5HWBA

Aspergillus fumigatus fkbp12 apo protein in p212121 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwbA00
3PRDA 3OOBA 3KAGA 1D7HA 4QIBA 1R9HA 4BF8A 5DIUA 1J4HA 2DG4A 2LGOA 3KAFA 3PRBA 4ODKA 4C02B 2XPBA 2ZQTA 3O5RA 4GIVA 1EYMA 2ZR5A 2M1IA 4ODRA 4DZ3A 4QT3A 3IKGA 1J6YA 2ZR4A 1FKKA 1P5QA 1ZCNA 2MLXA 4IQ2A 4LAXA 4NNRA 1FKFA 2RQSA 3JYJA 4O2TA 2PV3A 1KT1A 4ODMA 4LAVA 1C9HA 2M08A 2Q5AA 3UI4A 3JYMA 3UQAA 2MLZA 3UI6A 4FN2A 1HXVA 3O5DA 4JFLA 4ODOA 4DIPA 4DRIA 3H9RB 3GPKA 4DRQA 2D9FA 1JNTA 3UQBA 1D6OA 2VN1A 2ZQUA 3IK8A 3NI6A 5D75A 4DH0A 4MSPA 2KR7A 3KABA 1D7JA 4JFKA 4DRJA 2XP5A 5B8IC 1Q1CA 2KGJA 3TDBA 1QPLA 3O5KA 1ROTA 4U86A 1ROUA 3PA7A 4J4OA 5HWBA 3VAWA 3O5PA 1EQ3A 2XP8A 3WH0A 3B7XA 1FKGA 1KT0A 2XP9A 4MGVA 4QT2A 5HWCA 4TNSA 5HTGA 4ODPA 4W9OA 3LUOA 4TW7A 5J6EA 1FKDA 1PINA 2KO7A 1FKLA 4TW6A 4JFMA 5HT1A 3TC5A 1FKRA 2FKEA 1Q6HA 1TCOC 2JZVA 3EY6A 1D7IA 4ODQA 2ZQVA 2RURA 3KAHA 2XP6A 3CGNA 1ZK6A 2UZ5A 3IKDA 2MNTA 5DIVA 1JVWA 1F8AB 1BKFA 5HKGA 2N87A 1NMWA 3UF8A 4JFIA 3KACA 4ODLA 4IQCA 3KZ7A 1B6CA 4W9PA 1M5YA 1QZ2A 1T11A 1Y0OA 2F21A 3O5IA 4DRMA 4J4NA 1QPFA 2ITKA 1FKJA 1NMVA 2LJ4A 2XP3A 2IF4A 2DG9A 3O5GA 4TYOA 2PV1A 1FKHA 2DG3A 4ITZA 2PPNA 4IPXA 2XPAA 1FD9A 1FKBA 1BL4A 2OFNA 2MF9A 3MDYB 3O5OA 3KAIA 4DRNA 2F4EA 2RUCA 5HW6A 1J4IA 2ZR6A 4LAYA 1FAPA 1Q6UA 4U84A 2L2SA 3UI5A 3IHZA 1YW5A 2KI3A 1L1PA 3O5QA 2MPHA 2RUDA 3O5EA 3JXVA 3NTPA 3KCEA 1F40A 2KE0A 2F2DA 4DZ2A 4G50A 4U85A 4W9QA 3UQIA 2PBCA 5HW7A 3RFWA 5HW8A 2KFWA 4DROA 2ZQSA 4TW8A 2XP7A 3I6CA 4G2PA 3O5JA 2MLYA 1FKTA 3O5MA 5I98A 4R0XA 2AWGA 3TCZA 2Y78A 4TX0A 3FAPA 4ODNA 1YATA 1FJDA 4DRKA 3RGCA 3O5FA 3O5LA 2XP4A 1JNSA 1J4RA 1FKSA 2RUQA 2FAPA 4JFJA 5GPGA 1Q6IA 4DRHA 1A7XA 3ODKA 1NSGA 3KADA 3NRKA 2LPVA 5DITA 2M2AA 2K8IA 4JYSA 4LAWA 4GGQA 2RSEA 2PPPA 1W26A 4N19A 1FKIA 2PPOA 5HUAA 1PBKA 4FAPA 1U79A 2PV2A 4DRPA 1N1AA 3CGMA 2VCDA 2LKNA 5BXJA 4DT4A
chains in the Genus database with same CATH superfamily
4MNJA 3OOBA 4NSBA 4MNLA 4QIBA 2DG4A 1ZBKA 3CZ8A 4GIVA 3AS2A 4QT3A 1ZBVA 5HBFA 1SYTA 1E6RA 2ZR4A 1FKKA 1ZCNA 3ARYA 4O2TA 4LAVA 4Z2JA 1ZBWA 3ARSA 4PTMA 4KQZA 3WD4A 1NWUA 2D9FA 2ZQUA 4ZS6A 3IK8A 5D75A 2QF8A 2KR7A 3KABA 2G8ZA 1QPLA 3O5KA 1ROUA 1EQ3A 1TFVA 4TNSA 2DSWA 3LUOA 5J6EA 1FKRA 4JFMA 1TCOC 1UR9A 2JZVA 3KAHA 1ZK6A 4Q22A 1BKFA 2DT0A 1HJWA 4WIWA 3KACA 1HKJA 1NWSA 3WD2A 4W9PA 1B6CA 1K9TA 1Y0OA 4P8UA 1NMVA 3O5GA 2WLYA 2PV1A 1JCHB 4Z2IA 4IPXA 4KR0B 4R5EA 3WIJA 4AY1A 2OFNA 3O5OA 1UR8A 2RUCA 1J4IA 4U84A 3EIPA 3OA5A 3WD3A 2MPHA 3NTPA 3KCEA 4DZ2A 2F2DA 1E6ZA 1FFQA 1EIBA 1E15A 4DROA 2XP7A 4G2PA 3WD0A 2AWGA 1EDQA 4TX0A 1FJDA 4MPKA 3O5FA 