5HWBA

Aspergillus fumigatus fkbp12 apo protein in p212121 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
b'MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGINNKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwbA00
5HTGA 1FKJA 1FKSA 4J4NA 4U86A 4GGQA 1D7HA 3NRKA 1Q6UA 4GIVA 3KAFA 2KGJA 4DZ3A 3RGCA 2KE0A 1C9HA 1M5YA 5GPGA 3O5EA 1Q1CA 4QIBA 2KR7A 1KT0A 2LKNA 3O5LA 3PRBA 2KO7A 5HT1A 2PV2A 4NNRA 4DRPA 4DRJA 3TDBA 2XP7A 2F4EA 4MGVA 5BXJA 4FN2A 1A7XA 2ZQTA 3RFWA 3O5QA 2XP5A 4ODPA 1FKTA 5HWCA 4IQCA 2MF9A 3UQIA 2Y78A 3CGMA 4ODRA 2MLXA 3UI5A 2LGOA 4DROA 3O5IA 4ODOA 3IK8A 5D75A 3UQBA 1FKRA 2F21A 4JYSA 3IHZA 5J6EA 3KAGA 1FKIA 1W26A 2PV3A 4BF8A 3NTPA 1QPLA 3WH0A 1NMWA 3IKDA 4U85A 2M08A 3H9RB 2JZVA 3VAWA 1ROUA 3JYMA 2XP9A 4DRMA 3KAIA 3IKGA 1F40A 1FAPA 2DG4A 2RSEA 2ZR5A 1F8AB 4ODNA 5HUAA 2ITKA 2XP3A 2XPAA 1HXVA 2K8IA 2MLZA 2RQSA 5HW8A 3EY6A 3KADA 5B8IC 2KI3A 1FKHA 1EYMA 2MPHA 2RUDA 4DRQA 2LPVA 2Q5AA 4J4OA 3UI4A 2VCDA 3CGNA 4ODMA 4QT2A 2F2DA 2IF4A 1Y0OA 2LJ4A 4LAYA 1FKKA 4TYOA 3O5DA 3KCEA 1KT1A 2MNTA 4FAPA 4N19A 3O5OA 4TW6A 3O5PA 2D9FA 1Q6IA 3TC5A 2VN1A 3UI6A 3NI6A 4JFJA 1R9HA 2M2AA 3O5GA 4DZ2A 4IPXA 3O5MA 4ODKA 4W9QA 1PBKA 4DRHA 1NSGA 1QPFA 2XPBA 2DG3A 3KAHA 3UF8A 3UQAA 3O5JA 3O5FA 5DIVA 1J4RA 1BL4A 2PV1A 4ODQA 2ZQUA 1N1AA 4JFIA 1FKDA 2PPOA 1FKBA 3FAPA 1ZCNA 1ZK6A 3I6CA 3KACA 4DRIA 1J6YA 3O5KA 1FJDA 4R0XA 2M1IA 2RURA 1ROTA 1T11A 4LAWA 4U84A 2N87A 1JNTA 2KFWA 2L2SA 2RUQA 4G2PA 3TCZA 3JYJA 4DH0A 1YATA 3MDYB 5HW7A 5HWBA 1Q6HA 3B7XA 2PPPA 2OFNA 5DIUA 1YW5A 1BKFA 4ODLA 4C02B 4JFKA 2UZ5A 5HW6A 2XP6A 2ZR6A 3KZ7A 3PRDA 1D6OA 4MSPA 3GPKA 3LUOA 4DT4A 4TW7A 3PA7A 2PPNA 2RUCA 1JVWA 1L1PA 1P5QA 1JNSA 1B6CA 4JFMA 4LAVA 4IQ2A 1D7JA 3O5RA 4ITZA 1TCOC 1FKGA 1EQ3A 3ODKA 4W9PA 4W9OA 1FKFA 1J4IA 2DG9A 4O2TA 1J4HA 4TW8A 4TX0A 5I98A 2ZR4A 1FD9A 2XP8A 5DITA 2ZQVA 3OOBA 2PBCA 2ZQSA 4DRKA 3JXVA 1PINA 2FKEA 4LAXA 4TNSA 2MLYA 3KABA 4DRNA 4QT3A 5HKGA 2FAPA 1NMVA 2XP4A 4JFLA 1U79A 4DIPA 1FKLA 1QZ2A 2AWGA 1D7IA 4G50A
chains in the Genus database with same CATH superfamily
1FKSA 3ARVA 4J4NA 2B31A 3BXWA 4GIVA 4DWSB 2KGJA 3RGCA 3CHCA 3RM4A 3RM9A 2ETNA 2G8ZA 1KT0A 2KO7A 3CHDA 4MNLA 4NNRA 4DRJA 3TDBA 2XP7A 2YBTA 5BXJA 2A3AA 1A7XA 3RFWA 5HWCA 2MF9A 4NZCA 3PR9A 3CGMA 3UI5A 4IT4A 4JYSA 3IHZA 5J6EA 1FKIA 2PV3A 3AS0A 3WH0A 1IX5A 1NMWA 3H9RB 2JZVA 1TFVA 1ROUA 4MNJA 4Z2HA 4DWSD 3FY1A 2RSEA 1EIBA 2ITKA 2WK2A 1HXVA 3EY6A 2MPHA 1EYMA 1HJVA 1ZBCA 3CGNA 4ODMA 4LGXA 4P8WA 4NSBA 1Y0OA 2F23A 2LJ4A 1O6IA 3KCEA 1KT1A 2MNTA 3O5OA 4DZ2A 4IPXA 3O5MA 4DRHA 1PBKA 1QPFA 2XPBA 3UQAA 1UR8A 3O5FA 4DWSA 5DF0A 2DPEA 4ODQA 2ZQUA 