5HWBA

Aspergillus fumigatus fkbp12 apo protein in p212121 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwbA00
1BL4A 1NSGA 5HT1A 5HWCA 5HW7A 1J4IA 5HWBA 2MLXA 1FKHA 2N87A 2PPPA 1C9HA 4IQCA 4LAYA 2F4EA 4U86A 2LJ4A 4ODPA 2PBCA 3UI6A 1FAPA 3EY6A 2MNTA 2XP6A 1D7HA 4JFIA 2AWGA 4TNSA 2KE0A 2DG3A 5DIVA 1N1AA 3CGNA 3KABA 3TCZA 3WH0A 1BKFA 2KGJA 4BF8A 1P5QA 4W9OA 5B8IC 2RSEA 2ZQVA 1B6CA 4JFLA 4NNRA 1JVWA 4MGVA 3O5MA 4TW6A 5HW8A 4LAWA 3O5EA 3O5LA 3O5PA 2RURA 4TYOA 3CGMA 2VCDA 3PA7A 4DRHA 4JFMA 3NRKA 2PV1A 2XP3A 1L1PA 1KT1A 2Q5AA 4TW7A 1FKJA 3ODKA 1T11A 4QT2A 2XP8A 2ZR5A 5DIUA 1FKGA 1Q6HA 3JYJA 5HTGA 2K8IA 4U84A 4W9PA 5I98A 1YATA 4TW8A 3O5OA 1PBKA 3UQIA 1FD9A 4J4NA 2KI3A 1Q1CA 5BXJA 2RQSA 2MF9A 1ZK6A 4DZ2A 2F2DA 2MPHA 1NMVA 4J4OA 4O2TA 1ROUA 1D7JA 3KAIA 4C02B 3PRBA 1D6OA 3H9RB 3O5FA 2D9FA 1R9HA 4DRKA 1ROTA 1EYMA 3IKDA 3O5RA 5HW6A 5J6EA 1M5YA 3IKGA 2M1IA 2ITKA 1Q6IA 4TX0A 1U79A 2PV2A 2RUDA 2ZR4A 2FAPA 2L2SA 4GGQA 2XPAA 2LGOA 1F8AB 3GPKA 3O5JA 1Q6UA 2XP4A 2KO7A 4LAXA 2PPOA 2ZQSA 5HUAA 3RGCA 2IF4A 3PRDA 4MSPA 3TDBA 3KZ7A 1ZCNA 4ODOA 3O5KA 4ODQA 3TC5A 2M08A 3IHZA 2MLYA 2Y78A 4DIPA 1EQ3A 1FKSA 1PINA 2UZ5A 4DRQA 3IK8A 3OOBA 1W26A 4U85A 5HKGA 1HXVA 5DITA 4JFKA 4QIBA 3UI4A 1D7IA 2FKEA 1A7XA 4DRJA 2KFWA 4ODMA 1FJDA 2ZQUA 2PV3A 4DRMA 1KT0A 3I6CA 3RFWA 1J6YA 4ITZA 3NTPA 1FKLA 2MLZA 4QT3A 1FKDA 4N19A 2ZQTA 2LKNA 3FAPA 1JNTA 2LPVA 3KAGA 1YW5A 2F21A 4JFJA 4G50A 1J4HA 1NMWA 2XPBA 3KAFA 3O5IA 4FN2A 4LAVA 3UF8A 1FKTA 3B7XA 3KADA 4ODLA 4DRNA 4DROA 2ZR6A 2RUQA 2DG4A 4W9QA 3UI5A 3VAWA 3UQAA 1FKFA 4DH0A 1FKIA 1J4RA 2XP9A 1FKBA 1F40A 2XP5A 1QZ2A 3KCEA 2PPNA 3O5DA 1Y0OA 4ODKA 5GPGA 3JYMA 3JXVA 4JYSA 4IPXA 4DRIA 4DT4A 3UQBA 1JNSA 2M2AA 3O5QA 4G2PA 4R0XA 3O5GA 3NI6A 2OFNA 4FAPA 1TCOC 2RUCA 4ODRA 2JZVA 1QPFA 3KAHA 4DRPA 5D75A 2KR7A 1FKRA 2VN1A 3LUOA 4GIVA 3MDYB 4IQ2A 3KACA 4ODNA 1QPLA 4DZ3A 1FKKA 2XP7A 2DG9A
chains in the Genus database with same CATH superfamily
1BL4A 5HWCA 5HWBA 4ZPWR 4U86A 2DT2A 4ODPA 2DPEA 2MNTA 1D7HA 4DRNA 3TCZA 5B8IC 1BKFA 1FFRA 1ZB5A 2ZQVA 1UR8A 4DWSC 4MGVA 1JNEA 3ARRA 3O5LA 4PTMA 1HJXA 3O5PA 3CGMA 2VCDA 4L3NA 4WJXA 2OLHA 2XP3A 4DWSB 1FKJA 3CHEA 1FKGA 3AROA 3JYJA 5GPRA 5I98A 3WD4A 4TW8A 3O5OA 3UQIA 1K9TA 2KI3A 4J4NA 3WQWA 2MF9A 2DSWA 3ALGA 3WL0A 1ROUA 1D7JA 5DF0A 4C02B 3PRBA 4R5EA 1SR0A 1D6OA 3O5FA 2D9FA 1R9HA 1ROTA 3O5RA 2DT3A 4NZCA 3ARYA 2ITKA 1IX5A 1U79A 2RUDA 2L2SA 2IUZA 1F8AB 2WM0A 3W4RA 3KZ7A 4ODOA 3O5KA 3WIJA 2MLYA 4DIPA 1EQ3A 3AS0A 1EHNA 2UZ5A 3IK8A 3WD0A 5HKGA 5DITA 1VF8A 4DRMA 1KT0A 1TFVA 2FDMA 2ZQTA 1JNTA 4HBOA 4P8WA 3FY1A 2XPBA 4G50A 1XRVA 3UF8A 