1LQ0A 1FKSA 4JFJA 5GPGA 4P8WA 3ODKA 3KADA 4MTVA 1W1TA 4JYSA 4GGQA 2O92A 3G6MA 2RSEA 1HKIA 1W26A 4FAPA 1LL6A 1W1PA 1X6NA 1W9VA 4BF8A 1R9HA 3WL0A 1J4HA 1LJYA 3ARUA 3CH9A 3PRBA 4WKAA 4C02B 3B9AA 3RMEA 1EYMA 2WM0A 1ZBCA 4ODRA 1EHNA 1FFRA 3GU0A 4Z2GA 2PV3A 1LG1A 4DWSB 1LL4A 1NWTA 1C9HA 2Q5AA 3JYMA 1HJXA 4FN2A 4JFLA 4DIPA 3G6LA 1H0GA 1D6OA 4HBEA 2VN1A 3NI6A 5B8IC 4DRJA 1D7JA 2PI6A 1Q1CA 2KGJA 4U86A 4W5UA 5HWBA 3VAWA 1IX5A 2XP8A 4WKFA 3B7XA 4WK9A 2AOSA 2KO7A 1PINA 3AS0A 1FKLA 3EY6A 1OGGA 4ODQA 1W1YA 2UZ5A 3IKDA 2MNTA 5DIVA 5HKGA 2N87A 5DEZA 3KZ7A 1M5YA 1T11A 1W9PA 4J4NA 2P4VA 3B9EA 4DWSC 2DG9A 2DSUA 3RM9A 4HARA 1FKBA 1SR0A 5I98A 2ZR6A 1X6LA 1W1VA 4Z2KA 2KI3A 2B31A 3O5EA 3B8SA 4W9QA 3UQIA 2YBTA 2G41A 5HW7A 5HW8A 2KFWA 1XRVA 4HBOA 4NZCA 2MLYA 1FKTA 3O5MA 3FAPA 1YATA 3RGCA 1OWQA 1GRJA 3O5LA 2FAPA 3NRKA 2LPVA 4IT6A 3ALFA 2PPPA 4N19A 4WKHA 1ZL1A 4Z2HA 3WL1A 4DT4A 1HJVA 3PRDA 2IUZA 3KAGA 1D7HA 1W9UA 3ARWA 4ODKA 1GPFA 1XHGA 5DF0A 3O5RA 2M1IA 3WD1A 4ZPTR 1J6YA 4Z2LA 4LAXA 4NNRA 1FKFA 1GUVA 2RQSA 1NWRA 4ODMA 3UI4A 1ZB5A 3UQAA 2MLZA 3UI6A 1HXVA 1JNEA 2DT3A 3H9RB 3ALGA 5HW6A 4MSPA 4JFKA 1KFWA 1ROTA 4J4OA 3ARZA 3O5PA 5HWCA 1FKGA 1KT0A 4MGVA 4ZPWR 5HTGA 4W9OA 3FY1A 3GTYX 4TW7A 1O6IA 3TC5A 5HT1A 2EULA 2FKEA 3WKZA 3WQWA 2ZQVA 2A3BA 3CGNA 1VF8A 4ML4A 1F8AB 1NMWA 3UF8A 4JFIA 1WNOA 3FXYA 1FKJA 2LJ4A 1HKKA 2DT1A 1FKHA 4ITZA 4QZVB 2PPNA 4MAVA 3WQVA 2DSZA 4S3JA 1ITXA 1BL4A 2MF9A 3KAIA 2F4EA 3UI5A 1FAPA 2L2SA 1L1PA 3BXWA 3JXVA 1JNDA 1F40A 4DWSA 3CHCA 1D2KA 4U85A 5DO2A 4P8VA 1E9LA 1WB0A 3ARQA 1LG2A 3RFWA 1LL7A 2ZQSA 4TW8A 1HKMA 4IT4A 3ARPA 1RD6A 4L72B 3TCZA 1E6PA 2Y78A 4ODNA 2XP4A 1NH6A 1J4RA 4LGXA 1Q6IA 4DRHA 3CHFA 3ARTA 3QOKA 4WJXA 3ARXA 2PPOA 5HUAA 4DRPA 2PV2A 1WAWA 5BXJA 2DPEA 1H0IA 5DIUA 2LGOA 3KAFA 2XPBA 2ZQTA 2ZR5A 3CHDA 4DZ3A 3IKGA 3W4RA 1P5QA 2MLXA 4IQ2A 4MNMA 4L3NA 4DWSD 2PN0A 3JYJA 4URIA 1KT1A 2ESCA 2F23A 4MNKA 2M08A 1E44A 3O5DA 4ODOA 4DRIA 4DRQA 3GPKA 1JNTA 3UQBA 4DH0A 1GOIA 2XP5A 3TDBA 4P8XA 3PA7A 2A3CA 3WH0A 2XP9A 4QT2A 5JH8A 4ODPA 1FKDA 4Q7NA 4TW6A 2A3EA 3ARRA 1Q6HA 1OGBA 1D7IA 3BMBA 2O9OA 2RURA 2XP6A 2DSVA 3AROA 1JVWA 2B5UB 3AS3A 3RM8A 4UDMA 4ODLA 4IQCA 4DRMA 1QZ2A 3O5IA 2F21A 1QPFA 2ITKA 2XP3A 4TYOA 2IF4A 4XAKA 2DG3A 3ARVA 2XPAA 1CTNA 1FD9A 4DRNA 3MDYB 2OLHA 5GPRA 4LAYA 1Q6UA 3PRAA 3IHZA 1YW5A 3O5QA 2RUDA 2KE0A 4G50A 2YBUA 2FDMA 2PBCA 2WLZA 3PR9A 3I6CA 3O5JA 1E6NA 2A3AA 1ZU8A 4R0XA 5GQBA 2DT2A 3AQUA 4DRKA 4ZPVR 2WK2A 1JNSA 3CHEA 2RUQA 3AS1A 1A7XA 1NSGA 5DITA 2M2AA 2ETNA 2K8IA 4LAWA 3B9DA 1FKIA 3RM4A 1PBKA 1U79A 1N1AA 3CGMA 2VCDA 2LKNA 4S3KA