3G6LA 4MNMA 2P4VA 1HJXA 3I6CA 1ZCNA 3B9DA 1LL6A 4DRIA 1OGGA 1T11A 4LAWA 4MPKA 3WQWA 2O9OA 2KFWA 1YATA 2WLZA 3WD4A 3MDYB 4WK9A 2PPPA 2OFNA 3AS2A 1W9PA 5DIUA 1FFRA 1GUVA 1W1VA 2DSZA 4DWSC 3GPKA 3LUOA 4W5UA 2RUCA 4KQZA 4ITZA 1TCOC 4Z2KA 1KFWA 1W1TA 4Z2GA 1VF8A 1EQ3A 1FKFA 1WB0A 1J4HA 1OGBA 5I98A 2ZR4A 3AS3A 1OWQA 1ZB5A 5DITA 3ARSA 2ZQSA 1H0GA 1PINA 1K9TA 2WLYA 4DRNA 1W1YA 4QT3A 1U79A 4HBEA 4ZPVR 2WM0A 4DZ3A 5GPGA 1Q1CA 4QIBA 3ARUA 2PV2A 2F4EA 4MGVA 4FN2A 3OA5A 4UDMA 3ARYA 2MLXA 2LGOA 2QF8A 3O5IA 3IK8A 5D75A 3KAGA 1W26A 4BF8A 4WKAA 1QPLA 2M08A 3JYMA 4DRMA 2DSWA 3KAIA 3IKGA 2DG4A 5HUAA 1XRVA 3ARTA 4ODNA 2DT3A 2ESCA 2DSUA 3WIJA 3KADA 1EHNA 2KI3A 2RUDA 4IT6A 4DRQA 2LPVA 4L72B 3UI4A 2VCDA 2DT1A 4HARA 4XAKA 4LAYA 1ZU8A 5DEZA 4P8UA 1Q6IA 3TC5A 2VN1A 4JFJA 2M2AA 3W4RA 4URIA 3ARXA 5DIVA 1ZBWA 1ZK6A 3KACA 1ZBKA 1J6YA 3O5KA 2RURA 1ZL1A 4U84A 2N87A 1JNTA 1SYTA 4G2PA 4L3NA 1GOIA 1HKMA 3AQUA 5HW7A 3WL1A 2PN0A 1CTNA 4P8VA 1HJWA 1NWSA 1YW5A 4MTVA 4C02B 4JFKA 2UZ5A 2XP6A 2ZR6A 3BMBA 1H0IA 3KZ7A 1D6OA 4DT4A 2PPNA 1JVWA 3GTYX 4JFMA 4WJXA 1E6ZA 4IQ2A 1LG2A 2A3CA 4MNKA 1J4IA 1WAWA 4DRKA 1HKKA 3JXVA 3KABA 5HKGA 2FAPA 2FDMA 1NMVA 3PRAA 4S3KA 1FKLA 2AWGA 1D7IA 4Z2LA 5HTGA 1FKJA 4U86A 4PTMA 3NRKA 1Q6UA 3ARZA 3KAFA 2KE0A 1C9HA 1M5YA 3O5EA 2KR7A 1NWUA 2LKNA 3O5LA 5HT1A 2A3EA 2ZQTA 4ODPA 1X6LA 3EIPA 3UQIA 4Q7NA 4ODRA 4AY1A 4DROA 4ODOA 3UQBA 1FKRA 1NH6A 3ARQA 4KR0B 3NTPA 3CHFA 3VAWA 4HBOA 3G6MA 1FAPA 3RM8A 2XPAA 2MLZA 2RQSA 5HW8A 5B8IC 4QZVB 1FKHA 2G41A 4ML4A 2DT2A 3CH9A 2Q5AA 1EDQA 1JCHB 4QT2A 2A3BA 2IF4A 1UR9A 1FKKA 4FAPA 4WKHA 4TW6A 3O5PA 2D9FA 3CHEA 1E6PA 3NI6A 3ARPA 1W1PA 4S3JA 4WKFA 2DG3A 1LQ0A 3O5JA 1J4RA 2OLHA 1BL4A 2PV1A 1X6NA 4JFIA 1FKDA 2PPOA 1FKBA 2PI6A 2YBUA 3AS1A 4R0XA 2M1IA 1ROTA 1W9UA 2RUQA 3TCZA 1RD6A 3JYJA 4Q22A 5HWBA 1Q6HA 3B8SA 3B7XA 3FXYA 4ODLA 5HW6A 1E6RA 5GQBA 4P8XA 1L1PA 1P5QA 1JNSA 1B6CA 3CZ8A 1D7JA 3O5RA 1FKGA 1HKJA 3ODKA 3AROA 4W9PA 4O2TA 4TX0A 1FD9A 2ZQVA 2PBCA 1LG1A 4LAXA 4TNSA 2MLYA 3B9EA 1JNEA 1W9VA 3WD0A 4JFLA 3GU0A 4GGQA 1D7HA 1ZBVA 1NWRA 3PRBA 4ZS6A 1LJYA 5DO2A 4DRPA 4Z2IA 3WKZA 3O5QA 2XP5A 3RMEA 1FKTA 1E15A 4IQCA 2Y78A 1GPFA 1E6NA 2IUZA 2F21A 1SR0A 3IKDA 4U85A 2XP9A 1F40A 1XHGA 2AOSA 3B9AA 2ZR5A 1F8AB 3WD1A 1JNDA 2XP3A 2DSVA 2K8IA 4Z2JA 2B5UB 1LL7A 3WD3A 1FFQA 4J4OA 3WL0A 2F2DA 4TYOA 3O5DA 4N19A 1LL4A 3WD2A 3WQVA 3UI6A 1NWTA 1R9HA 3O5GA 2EULA 4ODKA 4W9QA 2DT0A 1NSGA 3KAHA 3UF8A 4MAVA 4ZPTR 1N1AA 3ARRA 3FAPA 1HKIA 1FJDA 4ZPWR 1ITXA 1WNOA 5GPRA 5JH8A 2L2SA 4DH0A 3ARWA 3ALFA 1BKFA 3PRDA 4MSPA 1E44A 1E9LA 4TW7A 3PA7A 4LAVA 1GRJA 4W9OA 1D2KA 4WIWA 2DG9A 4TW8A 2XP8A 3OOBA 2FKEA 5HBFA 3QOKA 2O92A 3ALGA 2XP4A 4DIPA 4R5EA 1QZ2A 4G50A
