5HWCA

Aspergillus fumigatus fkbp12 p90g protein bound with fk506 in p212121 space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
HMGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPGVIPGNSTLIFEVELLGINNKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 30
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwcA00
4ODMA 3KABA 3O5FA 1HXVA 1FAPA 1NSGA 4BF8A 1C9HA 1FD9A 2FAPA 4FAPA 3NRKA 5HW7A 2F21A 1FKDA 3KAHA 1ROTA 2AWGA 4TX0A 2F4EA 4IQ2A 3IHZA 4QT2A 4IQCA 5DIVA 2VN1A 3TC5A 1YW5A 4DROA 2MLYA 1ROUA 4JFIA 4ODNA 4DT4A 4DZ2A 1QPLA 2RUQA 1QZ2A 4TW7A 3VAWA 2M1IA 2ZQTA 4O2TA 4ODQA 3UQIA 5D75A 1P5QA 3ODKA 1A7XA 5DIUA 2XP4A 1Q6IA 2RSEA 3UQBA 4ODKA 5BXJA 5GPGA 2PV3A 2LGOA 4R0XA 2DG9A 1L1PA 3I6CA 2MLXA 1YATA 3TCZA 1JNTA 2ZR5A 3CGMA 1Q6UA 1FKRA 1ZCNA 2L2SA 4G2PA 4ODPA 3O5DA 1FJDA 1FKKA 4LAYA 3UI6A 1D6OA 3IKGA 2XP5A 2XP9A 2IF4A 3EY6A 3O5JA 3JYJA 3O5IA 2MNTA 3IKDA 1BKFA 3B7XA 3PRBA 4N19A 2LKNA 4JFJA 2F2DA 4LAVA 2Y78A 2MF9A 4ITZA 1PBKA 1M5YA 1FKSA 2XP6A 4QT3A 1J6YA 1D7HA 3TDBA 2ZR4A 2PV1A 2JZVA 1J4RA 3O5LA 4JYSA 2XP8A 5J6EA 4FN2A 2VCDA 4NNRA 4JFLA 1FKFA 1FKGA 2OFNA 3GPKA 2KGJA 3O5OA 4ODRA 4C02B 2KFWA 4DRNA 3UI5A 5I98A 1FKBA 1J4IA 2RQSA 3H9RB 4DRKA 3KAFA 4JFMA 2M08A 2MPHA 4DRMA 2PV2A 5HUAA 2LJ4A 2RUCA 1EQ3A 2PBCA 3IK8A 2K8IA 3FAPA 3UF8A 3KCEA 2M2AA 2ZQUA 2N87A 3O5EA 4DIPA 2XPAA 1J4HA 3RFWA 2UZ5A 3O5KA 5HWCA 1KT1A 2LPVA 4TYOA 4U86A 3O5GA 1U79A 1T11A 2FKEA 4G50A 5B8IC 1FKJA 2RUDA 1NMWA 3O5RA 3LUOA 1QPFA 4TW6A 2ZR6A 1R9HA 3KZ7A 5HT1A 4W9QA 2Q5AA 4DRPA 2D9FA 2KI3A 3WH0A 2KR7A 2XP7A 2PPPA 2KO7A 1D7JA 4ODLA 4J4OA 4W9PA 4IPXA 5HW8A 4TW8A 3KADA 3UQAA 4W9OA 2PPOA 2ITKA 3NTPA 5HWBA 1B6CA 4LAXA 2KE0A 2ZQVA 2PPNA 2MLZA 3O5QA 4DRQA 4DH0A 4J4NA 2DG3A 1NMVA 2XP3A 2RURA 1BL4A 2XPBA 3KACA 4MGVA 4MSPA 1Y0OA 4DZ3A 1F8AB 1ZK6A 2ZQSA 4GGQA 1F40A 3O5PA 4U85A 3UI4A 3OOBA 1KT0A 4DRIA 3RGCA 1D7IA 3PRDA 1JVWA 3JYMA 5DITA 1W26A 5HKGA 3JXVA 3PA7A 4LAWA 3NI6A 1PINA 1EYMA 1FKHA 3KAGA 1FKTA 1N1AA 3MDYB 3O5MA 4ODOA 4U84A 1JNSA 3CGNA 1Q6HA 2DG4A 5HW6A 1TCOC 5HTGA 1FKIA 4GIVA 4JFKA 4QIBA 1FKLA 3KAIA 4DRJA 1Q1CA 4TNSA 4DRHA