4ODLA 1GOIA 4UDMA 1NWUA 1ZBCA 4MNLA 3UI5A 3VAWA 3UQAA 1FFQA 4IT6A 1F40A 3ARZA 2PPNA 4IPXA 4DT4A 3UQBA 4ML4A 1H0IA 4R0XA 4ODRA 4NSBA 5D75A 3WL1A 1HKMA 2VN1A 1WB0A 4DZ3A 1X6NA 4TW6A 5HT1A 5HW7A 1J4IA 1ZBVA 1E15A 2MLXA 2N87A 3ARXA 3ALFA 4LAYA 1NWTA 2LJ4A 3OA5A 1FAPA 2B5UB 4TNSA 4Z2HA 2KGJA 4BF8A 4W9OA 2PI6A 2A3CA 5GQBA 1GRJA 1ZU8A 1JCHB 4WKFA 4TYOA 1GPFA 1OGGA 4DRHA 3WD1A 1E9LA 2PV1A 1T11A 5DIUA 2EULA 2K8IA 4U84A 4URIA 3WQVA 3G6MA 4QZVB 3CHCA 4Q22A 1UR9A 5BXJA 2RQSA 4DZ2A 4XAKA 2A3AA 5HW6A 3IKDA 3IKGA 4TX0A 1HKJA 2G8ZA 2ZR4A 4P8VA 4GGQA 2XPAA 3GPKA 4LAXA 5HUAA 2XP4A 2KO7A 2ZQSA 3PRDA 3ARUA 1ZCNA 4WIWA 2M08A 1EDQA 1PINA 4DRQA 2A3BA 4MTVA 4DRJA 2FKEA 1A7XA 1KFWA 4ODMA 1FJDA 3WD2A 1LL7A 3RFWA 1D2KA 4ITZA 3NTPA 1W9VA 1E6PA 2LKNA 2LPVA 2ESCA 4KR0B 1CTNA 1J4HA 3O5IA 4IT4A 1FKTA 3B7XA 4DROA 2ZR6A 1LG2A 1NH6A 4WKAA 4DH0A 3ARSA 1J4RA 5JH8A 2YBUA 1ITXA 4ODKA 3AQUA 3PR9A 4MNMA 4DRIA 3B9DA 3O5QA 3CH9A 4G2PA 3O5GA 3NI6A 4FAPA 1TCOC 2RUCA 1OGBA 1QPFA 1LL6A 1NWRA 3KAHA 5DO2A 3LUOA 4WKHA 4LGXA 3RM4A 3MDYB 4IQ2A 3RM9A 1HKKA 1HKIA 4KQZA 2F4EA 2PBCA 2DSUA 2AWGA 5DIVA 2DG3A 3KABA 1P5QA 3CHDA 2RSEA 3ARQA 1LJYA 4NNRA 1JVWA 4P8UA 3O5MA 1WAWA 5HW8A 4LAWA 3O5EA 2F23A 1E6NA 3PA7A 4JFMA 1XHGA 3NRKA 4Z2JA 1L1PA 1ZBWA 1KT1A 2Q5AA 4TW7A 3ODKA 2O92A 4QT2A 1W1TA 1Q6HA 4S3KA 4W9PA 1W9PA 1YATA 1FD9A 3ARVA 4Z2IA 3AS1A 1W1VA 3ARWA 1LQ0A 3H9RB 3RMEA 2WK2A 1EYMA 5J6EA 1OWQA 1Q6IA 2FAPA 3O5JA 2PPOA 4MNJA 3RGCA 4ODQA 1X6LA 4HBEA 4Z2KA 3CZ8A 3PRAA 1HXVA 4JFKA 4QIBA 1D7IA 5DEZA 2KFWA 4ZPVR 2PV3A 3I6CA 4QT3A 1FKDA 3WD3A 3FAPA 1O6IA 3KAFA 2WLYA 4LAVA 1E6RA 3KADA 2RUQA 2DG4A 1FKFA 1FKIA 1FKBA 3KCEA 1QZ2A 1Y0OA 5GPGA 3RM8A 4JYSA 1E44A 1E6ZA 2DT1A 1JNSA 2WLZA 4MPKA 4MAVA 2JZVA 4DRPA 3GTYX 1FKRA 3AS2A 4ZPTR 4ODNA 4P8XA 2DT0A 3B8SA 3KACA 1GUVA 2XP7A 2DG9A 1NSGA 1FKHA 2P4VA 2PPPA 1C9HA 4IQCA 2PN0A 3UI6A 3EY6A 2XP6A 1HJVA 4JFIA 3WH0A 2KE0A 3GU0A 1LG1A 1N1AA 3CGNA 1H0GA 1B6CA 4JFLA 4S3JA 2RURA 1WNOA 4ZS6A 5HBFA 2DSVA 2XP8A 2ZR5A 3G6LA 4Z2LA 3BXWA 1PBKA 3ARTA 1Q1CA 1SYTA 1ZK6A 2F2DA 2MPHA 1NMVA 4J4OA 4O2TA 1ZBKA 2DSZA 3KAIA 3CHFA 1W1PA 4DRKA 3B9AA 4AY1A 1M5YA 2M1IA 4MNKA 2PV2A 5HTGA 2LGOA 1Q6UA 2B31A 1JNDA 2IF4A 4MSPA 3TDBA 4L72B 3TC5A 3IHZA 1NWSA 2Y78A 2QF8A 1FKSA 2ETNA 3B9EA 2AOSA 3OOBA 1W26A 1HJWA 4U85A 1LL4A 4Q7NA 3UI4A 3WKZA 4W5UA 1ZL1A 2ZQUA 1W1YA 1J6YA 3QOKA 4Z2GA 1FKLA 2MLZA 4N19A 3EIPA 3AS3A 3KAGA 1YW5A 2F21A 4JFJA 1NMWA 4FN2A 1RD6A 1EIBA 3BMBA 4W9QA 2A3EA 2XP9A 3ARPA 2XP5A 3O5DA 3JYMA 3JXVA 2G41A 3FXYA 1W9UA 2YBTA 2M2AA 4DWSD 2OFNA 2O9OA 4WK9A 2KR7A 4DWSA 4GIVA 4HARA 1QPLA 1FKKA