chains in the Genus database with same CATH topology
1FKSA 3ARVA 4J4NA 2B31A 3BXWA 4GIVA 4DWSB 2KGJA 3RGCA 3CHCA 3RM4A 3RM9A 2G8ZA 1KT0A 2KO7A 3CHDA 4MNLA 4NNRA 4DRJA 3TDBA 2XP7A 2YBTA 5BXJA 2A3AA 1A7XA 3RFWA 5HWCA 2MF9A 4NZCA 3PR9A 3CGMA 3UI5A 4IT4A 4JYSA 3IHZA 5J6EA 1FKIA 2PV3A 3AS0A 3WH0A 1IX5A 1NMWA 3H9RB 2JZVA 1TFVA 1ROUA 4MNJA 4Z2HA 4DWSD 3FY1A 2RSEA 1EIBA 2ITKA 2WK2A 1HXVA 3EY6A 2MPHA 1EYMA 1HJVA 1ZBCA 3CGNA 4ODMA 4LGXA 4P8WA 4NSBA 1Y0OA 2LJ4A 1O6IA 3KCEA 1KT1A 2MNTA 3O5OA 4DZ2A 4IPXA 3O5MA 4DRHA 1PBKA 1QPFA 2XPBA 3UQAA 1UR8A 3O5FA 4DWSA 5DF0A 2DPEA 4ODQA 2ZQUA 3G6LA 4MNMA 1HJXA 3I6CA 1ZCNA 3B9DA 1LL6A 4DRIA 1OGGA 1T11A 4LAWA 4MPKA 3WQWA 2O9OA 2KFWA 1YATA 2WLZA 3WD4A 3MDYB 4WK9A 2PPPA 2OFNA 3AS2A 1W9PA 5DIUA 1FFRA 1GUVA 1W1VA 2DSZA 4DWSC 3GPKA 3LUOA 4W5UA 2RUCA 4KQZA 4ITZA 1TCOC 4Z2KA 1KFWA 1W1TA 4Z2GA 1VF8A 1EQ3A 1FKFA 1WB0A 1J4HA 1OGBA 5I98A 2ZR4A 3AS3A 1OWQA 1ZB5A 5DITA 3ARSA 2ZQSA 1H0GA 1PINA 1K9TA 2WLYA 4DRNA 1W1YA 4QT3A 1U79A 4HBEA 4ZPVR 2WM0A 4DZ3A 5GPGA 1Q1CA 4QIBA 3ARUA 2PV2A 2F4EA 4MGVA 4FN2A 3OA5A 3ARYA 2MLXA 2LGOA 2QF8A 3O5IA 3IK8A 5D75A 3KAGA 1W26A 4BF8A 4WKAA 1QPLA 2M08A 3JYMA 4DRMA 2DSWA 3KAIA 3IKGA 2DG4A 5HUAA 1XRVA 3ARTA 4ODNA 2DT3A 2ESCA 2DSUA 3WIJA 3KADA 1EHNA 2KI3A 2RUDA 4IT6A 4DRQA 2LPVA 4L72B 3UI4A 2VCDA 2DT1A 4HARA 4XAKA 4LAYA 1ZU8A 5DEZA 4P8UA 1Q6IA 3TC5A 2VN1A 4JFJA 2M2AA 3W4RA 4URIA 3ARXA 5DIVA 1ZBWA 1ZK6A 3KACA 1ZBKA 1J6YA 3O5KA 2RURA 1ZL1A 4U84A 2N87A 1JNTA 1SYTA 4G2PA 4L3NA 1GOIA 1HKMA 3AQUA 5HW7A 3WL1A 1CTNA 4P8VA 1HJWA 1NWSA 1YW5A 4MTVA 4C02B 4JFKA 2UZ5A 2XP6A 2ZR6A 1H0IA 3KZ7A 1D6OA 4DT4A 2PPNA 1JVWA 4JFMA 4WJXA 1E6ZA 4IQ2A 1LG2A 2A3CA 4MNKA 1J4IA 1WAWA 4DRKA 1HKKA 3JXVA 3KABA 5HKGA 2FAPA 2FDMA 1NMVA 3PRAA 4S3KA 1FKLA 2AWGA 1D7IA 4Z2LA 5HTGA 1FKJA 4U86A 4PTMA 3NRKA 1Q6UA 3ARZA 3KAFA 2KE0A 1C9HA 1M5YA 3O5EA 2KR7A 1NWUA 2LKNA 3O5LA 5HT1A 2A3EA 2ZQTA 4ODPA 1X6LA 3UQIA 4Q7NA 4ODRA 4AY1A 4DROA 4ODOA 3UQBA 1FKRA 1NH6A 3ARQA 4KR0B 3NTPA 3CHFA 3VAWA 4HBOA 3G6MA 1FAPA 3RM8A 2XPAA 2MLZA 2RQSA 5HW8A 5B8IC 4QZVB 1FKHA 2G41A 4ML4A 2DT2A 3CH9A 2Q5AA 1EDQA 4QT2A 2A3BA 2IF4A 1UR9A 1FKKA 4FAPA 4WKHA 4TW6A 3O5PA 2D9FA 3CHEA 1E6PA 3NI6A 3ARPA 1W1PA 4S3JA 4WKFA 2DG3A 1LQ0A 3O5JA 1J4RA 2OLHA 1BL4A 2PV1A 1X6NA 4JFIA 1FKDA 2PPOA 1FKBA 2PI6A 2YBUA 3AS1A 4R0XA 2M1IA 1ROTA 1W9UA 2RUQA 3TCZA 1RD6A 3JYJA 4Q22A 5HWBA 1Q6HA 3B8SA 3B7XA 3FXYA 4ODLA 5HW6A 1E6RA 5GQBA 4P8XA 1L1PA 1P5QA 1JNSA 1B6CA 3CZ8A 1D7JA 3O5RA 1FKGA 1HKJA 3ODKA 3AROA 4W9PA 4O2TA 4TX0A 1FD9A 2ZQVA 2PBCA 1LG1A 4LAXA 4TNSA 2MLYA 3B9EA 