chains in the Genus database with same CATH topology
4MNJA 3OOBA 4NSBA 4MNLA 4QIBA 2DG4A 1ZBKA 3CZ8A 4GIVA 3AS2A 4QT3A 1ZBVA 5HBFA 1SYTA 1E6RA 2ZR4A 1FKKA 1ZCNA 3ARYA 4O2TA 4LAVA 4Z2JA 1ZBWA 3ARSA 4PTMA 4KQZA 3WD4A 1NWUA 2D9FA 2ZQUA 4ZS6A 3IK8A 5D75A 2QF8A 2KR7A 3KABA 2G8ZA 1QPLA 3O5KA 1ROUA 1EQ3A 1TFVA 4TNSA 2DSWA 3LUOA 5J6EA 1FKRA 4JFMA 1TCOC 1UR9A 2JZVA 3KAHA 1ZK6A 4Q22A 1BKFA 2DT0A 1HJWA 4WIWA 3KACA 1HKJA 1NWSA 3WD2A 4W9PA 1B6CA 1K9TA 1Y0OA 4P8UA 1NMVA 3O5GA 2WLYA 2PV1A 4Z2IA 4IPXA 4KR0B 4R5EA 3WIJA 4AY1A 2OFNA 3O5OA 1UR8A 2RUCA 1J4IA 4U84A 3OA5A 3WD3A 2MPHA 3NTPA 3KCEA 4DZ2A 2F2DA 1E6ZA 1FFQA 1EIBA 1E15A 4DROA 2XP7A 4G2PA 3WD0A 2AWGA 1EDQA 4TX0A 1FJDA 4MPKA 3O5FA 1LQ0A 1FKSA 4JFJA 5GPGA 4P8WA 3ODKA 3KADA 4MTVA 1W1TA 4JYSA 4GGQA 2O92A 3G6MA 2RSEA 1HKIA 1W26A 4FAPA 1LL6A 1W1PA 1X6NA 1W9VA 4BF8A 1R9HA 3WL0A 1J4HA 1LJYA 3ARUA 3CH9A 3PRBA 4WKAA 4C02B 3B9AA 3RMEA 1EYMA 2WM0A 1ZBCA 4ODRA 1EHNA 1FFRA 4Z2GA 2PV3A 1LG1A 4DWSB 1LL4A 1NWTA 1C9HA 2Q5AA 3JYMA 1HJXA 4FN2A 4JFLA 4DIPA 3G6LA 1H0GA 1D6OA 4HBEA 2VN1A 3NI6A 5B8IC 4DRJA 1D7JA 2PI6A 1Q1CA 2KGJA 4U86A 4W5UA 5HWBA 3VAWA 1IX5A 2XP8A 4WKFA 3B7XA 4WK9A 2AOSA 2KO7A 1PINA 3AS0A 1FKLA 3EY6A 1OGGA 4ODQA 1W1YA 2UZ5A 3IKDA 2MNTA 5DIVA 5HKGA 2N87A 5DEZA 3KZ7A 1M5YA 1T11A 1W9PA 4J4NA 3B9EA 4DWSC 2DG9A 2DSUA 3RM9A 4HARA 1FKBA 1SR0A 5I98A 2ZR6A 1X6LA 1W1VA 4Z2KA 2KI3A 2B31A 3O5EA 3B8SA 4W9QA 3UQIA 2YBTA 2G41A 5HW7A 5HW8A 2KFWA 1XRVA 4HBOA 4NZCA 2MLYA 1FKTA 3O5MA 3FAPA 1YATA 3RGCA 1OWQA 3O5LA 2FAPA 3NRKA 2LPVA 4IT6A 3ALFA 2PPPA 4N19A 4WKHA 1ZL1A 4Z2HA 3WL1A 4DT4A 1HJVA 3PRDA 2IUZA 3KAGA 1D7HA 1W9UA 3ARWA 4ODKA 1GPFA 1XHGA 5DF0A 3O5RA 2M1IA 3WD1A 4ZPTR 1J6YA 4Z2LA 4LAXA 4NNRA 1FKFA 1GUVA 2RQSA 1NWRA 4ODMA 3UI4A 1ZB5A 3UQAA 2MLZA 3UI6A 1HXVA 1JNEA 2DT3A 3H9RB 3ALGA 5HW6A 4MSPA 4JFKA 1KFWA 1ROTA 4J4OA 3ARZA 3O5PA 5HWCA 1FKGA 1KT0A 4MGVA 4ZPWR 5HTGA 4W9OA 3FY1A 4TW7A 1O6IA 3TC5A 5HT1A 2FKEA 3WKZA 3WQWA 2ZQVA 2A3BA 3CGNA 1VF8A 4ML4A 1F8AB 1NMWA 3UF8A 4JFIA 1WNOA 3FXYA 1FKJA 2LJ4A 1HKKA 2DT1A 1FKHA 4ITZA 4QZVB 2PPNA 4MAVA 3WQVA 2DSZA 4S3JA 1ITXA 1BL4A 2MF9A 3KAIA 2F4EA 3UI5A 1FAPA 2L2SA 1L1PA 3BXWA 3JXVA 1JNDA 1F40A 4DWSA 3CHCA 1D2KA 4U85A 5DO2A 4P8VA 1E9LA 1WB0A 3ARQA 1LG2A 3RFWA 1LL7A 2ZQSA 4TW8A 1HKMA 4IT4A 3ARPA 1RD6A 4L72B 3TCZA 1E6PA 2Y78A 4ODNA 2XP4A 1NH6A 1J4RA 4LGXA 1Q6IA 4DRHA 3CHFA 3ARTA 3QOKA 4WJXA 3ARXA 2PPOA 5HUAA 4DRPA 2PV2A 1WAWA 5BXJA 2DPEA 1H0IA 5DIUA 2LGOA 3KAFA 2XPBA 2ZQTA 2ZR5A 3CHDA 4DZ3A 3IKGA 3W4RA 1P5QA 2MLXA 4IQ2A 4MNMA 4L3NA 4DWSD 3JYJA 4URIA 1KT1A 2ESCA 4MNKA 2M08A 3O5DA 4ODOA 4DRIA 4DRQA 3GPKA 1JNTA 3UQBA 4DH0A 1GOIA 2XP5A 