chains in the Genus database with same CATH superfamily
3GTYX 3KABA 1FD9A 3WKZA 2F21A 3KAHA 4TX0A 4IQ2A 3TC5A 3IHZA 1OWQA 4IQCA 2VN1A 1ROUA 4DT4A 2A3EA 1FFRA 3ALFA 4IT6A 4DWSA 1A7XA 1Q6IA 3UQBA 2PV3A 2DT3A 4MNJA 3RM4A 2LGOA 3I6CA 1W1VA 4Z2KA 2ZR5A 1LQ0A 3ARQA 1FKRA 4G2PA 2DT2A 1FJDA 1FKKA 3WIJA 1E6ZA 2ETNA 1D6OA 4DWSC 1LL7A 4MAVA 3IKDA 1BKFA 1NWSA 3B7XA 3PRBA 4L3NA 2LKNA 4DWSB 2F2DA 2Y78A 4DWSD 4QT3A 1FKSA 1D7HA 2ZR4A 1LJYA 4JYSA 4KR0B 2XP8A 4JFLA 4XAKA 1FKGA 2WK2A 1FKBA 1LL4A 4P8UA 4LGXA 4DRMA 2PV2A 5HUAA 2LJ4A 1EQ3A 3UF8A 1VF8A 1J4HA 3RFWA 2DSZA 1IX5A 4TYOA 2FKEA 1T11A 1LG2A 4TW6A 2ZR6A 3KZ7A 2Q5AA 3AROA 2ESCA 3WH0A 2A3AA 1D7JA 5HW8A 3W4RA 1ZBWA 4P8XA 3UQAA 2PPOA 3NTPA 5HWBA 2PPNA 4DH0A 4J4NA 2DG3A 1HKMA 3WL1A 1GOIA 1ZK6A 4GGQA 4IT4A 1D7IA 3BMBA 3NI6A 1NWTA 3ARRA 4HARA 3OA5A 4U84A 1TCOC 4QIBA 4MNMA 4Z2IA 3ARTA 3O5FA 1NSGA 1C9HA 2FAPA 3AS1A 3NRKA 3G6LA 2AWGA 1YW5A 4JFIA 3WL0A 4DZ2A 1QPLA 3VAWA 5HBFA 1X6LA 2G41A 2ZQTA 3UQIA 1LL6A 2O92A 2RSEA 5GPGA 1ZBCA 3CHDA 1HKKA 3ARWA 2DG9A 1L1PA 4S3JA 3WD4A 1YATA 3TCZA 4KQZA 4ML4A 1D2KA 3RMEA 3O5DA 4URIA 4LAYA 3UI6A 3IKGA 4WIWA 3EY6A 2IF4A 1WB0A 3O5JA 2FDMA 3O5IA 4WK9A 4W5UA 4P8WA 4NSBA 4N19A 4MPKA 1M5YA 4NZCA 2F23A 3TDBA 2PV1A 4Z2GA 1J4RA 1ZU8A 3O5LA 5J6EA 1FKFA 1XHGA 4C02B 3O5OA 1KFWA 3ARVA 3UI5A 1UR9A 2P4VA 1GRJA 1ZBKA 1ZL1A 2DSWA 4AY1A 2PBCA 4PTMA 2K8IA 3FAPA 3O5EA 1JNEA 1XRVA 2UZ5A 4P8VA 5HWCA 2DSUA 3AS2A 4U86A 3O5GA 4WKHA 4HBEA 1FKJA 1TFVA 3O5RA 3BXWA 2DT1A 1GUVA 4J4OA 2B5UB 4TW8A 2ITKA 2QF8A 2KE0A 2MLZA 5DEZA 4ZS6A 1SR0A 2YBTA 1W1YA 2XP3A 2RURA 1BL4A 2XPBA 4MSPA 1NWUA 1Y0OA 2YBUA 2ZQSA 4R5EA 5JH8A 3ARUA 