chains in the Genus database with same CATH topology
1BL4A 5HWCA 5HWBA 4ZPWR 4U86A 2DT2A 4ODPA 2DPEA 2MNTA 1D7HA 4DRNA 3TCZA 5B8IC 1BKFA 1FFRA 1ZB5A 2ZQVA 1UR8A 4DWSC 4MGVA 1JNEA 3ARRA 3O5LA 4PTMA 1HJXA 3O5PA 3CGMA 2VCDA 4L3NA 4WJXA 2OLHA 2XP3A 4DWSB 1FKJA 3CHEA 1FKGA 3AROA 3JYJA 5GPRA 5I98A 3WD4A 4TW8A 3O5OA 3UQIA 1K9TA 2KI3A 4J4NA 3WQWA 2MF9A 2DSWA 3ALGA 3WL0A 1ROUA 1D7JA 5DF0A 4C02B 3PRBA 4R5EA 1SR0A 1D6OA 3O5FA 2D9FA 1R9HA 1ROTA 3O5RA 2DT3A 4NZCA 3ARYA 2ITKA 1IX5A 1U79A 2RUDA 2L2SA 2IUZA 1F8AB 2WM0A 3W4RA 3KZ7A 4ODOA 3O5KA 3WIJA 2MLYA 4DIPA 1EQ3A 3AS0A 1EHNA 2UZ5A 3IK8A 3WD0A 5HKGA 5DITA 1VF8A 4DRMA 1KT0A 1TFVA 2FDMA 2ZQTA 1JNTA 4HBOA 4P8WA 3FY1A 2XPBA 4G50A 1XRVA 3UF8A 4ODLA 1GOIA 1NWUA 1ZBCA 4MNLA 3UI5A 3VAWA 3UQAA 1FFQA 4IT6A 1F40A 3ARZA 2PPNA 4IPXA 4DT4A 3UQBA 4ML4A 1H0IA 4R0XA 4ODRA 4NSBA 5D75A 3WL1A 1HKMA 2VN1A 1WB0A 4DZ3A 1X6NA 4TW6A 5HT1A 5HW7A 1J4IA 1ZBVA 1E15A 2MLXA 2N87A 3ARXA 3ALFA 4LAYA 1NWTA 2LJ4A 3OA5A 1FAPA 4TNSA 4Z2HA 2KGJA 4BF8A 4W9OA 2PI6A 2A3CA 5GQBA 1ZU8A 4WKFA 4TYOA 1GPFA 1OGGA 4DRHA 3WD1A 1E9LA 2PV1A 1T11A 5DIUA 2K8IA 4U84A 4URIA 3WQVA 3G6MA 4QZVB 3CHCA 4Q22A 1UR9A 5BXJA 2RQSA 4DZ2A 4XAKA 2A3AA 5HW6A 3IKDA 3IKGA 4TX0A 1HKJA 2G8ZA 2ZR4A 4P8VA 4GGQA 2XPAA 3GPKA 4LAXA 5HUAA 2XP4A 2KO7A 2ZQSA 3PRDA 3ARUA 1ZCNA 4WIWA 2M08A 1EDQA 1PINA 4DRQA 2A3BA 4MTVA 4DRJA 2FKEA 1A7XA 1KFWA 4ODMA 1FJDA 3WD2A 1LL7A 3RFWA 1D2KA 4ITZA 3NTPA 1W9VA 1E6PA 2LKNA 2LPVA 2ESCA 4KR0B 1CTNA 1J4HA 3O5IA 4IT4A 1FKTA 3B7XA 4DROA 2ZR6A 1LG2A 1NH6A 4WKAA 4DH0A 3ARSA 1J4RA 5JH8A 2YBUA 1ITXA 4ODKA 3AQUA 3PR9A 4MNMA 4DRIA 3B9DA 3O5QA 3CH9A 4G2PA 3O5GA 3NI6A 4FAPA 1TCOC 2RUCA 1OGBA 1QPFA 1LL6A 1NWRA 3KAHA 5DO2A 3LUOA 4WKHA 4LGXA 3RM4A 3MDYB 4IQ2A 3RM9A 1HKKA 1HKIA 4KQZA 2F4EA 2PBCA 2DSUA 2AWGA 5DIVA 2DG3A 3KABA 1P5QA 3CHDA 2RSEA 3ARQA 1LJYA 4NNRA 1JVWA 4P8UA 3O5MA 1WAWA 5HW8A 4LAWA 3O5EA 1E6NA 3PA7A 4JFMA 1XHGA 3NRKA 4Z2JA 1L1PA 1ZBWA 1KT1A 2Q5AA 4TW7A 3ODKA 2O92A 4QT2A 1W1TA 1Q6HA 4S3KA 4W9PA 1W9PA 1YATA 1FD9A 3ARVA 4Z2IA 3AS1A 1W1VA 3ARWA 1LQ0A 3H9RB 3RMEA 2WK2A 1EYMA 5J6EA 1OWQA 1Q6IA 2FAPA 3O5JA 2PPOA 4MNJA 3RGCA 4ODQA 1X6LA 4HBEA 4Z2KA 3CZ8A 3PRAA 1HXVA 4JFKA 4QIBA 1D7IA 5DEZA 2KFWA 4ZPVR 2PV3A 3I6CA 4QT3A 1FKDA 3WD3A 3FAPA 1O6IA 3KAFA 2WLYA 4LAVA 1E6RA 3KADA 2RUQA 2DG4A 1FKFA 1FKIA 1FKBA 3KCEA 1QZ2A 1Y0OA 5GPGA 3RM8A 4JYSA 1E6ZA 2DT1A 1JNSA 2WLZA 4MPKA 4MAVA 2JZVA 4DRPA 1FKRA 3AS2A 4ZPTR 4ODNA 4P8XA 2DT0A 3B8SA 3KACA 1GUVA 2XP7A 2DG9A 1NSGA 1FKHA 2PPPA 1C9HA 4IQCA 3UI6A 3EY6A 1HJVA 2XP6A 4JFIA 3WH0A 2KE0A 1LG1A 1N1AA 3CGNA 1H0GA 1B6CA 4JFLA 4S3JA 2RURA 1WNOA 4ZS6A 5HBFA 2DSVA 2XP8A 2ZR5A 