3TDBA 4P8XA 3PA7A 2A3CA 3WH0A 2XP9A 4QT2A 5JH8A 4ODPA 1FKDA 4Q7NA 4TW6A 2A3EA 3ARRA 1Q6HA 1OGBA 1D7IA 2O9OA 2RURA 2XP6A 2DSVA 3AROA 1JVWA 3AS3A 3RM8A 4ODLA 4IQCA 4DRMA 1QZ2A 3O5IA 2F21A 1QPFA 2ITKA 2XP3A 4TYOA 2IF4A 4XAKA 2DG3A 3ARVA 2XPAA 1CTNA 1FD9A 4DRNA 3MDYB 2OLHA 5GPRA 4LAYA 1Q6UA 3PRAA 3IHZA 1YW5A 3O5QA 2RUDA 2KE0A 4G50A 2YBUA 2FDMA 2PBCA 2WLZA 3PR9A 3I6CA 3O5JA 1E6NA 2A3AA 1ZU8A 4R0XA 5GQBA 2DT2A 3AQUA 4DRKA 4ZPVR 2WK2A 1JNSA 3CHEA 2RUQA 3AS1A 1A7XA 1NSGA 5DITA 2M2AA 2K8IA 4LAWA 3B9DA 1FKIA 3RM4A 1PBKA 1U79A 1N1AA 3CGMA 2VCDA 2LKNA 4S3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRD A;  3OOB A;  3KAG A;  1D7H A;  4QIB A;  1R9H A;  4BF8 A;  5DIU A;  1J4H A;  2DG4 A;  2LGO A;  3KAF A;  3PRB A;  4ODK A;  4C02 B;  2XPB A;  2ZQT A;  3O5R A;  4GIV A;  1EYM A;  2ZR5 A;  2M1I A;  4ODR A;  4DZ3 A;  4QT3 A;  3IKG A;  1J6Y A;  2ZR4 A;  1FKK A;  1P5Q A;  1ZCN A;  2MLX A;  4IQ2 A;  4LAX A;  4NNR A;  1FKF A;  2RQS A;  3JYJ A;  4O2T A;  2PV3 A;  1KT1 A;  4ODM A;  4LAV A;  1C9H A;  2M08 A;  2Q5A A;  3UI4 A;  3JYM A;  3UQA A;  2MLZ A;  3UI6 A;  4FN2 A;  1HXV A;  3O5D A;  4JFL A;  4ODO A;  4DIP A;  4DRI A;  3H9R B;  3GPK A;  4DRQ A;  2D9F A;  1JNT A;  3UQB A;  1D6O A;  2VN1 A;  2ZQU A;  3IK8 A;  3NI6 A;  5D75 A;  4DH0 A;  4MSP A;  2KR7 A;  3KAB A;  1D7J A;  4JFK A;  4DRJ A;  2XP5 A;  5B8I C;  1Q1C A;  2KGJ A;  3TDB A;  1QPL A;  3O5K A;  1ROT A;  4U86 A;  1ROU A;  3PA7 A;  4J4O A;  5HWB A;  3VAW A;  3O5P A;  1EQ3 A;  2XP8 A;  3WH0 A;  3B7X A;  1FKG A;  1KT0 A;  2XP9 A;  4MGV A;  4QT2 A;  5HWC A;  4TNS A;  5HTG A;  4ODP A;  4W9O A;  3LUO A;  4TW7 A;  5J6E A;  1FKD A;  1PIN A;  2KO7 A;  1FKL A;  4TW6 A;  4JFM A;  5HT1 A;  3TC5 A;  1FKR A;  2FKE A;  1Q6H A;  1TCO C;  2JZV A;  3EY6 A;  1D7I A;  4ODQ A;  2ZQV A;  2RUR A;  3KAH A;  2XP6 A;  3CGN A;  1ZK6 A;  2UZ5 A;  3IKD A;  2MNT A;  5DIV A;  1JVW A;  1F8A B;  1BKF A;  5HKG A;  2N87 A;  1NMW A;  3UF8 A;  4JFI A;  3KAC A;  4ODL A;  4IQC A;  3KZ7 A;  1B6C A;  4W9P A;  1M5Y A;  1QZ2 A;  1T11 A;  1Y0O A;  2F21 A;  3O5I A;  4DRM A;  4J4N A;  1QPF A;  2ITK A;  1FKJ A;  1NMV A;  2LJ4 A;  2XP3 A;  2IF4 A;  2DG9 A;  3O5G A;  4TYO A;  2PV1 A;  1FKH A;  2DG3 A;  4ITZ A;  2PPN A;  4IPX A;  2XPA A;  1FD9 A;  1FKB A;  1BL4 A;  2OFN A;  2MF9 A;  3MDY B;  3O5O A;  3KAI A;  4DRN A;  2F4E A;  2RUC A;  5HW6 A;  1J4I A;  2ZR6 A;  4LAY A;  1FAP A;  1Q6U A;  4U84 A;  2L2S A;  3UI5 A;  3IHZ A;  1YW5 A;  2KI3 A;  1L1P A;  3O5Q A;  2MPH A;  2RUD A;  3O5E A;  3JXV A;  3NTP A;  3KCE A;  1F40 A;  2KE0 A;  2F2D A;  4DZ2 A;  4G50 A;  4U85 A;  