;  3O5E A;  1EQ3 A;  3KZ7 A;  1LL4 A;  4S3J A;  4W9Q A;  2DPE A;  2PV1 A;  1W9V A;  1QZ2 A;  2A3A A;  4L72 B;  3IKG A;  3B9A A;  2QF8 A;  3O5R A;  1JND A;  4Z2L A;  1FKR A;  4JFK A;  3O5L A;  4JYS A;  3UQA A;  2MNT A;  4DZ3 A;  2WM0 A;  4TW7 A;  5HUA A;  4O2T A;  5HWC A;  5BXJ A;  1JNE A;  5HW6 A;  4ODM A;  4HBE A;  3RM9 A;  3TDB A;  3CGM A;  1FKI A;  2MLY A;  4P8U A;  3FY1 A;  2G41 A;  5HW7 A;  4J4N A;  2AOS A;  4DWS B;  4DRN A;  1Q6U A;  3PRA A;  1RD6 A;  3RM8 A;  1FKG A;  4DRO A;  2YBU A;  4DRQ A;  1YW5 A;  1EIB A;  3KAG A;  4DRP A;  1JNT A;  2K8I A;  2WLZ A;  4TW8 A;  4TNS A;  4HAR A;  2M08 A;  3ALF A;  1GUV A;  3CHE A;  1HKK A;  1NWT A;  1NMW A;  4LAV A;  4DRM A;  2LJ4 A;  1LG1 A;  1NMV A;  2RUD A;  4WKH A;  1LQ0 A;  1TFV A;  2DSZ A;  1W26 A;  3ARX A;  1D2K A;  2PBC A;  3KAH A;  2DG9 A;  1FKF A;  1EHN A;  4MNJ A;  4TW6 A;  5GPG A;  1OWQ A;  3AS2 A;  5DO2 A;  4Z2J A;  4MAV A;  1W9U A;  4GIV A;  3B9E A;  3AS0 A;  2MLX A;  2Q5A A;  3H9R B;  3WD4 A;  3WD1 A;  5D75 A;  4P8W A;  1FKH A;  2DSU A;  2VN1 A;  4IT4 A;  4S3K A;  1H0G A;  3JYM A;  4ODO A;  1U79 A;  1NH6 A;  3CHF A;  4FAP A;  2AWG A;  2ZR6 A;  3G6M A;  5DIU A;  2A3C A;  3NTP A;  4HBO A;  3WQW A;  1YAT A;  2DG4 A;  4WKF A;  4MNM A;  4LAW A;  1T11 A;  3UI5 A;  4Z2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...