1W26A 3JXVA 3PA7A 3ARSA 2A3CA 1HJXA 3PRAA 3QOKA 1Q6HA 1HJWA 4GIVA 4JFKA 4ZPWR 1W9VA 2MPHA 3B9AA 4ODMA 1HXVA 1NWRA 4FAPA 4BF8A 3WD3A 3WQVA 5HW7A 1ROTA 2WM0A 2F4EA 5DIVA 3ARPA 2MLYA 2M1IA 2O9OA 1P5QA 5DIUA 2XP4A 4ODKA 2G8ZA 3WD1A 3FY1A 4R0XA 2MLXA 3CHEA 1W1TA 1ZCNA 2A3BA 1NH6A 2L2SA 3ARXA 4ODPA 4MNLA 3CZ8A 3B8SA 3JYJA 2MNTA 1RD6A 3AQUA 4JFJA 1ITXA 2DSVA 1PBKA 4ITZA 2XP6A 4MNKA 5GQBA 4S3KA 1W9PA 1X6NA 2VCDA 2OFNA 4ODRA 4Z2JA 1J4IA 3H9RB 4JFMA 2M08A 4MTVA 3AS0A 4Z2HA 3CH9A 3KCEA 2M2AA 2ZQUA 2N87A 4DIPA 2XPAA 3O5KA 1GPFA 2LPVA 1CTNA 5B8IC 4G50A 1NMWA 1E15A 1QPFA 1R9HA 4L72B 2IUZA 4W9QA 3FXYA 4DRPA 2D9FA 2KI3A 2XP7A 2PPPA 2KO7A 3EIPA 4ODLA 4W9PA 4IPXA 4HBOA 3WQWA 4W9OA 2DPEA 1B6CA 2ZQVA 1JCHB 3O5QA 1NMVA 4MGVA 3ARZA 3KACA 1E44A 1HJVA 1F8AB 3O5PA 4U85A 2B31A 3RGCA 3PRDA 1JVWA 3JYMA 5DITA 5HKGA 3ARYA 3B9EA 1EYMA 1FKHA 3O5MA 3KAGA 2DT0A 4ODOA 1W9UA 3CGNA 3RM8A 2DG4A 4Z2LA 1FKIA 1FKLA 1E6NA 1Q1CA 1E9LA 2EULA 1SYTA 1FAPA 1ZB5A 1FKDA 3RM9A 4QT2A 4DROA 1EIBA 4ODNA 1E6RA 2RUQA 1FFQA 1QZ2A 2AOSA 4TW7A 1WNOA 4O2TA 4ODQA 1UR8A 5D75A 5GPRA 3ODKA 3PR9A 5BXJA 1JNTA 3CGMA 1Q6UA 3GU0A 1H0IA 3B9DA 2XP5A 4WKAA 2XP9A 2WLZA 1OGGA 4LAVA 4QZVB 2MF9A 1WAWA 1J6YA 2JZVA 1EDQA 4FN2A 4NNRA 3CHCA 3GPKA 5I98A 2KGJA 2KFWA 4DRNA 2WLYA 2RQSA 4DRKA 3KAFA 2RUCA 1JNDA 3IK8A 3CHFA 1KT1A 1U79A 4WKFA 2RUDA 3LUOA 4UDMA 5HT1A 2PI6A 5DO2A 1K9TA 2KR7A 1HKJA 3AS3A 3WD2A 5DF0A 1ZBVA 2OLHA 3KADA 4ZPTR 4LAXA 3ALGA 4DRQA 4DZ3A 2PN0A 1EHNA 1F40A 1LG1A 1E6PA 3UI4A 3OOBA 1KT0A 4DRIA 1HKIA 3WD0A 3G6MA 4LAWA 1PINA 3MDYB 1FKTA 1N1AA 1JNSA 1W1PA 5HW6A 4ZPVR 4Q7NA 5HTGA 3KAIA 4DRJA 1OGBA 4Q22A 4WJXA 4TNSA 1H0GA 4DRHA 1O6IA
chains in the Genus database with same CATH topology