4W9Q A;  3UQI A;  2PBC A;  5HW7 A;  3RFW A;  5HW8 A;  2KFW A;  4DRO A;  2ZQS A;  4TW8 A;  2XP7 A;  3I6C A;  4G2P A;  3O5J A;  2MLY A;  1FKT A;  3O5M A;  5I98 A;  4R0X A;  2AWG A;  3TCZ A;  2Y78 A;  4TX0 A;  3FAP A;  4ODN A;  1YAT A;  1FJD A;  4DRK A;  3RGC A;  3O5F A;  3O5L A;  2XP4 A;  1JNS A;  1J4R A;  1FKS A;  2RUQ A;  2FAP A;  4JFJ A;  5GPG A;  1Q6I A;  4DRH A;  1A7X A;  3ODK A;  1NSG A;  3KAD A;  3NRK A;  2LPV A;  5DIT A;  2M2A A;  2K8I A;  4JYS A;  4LAW A;  4GGQ A;  2RSE A;  2PPP A;  1W26 A;  4N19 A;  1FKI A;  2PPO A;  5HUA A;  1PBK A;  4FAP A;  1U79 A;  2PV2 A;  4DRP A;  1N1A A;  3CGM A;  2VCD A;  2LKN A;  5BXJ A;  4DT4 A; 
#chains in the Genus database with same CATH topology
 4MNJ A;  3OOB A;  4NSB A;  4MNL A;  4QIB A;  2DG4 A;  1ZBK A;  3CZ8 A;  4GIV A;  3AS2 A;  4QT3 A;  1ZBV A;  5HBF A;  1SYT A;  1E6R A;  2ZR4 A;  1FKK A;  1ZCN A;  3ARY A;  4O2T A;  4LAV A;  4Z2J A;  1ZBW A;  3ARS A;  4PTM A;  4KQZ A;  3WD4 A;  1NWU A;  2D9F A;  2ZQU A;  4ZS6 A;  3IK8 A;  5D75 A;  2QF8 A;  2KR7 A;  3KAB A;  2G8Z A;  1QPL A;  3O5K A;  1ROU A;  1EQ3 A;  1TFV A;  4TNS A;  2DSW A;  3LUO A;  5J6E A;  1FKR A;  4JFM A;  1TCO C;  1UR9 A;  2JZV A;  3KAH A;  1ZK6 A;  4Q22 A;  1BKF A;  2DT0 A;  1HJW A;  4WIW A;  3KAC A;  1HKJ A;  1NWS A;  3WD2 A;  4W9P A;  1B6C A;  1K9T A;  1Y0O A;  4P8U A;  1NMV A;  3O5G A;  2WLY A;  2PV1 A;  1JCH B;  4Z2I A;  4IPX A;  4KR0 B;  4R5E A;  3WIJ A;  4AY1 A;  2OFN A;  3O5O A;  1UR8 A;  2RUC A;  1J4I A;  4U84 A;  3EIP A;  3OA5 A;  3WD3 A;  2MPH A;  3NTP A;  3KCE A;  4DZ2 A;  2F2D A;  1E6Z A;  1FFQ A;  1EIB A;  1E15 A;  4DRO A;  2XP7 A;  4G2P A;  3WD0 A;  2AWG A;  1EDQ A;  4TX0 A;  1FJD A;  4MPK A;  3O5F A;  1LQ0 A;  1FKS A;  4JFJ A;  5GPG A;  4P8W A;  3ODK A;  3KAD A;  4MTV A;  1W1T A;  4JYS A;  4GGQ A;  2O92 A;  3G6M A;  2RSE A;  1HKI A;  1W26 A;  4FAP A;  1LL6 A;  1W1P A;  1X6N A;  1W9V A;  4BF8 A;  1R9H A;  3WL0 A;  1J4H A;  1LJY A;  3ARU A;  3CH9 A;  3PRB A;  4WKA A;  4C02 B;  3B9A A;  3RME A;  1EYM A;  2WM0 A;  1ZBC A;  4ODR A;  1EHN A;  1FFR A;  3GU0 A;  4Z2G A;  2PV3 A;  1LG1 A;  4DWS B;  1LL4 A;  1NWT A;  1C9H A;  2Q5A A;  3JYM A;  1HJX A;  4FN2 A;  4JFL A;  4DIP A;  3G6L A;  1H0G A;  1D6O A;  4HBE A;  2VN1 A;  3NI6 A;  5B8I C;  4DRJ A;  1D7J A;  2PI6 A;  1Q1C A;  2KGJ A;  4U86 A;  4W5U A;  5HWB A;  3VAW A;  1IX5 A;  2XP8 A;  4WKF A;  3B7X A;  4WK9 A;  2AOS A;  2KO7 A;  1PIN A;  3AS0 A;  1FKL A;  3EY6 A;  1OGG A;  4ODQ A;  1W1Y A;  2UZ5 A;  3IKD A;  2MNT A;  5DIV A;  5HKG A;  2N87 A;  5DEZ A;  3KZ7 A;  1M5Y A;  1T11 A;  1W9P A;  4J4N