1JNEA 1W9VA 3WD0A 4JFLA 4GGQA 1D7HA 1ZBVA 1NWRA 3PRBA 4ZS6A 1LJYA 5DO2A 4DRPA 4Z2IA 3WKZA 3O5QA 2XP5A 3RMEA 1FKTA 1E15A 4IQCA 2Y78A 1GPFA 1E6NA 2IUZA 2F21A 1SR0A 3IKDA 4U85A 2XP9A 1F40A 1XHGA 2AOSA 3B9AA 2ZR5A 1F8AB 3WD1A 1JNDA 2XP3A 2DSVA 2K8IA 4Z2JA 1LL7A 3WD3A 1FFQA 4J4OA 3WL0A 2F2DA 4TYOA 3O5DA 4N19A 1LL4A 3WD2A 3WQVA 3UI6A 1NWTA 1R9HA 3O5GA 4ODKA 4W9QA 2DT0A 1NSGA 3KAHA 3UF8A 4MAVA 4ZPTR 1N1AA 3ARRA 3FAPA 1HKIA 1FJDA 4ZPWR 1ITXA 1WNOA 5GPRA 5JH8A 2L2SA 4DH0A 3ARWA 3ALFA 1BKFA 3PRDA 4MSPA 1E9LA 4TW7A 3PA7A 4LAVA 4W9OA 1D2KA 4WIWA 2DG9A 4TW8A 2XP8A 3OOBA 2FKEA 5HBFA 3QOKA 2O92A 3ALGA 2XP4A 4DIPA 4R5EA 1QZ2A 4G50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HTG A;  1FKJ A;  1FKS A;  4J4N A;  4U86 A;  4GGQ A;  1D7H A;  3NRK A;  1Q6U A;  4GIV A;  3KAF A;  2KGJ A;  4DZ3 A;  3RGC A;  2KE0 A;  1C9H A;  1M5Y A;  5GPG A;  3O5E A;  1Q1C A;  4QIB A;  2KR7 A;  1KT0 A;  2LKN A;  3O5L A;  3PRB A;  2KO7 A;  5HT1 A;  2PV2 A;  4NNR A;  4DRP A;  4DRJ A;  3TDB A;  2XP7 A;  2F4E A;  4MGV A;  5BXJ A;  4FN2 A;  1A7X A;  2ZQT A;  3RFW A;  3O5Q A;  2XP5 A;  4ODP A;  1FKT A;  5HWC A;  4IQC A;  2MF9 A;  3UQI A;  2Y78 A;  3CGM A;  4ODR A;  2MLX A;  3UI5 A;  2LGO A;  4DRO A;  3O5I A;  4ODO A;  3IK8 A;  5D75 A;  3UQB A;  1FKR A;  2F21 A;  4JYS A;  3IHZ A;  5J6E A;  3KAG A;  1FKI A;  1W26 A;  2PV3 A;  4BF8 A;  3NTP A;  1QPL A;  3WH0 A;  1NMW A;  3IKD A;  4U85 A;  2M08 A;  3H9R B;  2JZV A;  3VAW A;  1ROU A;  3JYM A;  2XP9 A;  4DRM A;  3KAI A;  3IKG A;  1F40 A;  1FAP A;  2DG4 A;  2RSE A;  2ZR5 A;  1F8A B;  4ODN A;  5HUA A;  2ITK A;  2XP3 A;  2XPA A;  1HXV A;  2K8I A;  2MLZ A;  2RQS A;  5HW8 A;  3EY6 A;  3KAD A;  5B8I C;  2KI3 A;  1FKH A;  1EYM A;  2MPH A;  2RUD A;  4DRQ A;  2LPV A;  2Q5A A;  4J4O A;  3UI4 A;  2VCD A;  3CGN A;  4ODM A;  4QT2 A;  2F2D A;  2IF4 A;  1Y0O A;  2LJ4 A;  4LAY A;  1FKK A;  4TYO A;  3O5D A;  3KCE A;  1KT1 A;  2MNT A;  4FAP A;  4N19 A;  3O5O A;  4TW6 A;  3O5P A;  2D9F A;  1Q6I A;  3TC5 A;  2VN1 A;  3UI6 A;  3NI6 A;  4JFJ A;  1R9H A;  2M2A A;  3O5G A;  4DZ2 A;  4IPX A;  3O5M A;  4ODK A;  4W9Q A;  1PBK A;  4DRH A;  1NSG A;  1QPF A;  2XPB A;  2DG3 A;  3KAH A;  3UF8 A;  3UQA A;  3O5J A;  3O5F A;  5DIV A;  1J4R A;  1BL4 A;  2PV1 A;  4ODQ A;  2ZQU A;  1N1A A;  4JFI A;  1FKD A;  2PPO A;  1FKB A;  3FAP A;  1ZCN A;  1ZK6 A;  3I6C A;  3KAC A;  4DRI A;  1J6Y A;  3O5K A;  1FJD A;  4R0X A;  2M1I A;  2RUR A;  1ROT A;  1T11 A;  4LAW A;  4U84 A;  2N87 A;  1JNT A;  2KFW A;  2L2S A;  2RUQ A;  4G2P A;  3TCZ A;  3JYJ A;  4DH0 A;  1YAT A;  3MDY B;  5HW7 A;  5HWB A;  1Q6H A;  3B7X A;  2PPP