3G6LA 4Z2LA 3BXWA 1PBKA 3ARTA 1Q1CA 1SYTA 1ZK6A 2F2DA 2MPHA 1NMVA 4J4OA 4O2TA 1ZBKA 2DSZA 3KAIA 3CHFA 1W1PA 4DRKA 3B9AA 4AY1A 1M5YA 2M1IA 4MNKA 2PV2A 5HTGA 2LGOA 1Q6UA 2B31A 1JNDA 2IF4A 4MSPA 3TDBA 4L72B 3TC5A 3IHZA 1NWSA 2Y78A 2QF8A 1FKSA 3B9EA 2AOSA 3OOBA 1W26A 1HJWA 4U85A 1LL4A 4Q7NA 3UI4A 3WKZA 4W5UA 1ZL1A 2ZQUA 1W1YA 1J6YA 3QOKA 4Z2GA 1FKLA 2MLZA 4N19A 3AS3A 3KAGA 1YW5A 2F21A 4JFJA 1NMWA 4FN2A 1RD6A 1EIBA 4W9QA 2A3EA 2XP9A 3ARPA 2XP5A 3O5DA 3JYMA 3JXVA 2G41A 3FXYA 1W9UA 2YBTA 2M2AA 4DWSD 2OFNA 2O9OA 4WK9A 2KR7A 4DWSA 4GIVA 4HARA 1QPLA 1FKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  1NSG A;  5HT1 A;  5HWC A;  5HW7 A;  1J4I A;  5HWB A;  2MLX A;  1FKH A;  2N87 A;  2PPP A;  1C9H A;  4IQC A;  4LAY A;  2F4E A;  4U86 A;  2LJ4 A;  4ODP A;  2PBC A;  3UI6 A;  1FAP A;  3EY6 A;  2MNT A;  2XP6 A;  1D7H A;  4JFI A;  2AWG A;  4TNS A;  2KE0 A;  2DG3 A;  5DIV A;  1N1A A;  3CGN A;  3KAB A;  3TCZ A;  3WH0 A;  1BKF A;  2KGJ A;  4BF8 A;  1P5Q A;  4W9O A;  5B8I C;  2RSE A;  2ZQV A;  1B6C A;  4JFL A;  4NNR A;  1JVW A;  4MGV A;  3O5M A;  4TW6 A;  5HW8 A;  4LAW A;  3O5E A;  3O5L A;  3O5P A;  2RUR A;  4TYO A;  3CGM A;  2VCD A;  3PA7 A;  4DRH A;  4JFM A;  3NRK A;  2PV1 A;  2XP3 A;  1L1P A;  1KT1 A;  2Q5A A;  4TW7 A;  1FKJ A;  3ODK A;  1T11 A;  4QT2 A;  2XP8 A;  2ZR5 A;  5DIU A;  1FKG A;  1Q6H A;  3JYJ A;  5HTG A;  2K8I A;  4U84 A;  4W9P A;  5I98 A;  1YAT A;  4TW8 A;  3O5O A;  1PBK A;  3UQI A;  1FD9 A;  4J4N A;  2KI3 A;  1Q1C A;  5BXJ A;  2RQS A;  2MF9 A;  1ZK6 A;  4DZ2 A;  2F2D A;  2MPH A;  1NMV A;  4J4O A;  4O2T A;  1ROU A;  1D7J A;  3KAI A;  4C02 B;  3PRB A;  1D6O A;  3H9R B;  3O5F A;  2D9F A;  1R9H A;  4DRK A;  1ROT A;  1EYM A;  3IKD A;  3O5R A;  5HW6 A;  5J6E A;  1M5Y A;  3IKG A;  2M1I A;  2ITK A;  1Q6I A;  4TX0 A;  1U79 A;  2PV2 A;  2RUD A;  2ZR4 A;  2FAP A;  2L2S A;  4GGQ A;  2XPA A;  2LGO A;  1F8A B;  3GPK A;  3O5J A;  1Q6U A;  2XP4 A;  2KO7 A;  4LAX A;  2PPO A;  2ZQS A;  5HUA A;  3RGC A;  2IF4 A;  3PRD A;  4MSP A;  3TDB A;  3KZ7 A;  1ZCN A;  4ODO A;  3O5K A;  4ODQ A;  3TC5 A;  2M08 A;  3IHZ A;  2MLY A;  2Y78 A;  4DIP A;  1EQ3 A;  1FKS A;  1PIN A;  2UZ5 A;  4DRQ A;  3IK8 A;  3OOB A;  1W26 A;  4U85 A;  5HKG A;  1HXV A;  5DIT A;  4JFK A;  4QIB A;  3UI4 A;  1D7I A;  2FKE A;  1A7X A;  4DRJ A;  2KFW A;  4ODM A;  1FJD A;  2ZQU A;  2PV3 A;  4DRM A;  1KT0 A;  3I6C A;  3RFW A;  1J6Y A;  4ITZ A;  3NTP A;  1FKL A;  2MLZ A;  4QT3 A;  1FKD A;  4N19 A;  2ZQT A;  2LKN A;  3FAP A;  1JNT A;  2LPV A;  3KAG A;  1YW5 A;  2F21 A;  4JFJ A;  4G50 A;  1J4H A;  1NMW A;  2XPB A;  