3KABA 1FD9A 3WKZA 2F21A 3KAHA 4TX0A 4IQ2A 3TC5A 3IHZA 1OWQA 4IQCA 2VN1A 1ROUA 4DT4A 2A3EA 1FFRA 3ALFA 4IT6A 4DWSA 1A7XA 1Q6IA 3UQBA 2PV3A 2DT3A 4MNJA 3RM4A 2LGOA 3I6CA 1W1VA 4Z2KA 2ZR5A 1LQ0A 3ARQA 1FKRA 4G2PA 2DT2A 1FJDA 1FKKA 3WIJA 1E6ZA 1D6OA 4DWSC 1LL7A 4MAVA 3IKDA 1BKFA 1NWSA 3B7XA 3PRBA 4L3NA 2LKNA 4DWSB 2F2DA 2Y78A 4DWSD 4QT3A 1FKSA 1D7HA 2ZR4A 1LJYA 4JYSA 4KR0B 2XP8A 4JFLA 4XAKA 1FKGA 2WK2A 1FKBA 1LL4A 4P8UA 4LGXA 4DRMA 2PV2A 5HUAA 2LJ4A 1EQ3A 3UF8A 1VF8A 1J4HA 3RFWA 2DSZA 1IX5A 4TYOA 2FKEA 1T11A 1LG2A 4TW6A 2ZR6A 3KZ7A 2Q5AA 3AROA 2ESCA 3WH0A 2A3AA 1D7JA 5HW8A 3W4RA 1ZBWA 4P8XA 3UQAA 2PPOA 3NTPA 5HWBA 2PPNA 4DH0A 4J4NA 2DG3A 1HKMA 3WL1A 1GOIA 1ZK6A 4GGQA 4IT4A 1D7IA 3NI6A 1NWTA 3ARRA 4HARA 3OA5A 4U84A 1TCOC 4QIBA 4MNMA 4Z2IA 3ARTA 3O5FA 1NSGA 1C9HA 2FAPA 3AS1A 3NRKA 3G6LA 2AWGA 1YW5A 4JFIA 3WL0A 4DZ2A 1QPLA 3VAWA 5HBFA 1X6LA 2G41A 2ZQTA 3UQIA 1LL6A 2O92A 2RSEA 5GPGA 1ZBCA 3CHDA 1HKKA 3ARWA 2DG9A 1L1PA 4S3JA 3WD4A 1YATA 3TCZA 4KQZA 4ML4A 1D2KA 3RMEA 3O5DA 4URIA 4LAYA 3UI6A 3IKGA 4WIWA 3EY6A 2IF4A 1WB0A 3O5JA 2FDMA 3O5IA 4WK9A 4W5UA 4P8WA 4NSBA 4N19A 4MPKA 1M5YA 4NZCA 3TDBA 2PV1A 4Z2GA 1J4RA 1ZU8A 3O5LA 5J6EA 1FKFA 1XHGA 4C02B 3O5OA 1KFWA 3ARVA 3UI5A 1UR9A 1ZBKA 1ZL1A 2DSWA 4AY1A 2PBCA 4PTMA 2K8IA 3FAPA 3O5EA 1JNEA 1XRVA 2UZ5A 4P8VA 5HWCA 2DSUA 3AS2A 4U86A 3O5GA 4WKHA 4HBEA 1FKJA 1TFVA 3O5RA 3BXWA 2DT1A 1GUVA 4J4OA 4TW8A 2ITKA 2QF8A 2KE0A 2MLZA 5DEZA 4ZS6A 1SR0A 2YBTA 1W1YA 2XP3A 2RURA 1BL4A 2XPBA 4MSPA 1NWUA 1Y0OA 2YBUA 2ZQSA 4R5EA 5JH8A 3ARUA 1W26A 3JXVA 3PA7A 3ARSA 2A3CA 1HJXA 3PRAA 3QOKA 1Q6HA 1HJWA 4GIVA 4JFKA 4ZPWR 1W9VA 2MPHA 3B9AA 4ODMA 1HXVA 1NWRA 4FAPA 4BF8A 3WD3A 3WQVA 5HW7A 1ROTA 2WM0A 2F4EA 5DIVA 3ARPA 2MLYA 2M1IA 2O9OA 1P5QA 5DIUA 2XP4A 4ODKA 2G8ZA 3WD1A 3FY1A 4R0XA 2MLXA 3CHEA 1W1TA 1ZCNA 2A3BA 1NH6A 2L2SA 3ARXA 4ODPA 4MNLA 3CZ8A 3B8SA 3JYJA 2MNTA 1RD6A 3AQUA 4JFJA 1ITXA 2DSVA 1PBKA 4ITZA 2XP6A 4MNKA 5GQBA 4S3KA 1W9PA 1X6NA 2VCDA 2OFNA 4ODRA 4Z2JA 1J4IA 3H9RB 4JFMA 2M08A 4MTVA 3AS0A 4Z2HA 3CH9A 