A;  2OFN A;  5DIU A;  1YW5 A;  1BKF A;  4ODL A;  4C02 B;  4JFK A;  2UZ5 A;  5HW6 A;  2XP6 A;  2ZR6 A;  3KZ7 A;  3PRD A;  1D6O A;  4MSP A;  3GPK A;  3LUO A;  4DT4 A;  4TW7 A;  3PA7 A;  2PPN A;  2RUC A;  1JVW A;  1L1P A;  1P5Q A;  1JNS A;  1B6C A;  4JFM A;  4LAV A;  4IQ2 A;  1D7J A;  3O5R A;  4ITZ A;  1TCO C;  1FKG A;  1EQ3 A;  3ODK A;  4W9P A;  4W9O A;  1FKF A;  1J4I A;  2DG9 A;  4O2T A;  1J4H A;  4TW8 A;  4TX0 A;  5I98 A;  2ZR4 A;  1FD9 A;  2XP8 A;  5DIT A;  2ZQV A;  3OOB A;  2PBC A;  2ZQS A;  4DRK A;  3JXV A;  1PIN A;  2FKE A;  4LAX A;  4TNS A;  2MLY A;  3KAB A;  4DRN A;  4QT3 A;  5HKG A;  2FAP A;  1NMV A;  2XP4 A;  4JFL A;  1U79 A;  4DIP A;  1FKL A;  1QZ2 A;  2AWG A;  1D7I A;  4G50 A; 
#chains in the Genus database with same CATH topology
 1FKS A;  3ARV A;  4J4N A;  2B31 A;  3BXW A;  4GIV A;  4DWS B;  2KGJ A;  3RGC A;  3CHC A;  3RM4 A;  3RM9 A;  2ETN A;  2G8Z A;  1KT0 A;  2KO7 A;  3CHD A;  4MNL A;  4NNR A;  4DRJ A;  3TDB A;  2XP7 A;  2YBT A;  5BXJ A;  2A3A A;  1A7X A;  3RFW A;  5HWC A;  2MF9 A;  4NZC A;  3PR9 A;  3CGM A;  3UI5 A;  4IT4 A;  4JYS A;  3IHZ A;  5J6E A;  1FKI A;  2PV3 A;  3AS0 A;  3WH0 A;  1IX5 A;  1NMW A;  3H9R B;  2JZV A;  1TFV A;  1ROU A;  4MNJ A;  4Z2H A;  4DWS D;  3FY1 A;  2RSE A;  1EIB A;  2ITK A;  2WK2 A;  1HXV A;  3EY6 A;  2MPH A;  1EYM A;  1HJV A;  1ZBC A;  3CGN A;  4ODM A;  4LGX A;  4P8W A;  4NSB A;  1Y0O A;  2F23 A;  2LJ4 A;  1O6I A;  3KCE A;  1KT1 A;  2MNT A;  3O5O A;  4DZ2 A;  4IPX A;  3O5M A;  4DRH A;  1PBK A;  1QPF A;  2XPB A;  3UQA A;  1UR8 A;  3O5F A;  4DWS A;  5DF0 A;  2DPE A;  4ODQ A;  2ZQU A;  3G6L A;  4MNM A;  2P4V A;  1HJX A;  3I6C A;  1ZCN A;  3B9D A;  1LL6 A;  4DRI A;  1OGG A;  1T11 A;  4LAW A;  4MPK A;  3WQW A;  2O9O A;  2KFW A;  1YAT A;  2WLZ A;  3WD4 A;  3MDY B;  4WK9 A;  2PPP A;  2OFN A;  3AS2 A;  1W9P A;  5DIU A;  1FFR A;  1GUV A;  1W1V A;  2DSZ A;  4DWS C;  3GPK A;  3LUO A;  4W5U A;  2RUC A;  4KQZ A;  4ITZ A;  1TCO C;  4Z2K A;  1KFW A;  1W1T A;  4Z2G A;  1VF8 A;  1EQ3 A;  1FKF A;  1WB0 A;  1J4H A;  1OGB A;  5I98 A;  2ZR4 A;  3AS3 A;  1OWQ A;  1ZB5 A;  5DIT A;  3ARS A;  2ZQS A;  1H0G A;  1PIN A;  1K9T A;  2WLY A;  4DRN A;  1W1Y A;  4QT3 A;  1U79 A;  4HBE A;  4ZPV R;  2WM0 A;  4DZ3 A;  5GPG A;  1Q1C A;  4QIB A;  3ARU A;  2PV2 A;  2F4E A;  4MGV A;  4FN2 A;  3OA5 A;  4UDM A;  3ARY A;  2MLX A;  2LGO A;  2QF8 A;  3O5I A;  3IK8 A;  5D75 A;  3KAG A;  1W26 A;  4BF8 A;  4WKA A;  1QPL A;  2M08 A;  3JYM A;  4DRM A;  2DSW A;  3KAI A;  3IKG A;  2DG4 A;  5HUA A;  1XRV A;  3ART A;  4ODN A;  2DT3 A;  2ESC A;  2DSU A;  3WIJ A;  3KAD A;  1EHN