A;  2P4V A;  3B9E A;  4DWS C;  2DG9 A;  2DSU A;  3RM9 A;  4HAR A;  1FKB A;  1SR0 A;  5I98 A;  2ZR6 A;  1X6L A;  1W1V A;  4Z2K A;  2KI3 A;  2B31 A;  3O5E A;  3B8S A;  4W9Q A;  3UQI A;  2YBT A;  2G41 A;  5HW7 A;  5HW8 A;  2KFW A;  1XRV A;  4HBO A;  4NZC A;  2MLY A;  1FKT A;  3O5M A;  3FAP A;  1YAT A;  3RGC A;  1OWQ A;  1GRJ A;  3O5L A;  2FAP A;  3NRK A;  2LPV A;  4IT6 A;  3ALF A;  2PPP A;  4N19 A;  4WKH A;  1ZL1 A;  4Z2H A;  3WL1 A;  4DT4 A;  1HJV A;  3PRD A;  2IUZ A;  3KAG A;  1D7H A;  1W9U A;  3ARW A;  4ODK A;  1GPF A;  1XHG A;  5DF0 A;  3O5R A;  2M1I A;  3WD1 A;  4ZPT R;  1J6Y A;  4Z2L A;  4LAX A;  4NNR A;  1FKF A;  1GUV A;  2RQS A;  1NWR A;  4ODM A;  3UI4 A;  1ZB5 A;  3UQA A;  2MLZ A;  3UI6 A;  1HXV A;  1JNE A;  2DT3 A;  3H9R B;  3ALG A;  5HW6 A;  4MSP A;  4JFK A;  1KFW A;  1ROT A;  4J4O A;  3ARZ A;  3O5P A;  5HWC A;  1FKG A;  1KT0 A;  4MGV A;  4ZPW R;  5HTG A;  4W9O A;  3FY1 A;  3GTY X;  4TW7 A;  1O6I A;  3TC5 A;  5HT1 A;  2EUL A;  2FKE A;  3WKZ A;  3WQW A;  2ZQV A;  2A3B A;  3CGN A;  1VF8 A;  4ML4 A;  1F8A B;  1NMW A;  3UF8 A;  4JFI A;  1WNO A;  3FXY A;  1FKJ A;  2LJ4 A;  1HKK A;  2DT1 A;  1FKH A;  4ITZ A;  4QZV B;  2PPN A;  4MAV A;  3WQV A;  2DSZ A;  4S3J A;  1ITX A;  1BL4 A;  2MF9 A;  3KAI A;  2F4E A;  3UI5 A;  1FAP A;  2L2S A;  1L1P A;  3BXW A;  3JXV A;  1JND A;  1F40 A;  4DWS A;  3CHC A;  1D2K A;  4U85 A;  5DO2 A;  4P8V A;  1E9L A;  1WB0 A;  3ARQ A;  1LG2 A;  3RFW A;  1LL7 A;  2ZQS A;  4TW8 A;  1HKM A;  4IT4 A;  3ARP A;  1RD6 A;  4L72 B;  3TCZ A;  1E6P A;  2Y78 A;  4ODN A;  2XP4 A;  1NH6 A;  1J4R A;  4LGX A;  1Q6I A;  4DRH A;  3CHF A;  3ART A;  3QOK A;  4WJX A;  3ARX A;  2PPO A;  5HUA A;  4DRP A;  2PV2 A;  1WAW A;  5BXJ A;  2DPE A;  1H0I A;  5DIU A;  2LGO A;  3KAF A;  2XPB A;  2ZQT A;  2ZR5 A;  3CHD A;  4DZ3 A;  3IKG A;  3W4R A;  1P5Q A;  2MLX A;  4IQ2 A;  4MNM A;  4L3N A;  4DWS D;  2PN0 A;  3JYJ A;  4URI A;  1KT1 A;  2ESC A;  2F23 A;  4MNK A;  2M08 A;  1E44 A;  3O5D A;  4ODO A;  4DRI A;  4DRQ A;  3GPK A;  1JNT A;  3UQB A;  4DH0 A;  1GOI A;  2XP5 A;  3TDB A;  4P8X A;  3PA7 A;  2A3C A;  3WH0 A;  2XP9 A;  4QT2 A;  5JH8 A;  4ODP A;  1FKD A;  4Q7N A;  4TW6 A;  2A3E A;  3ARR A;  1Q6H A;  1OGB A;  1D7I A;  3BMB A;  2O9O A;  2RUR A;  2XP6 A;  2DSV A;  3ARO A;  1JVW A;  2B5U B;  3AS3 A;  3RM8 A;  4UDM A;  4ODL A;  4IQC A;  4DRM A;  1QZ2 A;  3O5I A;  2F21 A;  1QPF A;  2ITK A;  2XP3 A;  4TYO A;  2IF4 A;  4XAK A;  2DG3 A;  3ARV A;  2XPA A;  1CTN A;  1FD9 A;  4DRN A;  3MDY B;  2OLH A;  5GPR A;  4LAY A;  1Q6U A;  3PRA A;  3IHZ A;  1YW5 A;  3O5Q A;  2RUD A;  2KE0 A;  4G50 A;  2YBU A;  2FDM A;  2PBC A;  2WLZ A;  3PR9 A;  3I6C A;  3O5J A;  1E6N A;  2A3A A;  1ZU8 A;  4R0X A;  5GQB A;  2DT2 A;  3AQU A;  4DRK A;  4ZPV R;  2WK2 A;  1JNS A;  3CHE A;  2RUQ A;  3AS1 A;  1A7X A;  1NSG A;  5DIT A;  2M2A A;  2ETN A;  2K8I A;  4LAW A;  3B9D A;  1FKI A;  3RM4 A;  1PBK A;  1U79 A;  1N1A A;  3CGM A;  2VCD A;  2LKN A;  4S3K A; 