3KAF A;  3O5I A;  4FN2 A;  4LAV A;  3UF8 A;  1FKT A;  3B7X A;  3KAD A;  4ODL A;  4DRN A;  4DRO A;  2ZR6 A;  2RUQ A;  2DG4 A;  4W9Q A;  3UI5 A;  3VAW A;  3UQA A;  1FKF A;  4DH0 A;  1FKI A;  1J4R A;  2XP9 A;  1FKB A;  1F40 A;  2XP5 A;  1QZ2 A;  3KCE A;  2PPN A;  3O5D A;  1Y0O A;  4ODK A;  5GPG A;  3JYM A;  3JXV A;  4JYS A;  4IPX A;  4DRI A;  4DT4 A;  3UQB A;  1JNS A;  2M2A A;  3O5Q A;  4G2P A;  4R0X A;  3O5G A;  3NI6 A;  2OFN A;  4FAP A;  1TCO C;  2RUC A;  4ODR A;  2JZV A;  1QPF A;  3KAH A;  4DRP A;  5D75 A;  2KR7 A;  1FKR A;  2VN1 A;  3LUO A;  4GIV A;  3MDY B;  4IQ2 A;  3KAC A;  4ODN A;  1QPL A;  4DZ3 A;  1FKK A;  2XP7 A;  2DG9 A; 
#chains in the Genus database with same CATH topology
 1BL4 A;  5HWC A;  5HWB A;  4ZPW R;  4U86 A;  2DT2 A;  4ODP A;  2DPE A;  2MNT A;  1D7H A;  4DRN A;  3TCZ A;  5B8I C;  1BKF A;  1FFR A;  1ZB5 A;  2ZQV A;  1UR8 A;  4DWS C;  4MGV A;  1JNE A;  3ARR A;  3O5L A;  4PTM A;  1HJX A;  3O5P A;  3CGM A;  2VCD A;  4L3N A;  4WJX A;  2OLH A;  2XP3 A;  4DWS B;  1FKJ A;  3CHE A;  1FKG A;  3ARO A;  3JYJ A;  5GPR A;  5I98 A;  3WD4 A;  4TW8 A;  3O5O A;  3UQI A;  1K9T A;  2KI3 A;  4J4N A;  3WQW A;  2MF9 A;  2DSW A;  3ALG A;  3WL0 A;  1ROU A;  1D7J A;  5DF0 A;  4C02 B;  3PRB A;  4R5E A;  1SR0 A;  1D6O A;  3O5F A;  2D9F A;  1R9H A;  1ROT A;  3O5R A;  2DT3 A;  4NZC A;  3ARY A;  2ITK A;  1IX5 A;  1U79 A;  2RUD A;  2L2S A;  2IUZ A;  1F8A B;  2WM0 A;  3W4R A;  3KZ7 A;  4ODO A;  3O5K A;  3WIJ A;  2MLY A;  4DIP A;  1EQ3 A;  3AS0 A;  1EHN A;  2UZ5 A;  3IK8 A;  3WD0 A;  5HKG A;  5DIT A;  1VF8 A;  4DRM A;  1KT0 A;  1TFV A;  2FDM A;  2ZQT A;  1JNT A;  4HBO A;  4P8W A;  3FY1 A;  2XPB A;  4G50 A;  1XRV A;  3UF8 A;  4ODL A;  1GOI A;  4UDM A;  1NWU A;  1ZBC A;  4MNL A;  3UI5 A;  3VAW A;  3UQA A;  1FFQ A;  4IT6 A;  1F40 A;  3ARZ A;  2PPN A;  4IPX A;  4DT4 A;  3UQB A;  4ML4 A;  1H0I A;  4R0X A;  4ODR A;  4NSB A;  5D75 A;  3WL1 A;  1HKM A;  2VN1 A;  1WB0 A;  4DZ3 A;  1X6N A;  4TW6 A;  5HT1 A;  5HW7 A;  1J4I A;  1ZBV A;  1E15 A;  2MLX A;  2N87 A;  3ARX A;  3ALF A;  4LAY A;  1NWT A;  2LJ4 A;  3OA5 A;  1FAP A;  2B5U B;  4TNS A;  4Z2H A;  2KGJ A;  4BF8 A;  4W9O A;  2PI6 A;  2A3C A;  5GQB A;  1GRJ A;  1ZU8 A;  1JCH B;  4WKF A;  4TYO A;  1GPF A;  1OGG A;  4DRH A;  3WD1 A;  1E9L A;  2PV1 A;  1T11 A;  5DIU A;  2EUL A;  2K8I A;  4U84 A;  4URI A;  3WQV A;  3G6M A;  4QZV B;  3CHC A;  4Q22 A;  1UR9 A;  5BXJ A;  2RQS A;  4DZ2 A;  4XAK A;  2A3A A;  5HW6 A;  3IKD A;  3IKG A;  4TX0 A;  1HKJ A;  2G8Z A;  2ZR4 A;  4P8V A;  4GGQ A;  2XPA A;  3GPK A;  4LAX A;  5HUA A;  2XP4 A;  2KO7 