3KCEA 2M2AA 2ZQUA 2N87A 4DIPA 2XPAA 3O5KA 1GPFA 2LPVA 1CTNA 5B8IC 4G50A 1NMWA 1E15A 1QPFA 1R9HA 4L72B 2IUZA 4W9QA 3FXYA 4DRPA 2D9FA 2KI3A 2XP7A 2PPPA 2KO7A 4ODLA 4W9PA 4IPXA 4HBOA 3WQWA 4W9OA 2DPEA 1B6CA 2ZQVA 3O5QA 1NMVA 4MGVA 3KACA 3ARZA 1HJVA 1F8AB 3O5PA 4U85A 2B31A 3RGCA 3PRDA 1JVWA 3JYMA 5DITA 5HKGA 3ARYA 3B9EA 1EYMA 1FKHA 3O5MA 3KAGA 2DT0A 4ODOA 1W9UA 3CGNA 3RM8A 2DG4A 4Z2LA 1FKIA 1FKLA 1E6NA 1Q1CA 1E9LA 1SYTA 1FAPA 1ZB5A 1FKDA 3RM9A 4QT2A 4DROA 1EIBA 4ODNA 1E6RA 2RUQA 1FFQA 1QZ2A 2AOSA 4TW7A 1WNOA 4O2TA 4ODQA 1UR8A 5D75A 5GPRA 3ODKA 3PR9A 5BXJA 1JNTA 3CGMA 1Q6UA 1H0IA 3B9DA 2XP5A 4WKAA 2XP9A 2WLZA 1OGGA 4LAVA 4QZVB 2MF9A 1WAWA 1J6YA 2JZVA 1EDQA 4FN2A 4NNRA 3CHCA 3GPKA 5I98A 2KGJA 2KFWA 4DRNA 2WLYA 2RQSA 4DRKA 3KAFA 2RUCA 1JNDA 3IK8A 3CHFA 1KT1A 1U79A 4WKFA 2RUDA 3LUOA 5HT1A 2PI6A 5DO2A 1K9TA 2KR7A 1HKJA 3AS3A 3WD2A 5DF0A 1ZBVA 2OLHA 3KADA 4ZPTR 4LAXA 3ALGA 4DRQA 4DZ3A 1EHNA 1F40A 1LG1A 1E6PA 3UI4A 3OOBA 1KT0A 4DRIA 1HKIA 3WD0A 3G6MA 4LAWA 1PINA 3MDYB 1FKTA 1N1AA 1JNSA 1W1PA 5HW6A 4ZPVR 4Q7NA 5HTGA 3KAIA 4DRJA 1OGBA 4Q22A 4WJXA 4TNSA 1H0GA 4DRHA 1O6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODM A;  3KAB A;  3O5F A;  1HXV A;  1FAP A;  1NSG A;  4BF8 A;  1C9H A;  1FD9 A;  2FAP A;  4FAP A;  3NRK A;  5HW7 A;  2F21 A;  1FKD A;  3KAH A;  1ROT A;  2AWG A;  4TX0 A;  2F4E A;  4IQ2 A;  3IHZ A;  4QT2 A;  4IQC A;  5DIV A;  2VN1 A;  3TC5 A;  1YW5 A;  4DRO A;  2MLY A;  1ROU A;  4JFI A;  4ODN A;  4DT4 A;  4DZ2 A;  1QPL A;  2RUQ A;  1QZ2 A;  4TW7 A;  3VAW A;  2M1I A;  2ZQT A;  4O2T A;  4ODQ A;  3UQI A;  5D75 A;  1P5Q A;  3ODK A;  1A7X A;  5DIU A;  2XP4 A;  1Q6I A;  2RSE A;  3UQB A;  4ODK A;  5BXJ A;  5GPG A;  2PV3 A;  2LGO A;  4R0X A;  2DG9 A;  1L1P A;  3I6C A;  2MLX A;  1YAT A;  3TCZ A;  1JNT A;  2ZR5 A;  3CGM A;  1Q6U A;  1FKR A;  1ZCN A;  2L2S A;  4G2P A;  4ODP A;  