#chains in the Genus database with same CATH homology
 4MNJ A;  3OOB A;  4NSB A;  4MNL A;  4QIB A;  2DG4 A;  1ZBK A;  3CZ8 A;  4GIV A;  3AS2 A;  4QT3 A;  1ZBV A;  5HBF A;  1SYT A;  1E6R A;  2ZR4 A;  1FKK A;  1ZCN A;  3ARY A;  4O2T A;  4LAV A;  4Z2J A;  1ZBW A;  3ARS A;  4PTM A;  4KQZ A;  3WD4 A;  1NWU A;  2D9F A;  2ZQU A;  4ZS6 A;  3IK8 A;  5D75 A;  2QF8 A;  2KR7 A;  3KAB A;  2G8Z A;  1QPL A;  3O5K A;  1ROU A;  1EQ3 A;  1TFV A;  4TNS A;  2DSW A;  3LUO A;  5J6E A;  1FKR A;  4JFM A;  1TCO C;  1UR9 A;  2JZV A;  3KAH A;  1ZK6 A;  4Q22 A;  1BKF A;  2DT0 A;  1HJW A;  4WIW A;  3KAC A;  1HKJ A;  1NWS A;  3WD2 A;  4W9P A;  1B6C A;  1K9T A;  1Y0O A;  4P8U A;  1NMV A;  3O5G A;  2WLY A;  2PV1 A;  4Z2I A;  4IPX A;  4KR0 B;  4R5E A;  3WIJ A;  4AY1 A;  2OFN A;  3O5O A;  1UR8 A;  2RUC A;  1J4I A;  4U84 A;  3OA5 A;  3WD3 A;  2MPH A;  3NTP A;  3KCE A;  4DZ2 A;  2F2D A;  1E6Z A;  1FFQ A;  1EIB A;  1E15 A;  4DRO A;  2XP7 A;  4G2P A;  3WD0 A;  2AWG A;  1EDQ A;  4TX0 A;  1FJD A;  4MPK A;  3O5F A;  1LQ0 A;  1FKS A;  4JFJ A;  5GPG A;  4P8W A;  3ODK A;  3KAD A;  4MTV A;  1W1T A;  4JYS A;  4GGQ A;  2O92 A;  3G6M A;  2RSE A;  1HKI A;  1W26 A;  4FAP A;  1LL6 A;  1W1P A;  1X6N A;  1W9V A;  4BF8 A;  1R9H A;  3WL0 A;  1J4H A;  1LJY A;  3ARU A;  3CH9 A;  3PRB A;  4WKA A;  4C02 B;  3B9A A;  3RME A;  1EYM A;  2WM0 A;  1ZBC A;  4ODR A;  1EHN A;  1FFR A;  4Z2G A;  2PV3 A;  1LG1 A;  4DWS B;  1LL4 A;  1NWT A;  1C9H A;  2Q5A A;  3JYM A;  1HJX A;  4FN2 A;  4JFL A;  4DIP A;  3G6L A;  1H0G A;  1D6O A;  4HBE A;  2VN1 A;  3NI6 A;  5B8I C;  4DRJ A;  1D7J A;  2PI6 A;  1Q1C A;  2KGJ A;  4U86 A;  4W5U A;  5HWB A;  3VAW A;  1IX5 A;  2XP8 A;  4WKF A;  3B7X A;  4WK9 A;  2AOS A;  2KO7 A;  1PIN A;  3AS0 A;  1FKL A;  3EY6 A;  1OGG A;  4ODQ A;  1W1Y A;  2UZ5 A;  3IKD A;  2MNT A;  5DIV A;  5HKG A;  2N87 A;  5DEZ A;  3KZ7 A;  1M5Y A;  1T11 A;  1W9P A;  4J4N A;  3B9E A;  4DWS C;  2DG9 A;  2DSU A;  3RM9 A;  4HAR A;  1FKB A;  1SR0 A;  5I98 A;  2ZR6 A;  1X6L A;  1W1V A;  4Z2K A;  2KI3 A;  2B31 A;  3O5E A;  3B8S A;  4W9Q A;  3UQI A;  2YBT A;  2G41 A;  5HW7 A;  5HW8 A;  2KFW A;  1XRV A;  4HBO A;  4NZC A;  2MLY A;  1FKT A;  3O5M A;  3FAP A;  1YAT A;  3RGC A;  1OWQ A;  