A;  2ZQS A;  3PRD A;  3ARU A;  1ZCN A;  4WIW A;  2M08 A;  1EDQ A;  1PIN A;  4DRQ A;  2A3B A;  4MTV A;  4DRJ A;  2FKE A;  1A7X A;  1KFW A;  4ODM A;  1FJD A;  3WD2 A;  1LL7 A;  3RFW A;  1D2K A;  4ITZ A;  3NTP A;  1W9V A;  1E6P A;  2LKN A;  2LPV A;  2ESC A;  4KR0 B;  1CTN A;  1J4H A;  3O5I A;  4IT4 A;  1FKT A;  3B7X A;  4DRO A;  2ZR6 A;  1LG2 A;  1NH6 A;  4WKA A;  4DH0 A;  3ARS A;  1J4R A;  5JH8 A;  2YBU A;  1ITX A;  4ODK A;  3AQU A;  3PR9 A;  4MNM A;  4DRI A;  3B9D A;  3O5Q A;  3CH9 A;  4G2P A;  3O5G A;  3NI6 A;  4FAP A;  1TCO C;  2RUC A;  1OGB A;  1QPF A;  1LL6 A;  1NWR A;  3KAH A;  5DO2 A;  3LUO A;  4WKH A;  4LGX A;  3RM4 A;  3MDY B;  4IQ2 A;  3RM9 A;  1HKK A;  1HKI A;  4KQZ A;  2F4E A;  2PBC A;  2DSU A;  2AWG A;  5DIV A;  2DG3 A;  3KAB A;  1P5Q A;  3CHD A;  2RSE A;  3ARQ A;  1LJY A;  4NNR A;  1JVW A;  4P8U A;  3O5M A;  1WAW A;  5HW8 A;  4LAW A;  3O5E A;  2F23 A;  1E6N A;  3PA7 A;  4JFM A;  1XHG A;  3NRK A;  4Z2J A;  1L1P A;  1ZBW A;  1KT1 A;  2Q5A A;  4TW7 A;  3ODK A;  2O92 A;  4QT2 A;  1W1T A;  1Q6H A;  4S3K A;  4W9P A;  1W9P A;  1YAT A;  1FD9 A;  3ARV A;  4Z2I A;  3AS1 A;  1W1V A;  3ARW A;  1LQ0 A;  3H9R B;  3RME A;  2WK2 A;  1EYM A;  5J6E A;  1OWQ A;  1Q6I A;  2FAP A;  3O5J A;  2PPO A;  4MNJ A;  3RGC A;  4ODQ A;  1X6L A;  4HBE A;  4Z2K A;  3CZ8 A;  3PRA A;  1HXV A;  4JFK A;  4QIB A;  1D7I A;  5DEZ A;  2KFW A;  4ZPV R;  2PV3 A;  3I6C A;  4QT3 A;  1FKD A;  3WD3 A;  3FAP A;  1O6I A;  3KAF A;  2WLY A;  4LAV A;  1E6R A;  3KAD A;  2RUQ A;  2DG4 A;  1FKF A;  1FKI A;  1FKB A;  3KCE A;  1QZ2 A;  1Y0O A;  5GPG A;  3RM8 A;  4JYS A;  1E44 A;  1E6Z A;  2DT1 A;  1JNS A;  2WLZ A;  4MPK A;  4MAV A;  2JZV A;  4DRP A;  3GTY X;  1FKR A;  3AS2 A;  4ZPT R;  4ODN A;  4P8X A;  2DT0 A;  3B8S A;  3KAC A;  1GUV A;  2XP7 A;  2DG9 A;  1NSG A;  1FKH A;  2P4V A;  2PPP A;  1C9H A;  4IQC A;  2PN0 A;  3UI6 A;  3EY6 A;  2XP6 A;  1HJV A;  4JFI A;  3WH0 A;  2KE0 A;  3GU0 A;  1LG1 A;  1N1A A;  3CGN A;  1H0G A;  1B6C A;  4JFL A;  4S3J A;  2RUR A;  1WNO A;  4ZS6 A;  5HBF A;  2DSV A;  2XP8 A;  2ZR5 A;  3G6L A;  4Z2L A;  3BXW A;  1PBK A;  3ART A;  1Q1C A;  1SYT A;  1ZK6 A;  2F2D A;  2MPH A;  1NMV A;  4J4O A;  4O2T A;  1ZBK A;  2DSZ A;  3KAI A;  3CHF A;  1W1P A;  4DRK A;  3B9A A;  4AY1 A;  1M5Y A;  2M1I A;  4MNK A;  2PV2 A;  5HTG A;  2LGO A;  1Q6U A;  2B31 A;  1JND A;  2IF4 A;  4MSP A;  3TDB A;  4L72 B;  3TC5 A;  3IHZ A;  1NWS A;  2Y78 A;  2QF8 A;  1FKS A;  2ETN A;  3B9E A;  2AOS A;  3OOB A;  1W26 A;  1HJW A;  4U85 A;  1LL4 A;  4Q7N A;  3UI4 A;  3WKZ A;  4W5U A;  1ZL1 A;  2ZQU A;  1W1Y A;  1J6Y A;  3QOK A;  4Z2G A;  1FKL A;  2MLZ A;  4N19 A;  3EIP A;  3AS3 A;  3KAG A;  1YW5 A;  2F21 A;  4JFJ A;  1NMW A;  4FN2 A;  1RD6 A;  1EIB A;  3BMB A;  4W9Q A;  2A3E A;  2XP9 A;  3ARP A;  2XP5 A;  3O5D A;  3JYM A;  3JXV A;  2G41 A;  3FXY A;  1W9U A;  2YBT A;  2M2A A;  4DWS D;  2OFN A;  2O9O A;  4WK9 A;  2KR7 A;  4DWS A;  4GIV A;  4HAR A;  1QPL A;  1FKK A; 