A;  2KI3 A;  2RUD A;  4IT6 A;  4DRQ A;  2LPV A;  4L72 B;  3UI4 A;  2VCD A;  2DT1 A;  4HAR A;  4XAK A;  4LAY A;  1ZU8 A;  5DEZ A;  4P8U A;  1Q6I A;  3TC5 A;  2VN1 A;  4JFJ A;  2M2A A;  3W4R A;  4URI A;  3ARX A;  5DIV A;  1ZBW A;  1ZK6 A;  3KAC A;  1ZBK A;  1J6Y A;  3O5K A;  2RUR A;  1ZL1 A;  4U84 A;  2N87 A;  1JNT A;  1SYT A;  4G2P A;  4L3N A;  1GOI A;  1HKM A;  3AQU A;  5HW7 A;  3WL1 A;  2PN0 A;  1CTN A;  4P8V A;  1HJW A;  1NWS A;  1YW5 A;  4MTV A;  4C02 B;  4JFK A;  2UZ5 A;  2XP6 A;  2ZR6 A;  3BMB A;  1H0I A;  3KZ7 A;  1D6O A;  4DT4 A;  2PPN A;  1JVW A;  3GTY X;  4JFM A;  4WJX A;  1E6Z A;  4IQ2 A;  1LG2 A;  2A3C A;  4MNK A;  1J4I A;  1WAW A;  4DRK A;  1HKK A;  3JXV A;  3KAB A;  5HKG A;  2FAP A;  2FDM A;  1NMV A;  3PRA A;  4S3K A;  1FKL A;  2AWG A;  1D7I A;  4Z2L A;  5HTG A;  1FKJ A;  4U86 A;  4PTM A;  3NRK A;  1Q6U A;  3ARZ A;  3KAF A;  2KE0 A;  1C9H A;  1M5Y A;  3O5E A;  2KR7 A;  1NWU A;  2LKN A;  3O5L A;  5HT1 A;  2A3E A;  2ZQT A;  4ODP A;  1X6L A;  3EIP A;  3UQI A;  4Q7N A;  4ODR A;  4AY1 A;  4DRO A;  4ODO A;  3UQB A;  1FKR A;  1NH6 A;  3ARQ A;  4KR0 B;  3NTP A;  3CHF A;  3VAW A;  4HBO A;  3G6M A;  1FAP A;  3RM8 A;  2XPA A;  2MLZ A;  2RQS A;  5HW8 A;  5B8I C;  4QZV B;  1FKH A;  2G41 A;  4ML4 A;  2DT2 A;  3CH9 A;  2Q5A A;  1EDQ A;  1JCH B;  4QT2 A;  2A3B A;  2IF4 A;  1UR9 A;  1FKK A;  4FAP A;  4WKH A;  4TW6 A;  3O5P A;  2D9F A;  3CHE A;  1E6P A;  3NI6 A;  3ARP A;  1W1P A;  4S3J A;  4WKF A;  2DG3 A;  1LQ0 A;  3O5J A;  1J4R A;  2OLH A;  1BL4 A;  2PV1 A;  1X6N A;  4JFI A;  1FKD A;  2PPO A;  1FKB A;  2PI6 A;  2YBU A;  3AS1 A;  4R0X A;  2M1I A;  1ROT A;  1W9U A;  2RUQ A;  3TCZ A;  1RD6 A;  3JYJ A;  4Q22 A;  5HWB A;  1Q6H A;  3B8S A;  3B7X A;  3FXY A;  4ODL A;  5HW6 A;  1E6R A;  5GQB A;  4P8X A;  1L1P A;  1P5Q A;  1JNS A;  1B6C A;  3CZ8 A;  1D7J A;  3O5R A;  1FKG A;  1HKJ A;  3ODK A;  3ARO A;  4W9P A;  4O2T A;  4TX0 A;  1FD9 A;  2ZQV A;  2PBC A;  1LG1 A;  4LAX A;  4TNS A;  2MLY A;  3B9E A;  1JNE A;  1W9V A;  3WD0 A;  4JFL A;  3GU0 A;  4GGQ A;  1D7H A;  1ZBV A;  1NWR A;  3PRB A;  4ZS6 A;  1LJY A;  5DO2 A;  4DRP A;  4Z2I A;  3WKZ A;  3O5Q A;  2XP5 A;  3RME A;  1FKT A;  1E15 A;  4IQC A;  2Y78 A;  1GPF A;  1E6N A;  2IUZ A;  2F21 A;  1SR0 A;  3IKD A;  4U85 A;  2XP9 A;  1F40 A;  1XHG A;  2AOS A;  3B9A A;  2ZR5 A;  1F8A B;  3WD1 A;  1JND A;  2XP3 A;  2DSV A;  2K8I A;  4Z2J A;  2B5U B;  1LL7 A;  3WD3 A;  1FFQ A;  4J4O A;  3WL0 A;  2F2D A;  4TYO A;  3O5D A;  4N19 A;  1LL4 A;  3WD2 A;  3WQV A;  3UI6 A;  1NWT A;  1R9H A;  3O5G A;  2EUL A;  4ODK A;  4W9Q A;  2DT0 A;  1NSG A;  3KAH A;  