3O5D A;  1FJD A;  1FKK A;  4LAY A;  3UI6 A;  1D6O A;  3IKG A;  2XP5 A;  2XP9 A;  2IF4 A;  3EY6 A;  3O5J A;  3JYJ A;  3O5I A;  2MNT A;  3IKD A;  1BKF A;  3B7X A;  3PRB A;  4N19 A;  2LKN A;  4JFJ A;  2F2D A;  4LAV A;  2Y78 A;  2MF9 A;  4ITZ A;  1PBK A;  1M5Y A;  1FKS A;  2XP6 A;  4QT3 A;  1J6Y A;  1D7H A;  3TDB A;  2ZR4 A;  2PV1 A;  2JZV A;  1J4R A;  3O5L A;  4JYS A;  2XP8 A;  5J6E A;  4FN2 A;  2VCD A;  4NNR A;  4JFL A;  1FKF A;  1FKG A;  2OFN A;  3GPK A;  2KGJ A;  3O5O A;  4ODR A;  4C02 B;  2KFW A;  4DRN A;  3UI5 A;  5I98 A;  1FKB A;  1J4I A;  2RQS A;  3H9R B;  4DRK A;  3KAF A;  4JFM A;  2M08 A;  2MPH A;  4DRM A;  2PV2 A;  5HUA A;  2LJ4 A;  2RUC A;  1EQ3 A;  2PBC A;  3IK8 A;  2K8I A;  3FAP A;  3UF8 A;  3KCE A;  2M2A A;  2ZQU A;  2N87 A;  3O5E A;  4DIP A;  2XPA A;  1J4H A;  3RFW A;  2UZ5 A;  3O5K A;  5HWC A;  1KT1 A;  2LPV A;  4TYO A;  4U86 A;  3O5G A;  1U79 A;  1T11 A;  2FKE A;  4G50 A;  5B8I C;  1FKJ A;  2RUD A;  1NMW A;  3O5R A;  3LUO A;  1QPF A;  4TW6 A;  2ZR6 A;  1R9H A;  3KZ7 A;  5HT1 A;  4W9Q A;  2Q5A A;  4DRP A;  2D9F A;  2KI3 A;  3WH0 A;  2KR7 A;  2XP7 A;  2PPP A;  2KO7 A;  1D7J A;  4ODL A;  4J4O A;  4W9P A;  4IPX A;  5HW8 A;  4TW8 A;  3KAD A;  3UQA A;  4W9O A;  2PPO A;  2ITK A;  3NTP A;  5HWB A;  1B6C A;  4LAX A;  2KE0 A;  2ZQV A;  2PPN A;  2MLZ A;  3O5Q A;  4DRQ A;  4DH0 A;  4J4N A;  2DG3 A;  1NMV A;  2XP3 A;  2RUR A;  1BL4 A;  2XPB A;  3KAC A;  4MGV A;  4MSP A;  1Y0O A;  4DZ3 A;  1F8A B;  1ZK6 A;  2ZQS A;  4GGQ A;  1F40 A;  3O5P A;  4U85 A;  3UI4 A;  3OOB A;  1KT0 A;  4DRI A;  3RGC A;  1D7I A;  3PRD A;  1JVW A;  3JYM A;  5DIT A;  1W26 A;  5HKG A;  3JXV A;  3PA7 A;  4LAW A;  3NI6 A;  1PIN A;  1EYM A;  1FKH A;  3KAG A;  1FKT A;  1N1A A;  3MDY B;  3O5M A;  4ODO A;  4U84 A;  1JNS A;  3CGN A;  1Q6H A;  2DG4 A;  5HW6 A;  1TCO C;  5HTG A;  1FKI A;  4GIV A;  4JFK A;  4QIB A;  1FKL A;  3KAI A;  4DRJ A;  1Q1C A;  4TNS A;  4DRH A; 