#chains in the Genus database with same CATH homology
 1BL4 A;  5HWC A;  5HWB A;  4ZPW R;  4U86 A;  2DT2 A;  4ODP A;  2DPE A;  2MNT A;  1D7H A;  4DRN A;  3TCZ A;  5B8I C;  1BKF A;  1FFR A;  1ZB5 A;  2ZQV A;  1UR8 A;  4DWS C;  4MGV A;  1JNE A;  3ARR A;  3O5L A;  4PTM A;  1HJX A;  3O5P A;  3CGM A;  2VCD A;  4L3N A;  4WJX A;  2OLH A;  2XP3 A;  4DWS B;  1FKJ A;  3CHE A;  1FKG A;  3ARO A;  3JYJ A;  5GPR A;  5I98 A;  3WD4 A;  4TW8 A;  3O5O A;  3UQI A;  1K9T A;  2KI3 A;  4J4N A;  3WQW A;  2MF9 A;  2DSW A;  3ALG A;  3WL0 A;  1ROU A;  1D7J A;  5DF0 A;  4C02 B;  3PRB A;  4R5E A;  1SR0 A;  1D6O A;  3O5F A;  2D9F A;  1R9H A;  1ROT A;  3O5R A;  2DT3 A;  4NZC A;  3ARY A;  2ITK A;  1IX5 A;  1U79 A;  2RUD A;  2L2S A;  2IUZ A;  1F8A B;  2WM0 A;  3W4R A;  3KZ7 A;  4ODO A;  3O5K A;  3WIJ A;  2MLY A;  4DIP A;  1EQ3 A;  3AS0 A;  1EHN A;  2UZ5 A;  3IK8 A;  3WD0 A;  5HKG A;  5DIT A;  1VF8 A;  4DRM A;  1KT0 A;  1TFV A;  2FDM A;  2ZQT A;  1JNT A;  4HBO A;  4P8W A;  3FY1 A;  2XPB A;  4G50 A;  1XRV A;  3UF8 A;  4ODL A;  1GOI A;  1NWU A;  1ZBC A;  4MNL A;  3UI5 A;  3VAW A;  3UQA A;  1FFQ A;  4IT6 A;  1F40 A;  3ARZ A;  2PPN A;  4IPX A;  4DT4 A;  3UQB A;  4ML4 A;  1H0I A;  4R0X A;  4ODR A;  4NSB A;  5D75 A;  3WL1 A;  1HKM A;  2VN1 A;  1WB0 A;  4DZ3 A;  1X6N A;  4TW6 A;  5HT1 A;  5HW7 A;  1J4I A;  1ZBV A;  1E15 A;  2MLX A;  2N87 A;  3ARX A;  3ALF A;  4LAY A;  1NWT A;  2LJ4 A;  3OA5 A;  1FAP A;  4TNS A;  4Z2H A;  2KGJ A;  4BF8 A;  4W9O A;  2PI6 A;  2A3C A;  5GQB A;  1ZU8 A;  4WKF A;  4TYO A;  1GPF A;  1OGG A;  4DRH A;  3WD1 A;  1E9L A;  2PV1 A;  1T11 A;  5DIU A;  2K8I A;  4U84 A;  4URI A;  3WQV A;  3G6M A;  4QZV B;  3CHC A;  4Q22 A;  1UR9 A;  5BXJ A;  2RQS A;  4DZ2 A;  4XAK A;  2A3A A;  5HW6 A;  3IKD A;  3IKG A;  4TX0 A;  1HKJ A;  2G8Z A;  2ZR4 A;  4P8V A;  4GGQ A;  2XPA A;  3GPK A;  4LAX A;  5HUA A;  2XP4 A;  2KO7 A;  2ZQS A;  3PRD A;  3ARU A;  1ZCN A;  4WIW A;  2M08 A;  1EDQ A;  1PIN A;  4DRQ A;  2A3B A;  4MTV A;  4DRJ A;  2FKE A;  1A7X A;  1KFW A;  4ODM A;  1FJD A;  3WD2 A;  1LL7 A;  3RFW A;  1D2K A;  4ITZ A;  3NTP A;  1W9V A;  1E6P A;  2LKN A;  2LPV A;  2ESC A;  4KR0 B;  1CTN A;  1J4H A;  3O5I A;  4IT4 A;  1FKT A;  3B7X A;  4DRO A;  