3O5L A;  2FAP A;  3NRK A;  2LPV A;  4IT6 A;  3ALF A;  2PPP A;  4N19 A;  4WKH A;  1ZL1 A;  4Z2H A;  3WL1 A;  4DT4 A;  1HJV A;  3PRD A;  2IUZ A;  3KAG A;  1D7H A;  1W9U A;  3ARW A;  4ODK A;  1GPF A;  1XHG A;  5DF0 A;  3O5R A;  2M1I A;  3WD1 A;  4ZPT R;  1J6Y A;  4Z2L A;  4LAX A;  4NNR A;  1FKF A;  1GUV A;  2RQS A;  1NWR A;  4ODM A;  3UI4 A;  1ZB5 A;  3UQA A;  2MLZ A;  3UI6 A;  1HXV A;  1JNE A;  2DT3 A;  3H9R B;  3ALG A;  5HW6 A;  4MSP A;  4JFK A;  1KFW A;  1ROT A;  4J4O A;  3ARZ A;  3O5P A;  5HWC A;  1FKG A;  1KT0 A;  4MGV A;  4ZPW R;  5HTG A;  4W9O A;  3FY1 A;  4TW7 A;  1O6I A;  3TC5 A;  5HT1 A;  2FKE A;  3WKZ A;  3WQW A;  2ZQV A;  2A3B A;  3CGN A;  1VF8 A;  4ML4 A;  1F8A B;  1NMW A;  3UF8 A;  4JFI A;  1WNO A;  3FXY A;  1FKJ A;  2LJ4 A;  1HKK A;  2DT1 A;  1FKH A;  4ITZ A;  4QZV B;  2PPN A;  4MAV A;  3WQV A;  2DSZ A;  4S3J A;  1ITX A;  1BL4 A;  2MF9 A;  3KAI A;  2F4E A;  3UI5 A;  1FAP A;  2L2S A;  1L1P A;  3BXW A;  3JXV A;  1JND A;  1F40 A;  4DWS A;  3CHC A;  1D2K A;  4U85 A;  5DO2 A;  4P8V A;  1E9L A;  1WB0 A;  3ARQ A;  1LG2 A;  3RFW A;  1LL7 A;  2ZQS A;  4TW8 A;  1HKM A;  4IT4 A;  3ARP A;  1RD6 A;  4L72 B;  3TCZ A;  1E6P A;  2Y78 A;  4ODN A;  2XP4 A;  1NH6 A;  1J4R A;  4LGX A;  1Q6I A;  4DRH A;  3CHF A;  3ART A;  3QOK A;  4WJX A;  3ARX A;  2PPO A;  5HUA A;  4DRP A;  2PV2 A;  1WAW A;  5BXJ A;  2DPE A;  1H0I A;  5DIU A;  2LGO A;  3KAF A;  2XPB A;  2ZQT A;  2ZR5 A;  3CHD A;  4DZ3 A;  3IKG A;  3W4R A;  1P5Q A;  2MLX A;  4IQ2 A;  4MNM A;  4L3N A;  4DWS D;  3JYJ A;  4URI A;  1KT1 A;  2ESC A;  4MNK A;  2M08 A;  3O5D A;  4ODO A;  4DRI A;  4DRQ A;  3GPK A;  1JNT A;  3UQB A;  4DH0 A;  1GOI A;  2XP5 A;  3TDB A;  4P8X A;  3PA7 A;  2A3C A;  3WH0 A;  2XP9 A;  4QT2 A;  5JH8 A;  4ODP A;  1FKD A;  4Q7N A;  4TW6 A;  2A3E A;  3ARR A;  1Q6H A;  1OGB A;  1D7I A;  2O9O A;  2RUR A;  2XP6 A;  2DSV A;  3ARO A;  1JVW A;  3AS3 A;  3RM8 A;  4ODL A;  4IQC A;  4DRM A;  1QZ2 A;  3O5I A;  2F21 A;  1QPF A;  2ITK A;  2XP3 A;  4TYO A;  2IF4 A;  4XAK A;  2DG3 A;  3ARV A;  2XPA A;  1CTN A;  1FD9 A;  4DRN A;  3MDY B;  2OLH A;  5GPR A;  4LAY A;  1Q6U A;  3PRA A;  3IHZ A;  1YW5 A;  3O5Q A;  2RUD A;  2KE0 A;  4G50 A;  2YBU A;  2FDM A;  2PBC A;  2WLZ A;  3PR9 A;  3I6C A;  3O5J A;  1E6N A;  2A3A A;  1ZU8 A;  4R0X A;  5GQB A;  2DT2 A;  3AQU A;  4DRK A;  4ZPV R;  2WK2 A;  1JNS A;  3CHE A;  2RUQ A;  3AS1 A;  1A7X A;  1NSG A;  5DIT A;  2M2A A;  2K8I A;  4LAW A;  3B9D A;  1FKI A;  3RM4 A;  1PBK A;  1U79 A;  1N1A A;  3CGM A;  2VCD A;  2LKN A;  4S3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...