3UF8 A;  4MAV A;  4ZPT R;  1N1A A;  3ARR A;  3FAP A;  1HKI A;  1FJD A;  4ZPW R;  1ITX A;  1WNO A;  5GPR A;  5JH8 A;  2L2S A;  4DH0 A;  3ARW A;  3ALF A;  1BKF A;  3PRD A;  4MSP A;  1E44 A;  1E9L A;  4TW7 A;  3PA7 A;  4LAV A;  1GRJ A;  4W9O A;  1D2K A;  4WIW A;  2DG9 A;  4TW8 A;  2XP8 A;  3OOB A;  2FKE A;  5HBF A;  3QOK A;  2O92 A;  3ALG A;  2XP4 A;  4DIP A;  4R5E A;  1QZ2 A;  4G50 A; 
#chains in the Genus database with same CATH homology
 1FKS A;  3ARV A;  4J4N A;  2B31 A;  3BXW A;  4GIV A;  4DWS B;  2KGJ A;  3RGC A;  3CHC A;  3RM4 A;  3RM9 A;  2G8Z A;  1KT0 A;  2KO7 A;  3CHD A;  4MNL A;  4NNR A;  4DRJ A;  3TDB A;  2XP7 A;  2YBT A;  5BXJ A;  2A3A A;  1A7X A;  3RFW A;  5HWC A;  2MF9 A;  4NZC A;  3PR9 A;  3CGM A;  3UI5 A;  4IT4 A;  4JYS A;  3IHZ A;  5J6E A;  1FKI A;  2PV3 A;  3AS0 A;  3WH0 A;  1IX5 A;  1NMW A;  3H9R B;  2JZV A;  1TFV A;  1ROU A;  4MNJ A;  4Z2H A;  4DWS D;  3FY1 A;  2RSE A;  1EIB A;  2ITK A;  2WK2 A;  1HXV A;  3EY6 A;  2MPH A;  1EYM A;  1HJV A;  1ZBC A;  3CGN A;  4ODM A;  4LGX A;  4P8W A;  4NSB A;  1Y0O A;  2LJ4 A;  1O6I A;  3KCE A;  1KT1 A;  2MNT A;  3O5O A;  4DZ2 A;  4IPX A;  3O5M A;  4DRH A;  1PBK A;  1QPF A;  2XPB A;  3UQA A;  1UR8 A;  3O5F A;  4DWS A;  5DF0 A;  2DPE A;  4ODQ A;  2ZQU A;  3G6L A;  4MNM A;  1HJX A;  3I6C A;  1ZCN A;  3B9D A;  1LL6 A;  4DRI A;  1OGG A;  1T11 A;  4LAW A;  4MPK A;  3WQW A;  2O9O A;  2KFW A;  1YAT A;  2WLZ A;  3WD4 A;  3MDY B;  4WK9 A;  2PPP A;  2OFN A;  3AS2 A;  1W9P A;  5DIU A;  1FFR A;  1GUV A;  1W1V A;  2DSZ A;  4DWS C;  3GPK A;  3LUO A;  4W5U A;  2RUC A;  4KQZ A;  4ITZ A;  1TCO C;  4Z2K A;  1KFW A;  1W1T A;  4Z2G A;  1VF8 A;  1EQ3 A;  1FKF A;  1WB0 A;  1J4H A;  1OGB A;  5I98 A;  2ZR4 A;  3AS3 A;  1OWQ A;  1ZB5 A;  5DIT A;  3ARS A;  2ZQS A;  1H0G A;  1PIN A;  1K9T A;  2WLY A;  4DRN A;  1W1Y A;  4QT3 A;  1U79 A;  4HBE A;  4ZPV R;  2WM0 A;  4DZ3 A;  5GPG A;  1Q1C A;  4QIB A;  3ARU A;  2PV2 A;  2F4E A;  4MGV A;  4FN2 A;  3OA5 A;  3ARY A;  2MLX A;  2LGO A;  2QF8 A;  3O5I A;  3IK8 A;  5D75 A;  3KAG A;  1W26 A;  4BF8 A;  4WKA A;  1QPL A;  2M08 A;  3JYM A;  4DRM A;  2DSW A;  3KAI A;  3IKG A;  2DG4 A;  5HUA A;  1XRV A;  3ART A;  4ODN A;  2DT3 A;  2ESC A;  2DSU A;  3WIJ A;  3KAD A;  1EHN A;  2KI3 A;  2RUD A;  4IT6 A;  4DRQ A;  2LPV A;  4L72 B;  3UI4 A;  2VCD A;  2DT1 A;  4HAR A;  4XAK A;  4LAY A;  1ZU8 A;  5DEZ A;  4P8U A;  1Q6I A;  3TC5 A;  2VN1 A;  4JFJ A;  2M2A A;  3W4R A;  4URI A;  3ARX A;  5DIV A;  1ZBW A;  1ZK6 A;  3KAC A;  1ZBK A;  1J6Y A;  3O5K A;  2RUR A;  1ZL1 A;  4U84 A;  2N87 A;  1JNT A;  1SYT A;  4G2P A;  4L3N A;  1GOI