2ZR6 A;  1LG2 A;  1NH6 A;  4WKA A;  4DH0 A;  3ARS A;  1J4R A;  5JH8 A;  2YBU A;  1ITX A;  4ODK A;  3AQU A;  3PR9 A;  4MNM A;  4DRI A;  3B9D A;  3O5Q A;  3CH9 A;  4G2P A;  3O5G A;  3NI6 A;  4FAP A;  1TCO C;  2RUC A;  1OGB A;  1QPF A;  1LL6 A;  1NWR A;  3KAH A;  5DO2 A;  3LUO A;  4WKH A;  4LGX A;  3RM4 A;  3MDY B;  4IQ2 A;  3RM9 A;  1HKK A;  1HKI A;  4KQZ A;  2F4E A;  2PBC A;  2DSU A;  2AWG A;  5DIV A;  2DG3 A;  3KAB A;  1P5Q A;  3CHD A;  2RSE A;  3ARQ A;  1LJY A;  4NNR A;  1JVW A;  4P8U A;  3O5M A;  1WAW A;  5HW8 A;  4LAW A;  3O5E A;  1E6N A;  3PA7 A;  4JFM A;  1XHG A;  3NRK A;  4Z2J A;  1L1P A;  1ZBW A;  1KT1 A;  2Q5A A;  4TW7 A;  3ODK A;  2O92 A;  4QT2 A;  1W1T A;  1Q6H A;  4S3K A;  4W9P A;  1W9P A;  1YAT A;  1FD9 A;  3ARV A;  4Z2I A;  3AS1 A;  1W1V A;  3ARW A;  1LQ0 A;  3H9R B;  3RME A;  2WK2 A;  1EYM A;  5J6E A;  1OWQ A;  1Q6I A;  2FAP A;  3O5J A;  2PPO A;  4MNJ A;  3RGC A;  4ODQ A;  1X6L A;  4HBE A;  4Z2K A;  3CZ8 A;  3PRA A;  1HXV A;  4JFK A;  4QIB A;  1D7I A;  5DEZ A;  2KFW A;  4ZPV R;  2PV3 A;  3I6C A;  4QT3 A;  1FKD A;  3WD3 A;  3FAP A;  1O6I A;  3KAF A;  2WLY A;  4LAV A;  1E6R A;  3KAD A;  2RUQ A;  2DG4 A;  1FKF A;  1FKI A;  1FKB A;  3KCE A;  1QZ2 A;  1Y0O A;  5GPG A;  3RM8 A;  4JYS A;  1E6Z A;  2DT1 A;  1JNS A;  2WLZ A;  4MPK A;  4MAV A;  2JZV A;  4DRP A;  1FKR A;  3AS2 A;  4ZPT R;  4ODN A;  4P8X A;  2DT0 A;  3B8S A;  3KAC A;  1GUV A;  2XP7 A;  2DG9 A;  1NSG A;  1FKH A;  2PPP A;  1C9H A;  4IQC A;  3UI6 A;  3EY6 A;  1HJV A;  2XP6 A;  4JFI A;  3WH0 A;  2KE0 A;  1LG1 A;  1N1A A;  3CGN A;  1H0G A;  1B6C A;  4JFL A;  4S3J A;  2RUR A;  1WNO A;  4ZS6 A;  5HBF A;  2DSV A;  2XP8 A;  2ZR5 A;  3G6L A;  4Z2L A;  3BXW A;  1PBK A;  3ART A;  1Q1C A;  1SYT A;  1ZK6 A;  2F2D A;  2MPH A;  1NMV A;  4J4O A;  4O2T A;  1ZBK A;  2DSZ A;  3KAI A;  3CHF A;  1W1P A;  4DRK A;  3B9A A;  4AY1 A;  1M5Y A;  2M1I A;  4MNK A;  2PV2 A;  5HTG A;  2LGO A;  1Q6U A;  2B31 A;  1JND A;  2IF4 A;  4MSP A;  3TDB A;  4L72 B;  3TC5 A;  3IHZ A;  1NWS A;  2Y78 A;  2QF8 A;  1FKS A;  3B9E A;  2AOS A;  3OOB A;  1W26 A;  1HJW A;  4U85 A;  1LL4 A;  4Q7N A;  3UI4 A;  3WKZ A;  4W5U A;  1ZL1 A;  2ZQU A;  1W1Y A;  1J6Y A;  3QOK A;  4Z2G A;  1FKL A;  2MLZ A;  4N19 A;  3AS3 A;  3KAG A;  1YW5 A;  2F21 A;  4JFJ A;  1NMW A;  4FN2 A;  1RD6 A;  1EIB A;  4W9Q A;  2A3E A;  2XP9 A;  3ARP A;  2XP5 A;  3O5D A;  3JYM A;  3JXV A;  2G41 A;  3FXY A;  1W9U A;  2YBT A;  2M2A A;  4DWS D;  2OFN A;  2O9O A;  4WK9 A;  2KR7 A;  4DWS A;  4GIV A;  4HAR A;  1QPL A;  1FKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...