#chains in the Genus database with same CATH topology
 3GTY X;  3KAB A;  1FD9 A;  3WKZ A;  2F21 A;  3KAH A;  4TX0 A;  4IQ2 A;  3TC5 A;  3IHZ A;  1OWQ A;  4IQC A;  2VN1 A;  1ROU A;  4DT4 A;  2A3E A;  1FFR A;  3ALF A;  4IT6 A;  4DWS A;  1A7X A;  1Q6I A;  3UQB A;  2PV3 A;  2DT3 A;  4MNJ A;  3RM4 A;  2LGO A;  3I6C A;  1W1V A;  4Z2K A;  2ZR5 A;  1LQ0 A;  3ARQ A;  1FKR A;  4G2P A;  2DT2 A;  1FJD A;  1FKK A;  3WIJ A;  1E6Z A;  2ETN A;  1D6O A;  4DWS C;  1LL7 A;  4MAV A;  3IKD A;  1BKF A;  1NWS A;  3B7X A;  3PRB A;  4L3N A;  2LKN A;  4DWS B;  2F2D A;  2Y78 A;  4DWS D;  4QT3 A;  1FKS A;  1D7H A;  2ZR4 A;  1LJY A;  4JYS A;  4KR0 B;  2XP8 A;  4JFL A;  4XAK A;  1FKG A;  2WK2 A;  1FKB A;  1LL4 A;  4P8U A;  4LGX A;  4DRM A;  2PV2 A;  5HUA A;  2LJ4 A;  1EQ3 A;  3UF8 A;  1VF8 A;  1J4H A;  3RFW A;  2DSZ A;  1IX5 A;  4TYO A;  2FKE A;  1T11 A;  1LG2 A;  4TW6 A;  2ZR6 A;  3KZ7 A;  2Q5A A;  3ARO A;  2ESC A;  3WH0 A;  2A3A A;  1D7J A;  5HW8 A;  3W4R A;  1ZBW A;  4P8X A;  3UQA A;  2PPO A;  3NTP A;  5HWB A;  2PPN A;  4DH0 A;  4J4N A;  2DG3 A;  1HKM A;  3WL1 A;  1GOI A;  1ZK6 A;  4GGQ A;  4IT4 A;  1D7I A;  3BMB A;  3NI6 A;  1NWT A;  3ARR A;  4HAR A;  3OA5 A;  4U84 A;  1TCO C;  4QIB A;  4MNM A;  4Z2I A;  3ART A;  3O5F A;  1NSG A;  1C9H A;  2FAP A;  3AS1 A;  3NRK A;  3G6L A;  2AWG A;  1YW5 A;  4JFI A;  3WL0 A;  4DZ2 A;  1QPL A;  3VAW A;  5HBF A;  1X6L A;  2G41 A;  2ZQT A;  3UQI A;  1LL6 A;  2O92 A;  2RSE A;  5GPG A;  1ZBC A;  3CHD A;  1HKK A;  3ARW A;  2DG9 A;  1L1P A;  4S3J A;  3WD4 A;  1YAT A;  3TCZ A;  4KQZ A;  4ML4 A;  1D2K A;  3RME A;  3O5D A;  4URI A;  4LAY A;  3UI6 A;  3IKG A;  4WIW A;  3EY6 A;  2IF4 A;  1WB0 A;  3O5J A;  2FDM A;  3O5I A;  4WK9 A;  4W5U A;  4P8W A;  4NSB A;  4N19 A;  4MPK A;  1M5Y A;  4NZC A;  2F23 A;  