A;  1HKM A;  3AQU A;  5HW7 A;  3WL1 A;  1CTN A;  4P8V A;  1HJW A;  1NWS A;  1YW5 A;  4MTV A;  4C02 B;  4JFK A;  2UZ5 A;  2XP6 A;  2ZR6 A;  1H0I A;  3KZ7 A;  1D6O A;  4DT4 A;  2PPN A;  1JVW A;  4JFM A;  4WJX A;  1E6Z A;  4IQ2 A;  1LG2 A;  2A3C A;  4MNK A;  1J4I A;  1WAW A;  4DRK A;  1HKK A;  3JXV A;  3KAB A;  5HKG A;  2FAP A;  2FDM A;  1NMV A;  3PRA A;  4S3K A;  1FKL A;  2AWG A;  1D7I A;  4Z2L A;  5HTG A;  1FKJ A;  4U86 A;  4PTM A;  3NRK A;  1Q6U A;  3ARZ A;  3KAF A;  2KE0 A;  1C9H A;  1M5Y A;  3O5E A;  2KR7 A;  1NWU A;  2LKN A;  3O5L A;  5HT1 A;  2A3E A;  2ZQT A;  4ODP A;  1X6L A;  3UQI A;  4Q7N A;  4ODR A;  4AY1 A;  4DRO A;  4ODO A;  3UQB A;  1FKR A;  1NH6 A;  3ARQ A;  4KR0 B;  3NTP A;  3CHF A;  3VAW A;  4HBO A;  3G6M A;  1FAP A;  3RM8 A;  2XPA A;  2MLZ A;  2RQS A;  5HW8 A;  5B8I C;  4QZV B;  1FKH A;  2G41 A;  4ML4 A;  2DT2 A;  3CH9 A;  2Q5A A;  1EDQ A;  4QT2 A;  2A3B A;  2IF4 A;  1UR9 A;  1FKK A;  4FAP A;  4WKH A;  4TW6 A;  3O5P A;  2D9F A;  3CHE A;  1E6P A;  3NI6 A;  3ARP A;  1W1P A;  4S3J A;  4WKF A;  2DG3 A;  1LQ0 A;  3O5J A;  1J4R A;  2OLH A;  1BL4 A;  2PV1 A;  1X6N A;  4JFI A;  1FKD A;  2PPO A;  1FKB A;  2PI6 A;  2YBU A;  3AS1 A;  4R0X A;  2M1I A;  1ROT A;  1W9U A;  2RUQ A;  3TCZ A;  1RD6 A;  3JYJ A;  4Q22 A;  5HWB A;  1Q6H A;  3B8S A;  3B7X A;  3FXY A;  4ODL A;  5HW6 A;  1E6R A;  5GQB A;  4P8X A;  1L1P A;  1P5Q A;  1JNS A;  1B6C A;  3CZ8 A;  1D7J A;  3O5R A;  1FKG A;  1HKJ A;  3ODK A;  3ARO A;  4W9P A;  4O2T A;  4TX0 A;  1FD9 A;  2ZQV A;  2PBC A;  1LG1 A;  4LAX A;  4TNS A;  2MLY A;  3B9E A;  1JNE A;  1W9V A;  3WD0 A;  4JFL A;  4GGQ A;  1D7H A;  1ZBV A;  1NWR A;  3PRB A;  4ZS6 A;  1LJY A;  5DO2 A;  4DRP A;  4Z2I A;  3WKZ A;  3O5Q A;  2XP5 A;  3RME A;  1FKT A;  1E15 A;  4IQC A;  2Y78 A;  1GPF A;  1E6N A;  2IUZ A;  2F21 A;  1SR0 A;  3IKD A;  4U85 A;  2XP9 A;  1F40 A;  1XHG A;  2AOS A;  3B9A A;  2ZR5 A;  1F8A B;  3WD1 A;  1JND A;  2XP3 A;  2DSV A;  2K8I A;  4Z2J A;  1LL7 A;  3WD3 A;  1FFQ A;  4J4O A;  3WL0 A;  2F2D A;  4TYO A;  3O5D A;  4N19 A;  1LL4 A;  3WD2 A;  3WQV A;  3UI6 A;  1NWT A;  1R9H A;  3O5G A;  4ODK A;  4W9Q A;  2DT0 A;  1NSG A;  3KAH A;  3UF8 A;  4MAV A;  4ZPT R;  1N1A A;  3ARR A;  3FAP A;  1HKI A;  1FJD A;  4ZPW R;  1ITX A;  1WNO A;  5GPR A;  5JH8 A;  2L2S A;  4DH0 A;  3ARW A;  3ALF A;  1BKF A;  3PRD A;  4MSP A;  1E9L A;  4TW7 A;  3PA7 A;  4LAV A;  4W9O A;  1D2K A;  4WIW A;  2DG9 A;  4TW8 A;  2XP8 A;  3OOB A;  2FKE A;  5HBF A;  3QOK A;  2O92 A;  3ALG A;  2XP4 A;  4DIP A;  4R5E A;  1QZ2 A;  4G50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...