3TDB A;  2PV1 A;  4Z2G A;  1J4R A;  1ZU8 A;  3O5L A;  5J6E A;  1FKF A;  1XHG A;  4C02 B;  3O5O A;  1KFW A;  3ARV A;  3UI5 A;  1UR9 A;  2P4V A;  1GRJ A;  1ZBK A;  1ZL1 A;  2DSW A;  4AY1 A;  2PBC A;  4PTM A;  2K8I A;  3FAP A;  3O5E A;  1JNE A;  1XRV A;  2UZ5 A;  4P8V A;  5HWC A;  2DSU A;  3AS2 A;  4U86 A;  3O5G A;  4WKH A;  4HBE A;  1FKJ A;  1TFV A;  3O5R A;  3BXW A;  2DT1 A;  1GUV A;  4J4O A;  2B5U B;  4TW8 A;  2ITK A;  2QF8 A;  2KE0 A;  2MLZ A;  5DEZ A;  4ZS6 A;  1SR0 A;  2YBT A;  1W1Y A;  2XP3 A;  2RUR A;  1BL4 A;  2XPB A;  4MSP A;  1NWU A;  1Y0O A;  2YBU A;  2ZQS A;  4R5E A;  5JH8 A;  3ARU A;  1W26 A;  3JXV A;  3PA7 A;  3ARS A;  2A3C A;  1HJX A;  3PRA A;  3QOK A;  1Q6H A;  1HJW A;  4GIV A;  4JFK A;  4ZPW R;  1W9V A;  2MPH A;  3B9A A;  4ODM A;  1HXV A;  1NWR A;  4FAP A;  4BF8 A;  3WD3 A;  3WQV A;  5HW7 A;  1ROT A;  2WM0 A;  2F4E A;  5DIV A;  3ARP A;  2MLY A;  2M1I A;  2O9O A;  1P5Q A;  5DIU A;  2XP4 A;  4ODK A;  2G8Z A;  3WD1 A;  3FY1 A;  4R0X A;  2MLX A;  3CHE A;  1W1T A;  1ZCN A;  2A3B A;  1NH6 A;  2L2S A;  3ARX A;  4ODP A;  4MNL A;  3CZ8 A;  3B8S A;  3JYJ A;  2MNT A;  1RD6 A;  3AQU A;  4JFJ A;  1ITX A;  2DSV A;  1PBK A;  4ITZ A;  2XP6 A;  4MNK A;  5GQB A;  4S3K A;  1W9P A;  1X6N A;  2VCD A;  2OFN A;  4ODR A;  4Z2J A;  1J4I A;  3H9R B;  4JFM A;  2M08 A;  4MTV A;  3AS0 A;  4Z2H A;  3CH9 A;  3KCE A;  2M2A A;  2ZQU A;  2N87 A;  4DIP A;  2XPA A;  3O5K A;  1GPF A;  2LPV A;  1CTN A;  5B8I C;  4G50 A;  1NMW A;  1E15 A;  1QPF A;  1R9H A;  4L72 B;  2IUZ A;  4W9Q A;  3FXY A;  4DRP A;  2D9F A;  2KI3 A;  2XP7 A;  2PPP A;  2KO7 A;  3EIP A;  4ODL A;  4W9P A;  4IPX A;  4HBO A;  3WQW A;  4W9O A;  2DPE A;  1B6C A;  2ZQV A;  1JCH B;  3O5Q A;  1NMV A;  4MGV A;  3ARZ A;  3KAC A;  1E44 A;  1HJV A;  1F8A B;  3O5P A;  4U85 A;  2B31 A;  3RGC A;  3PRD A;  1JVW A;  3JYM A;  5DIT A;  5HKG A;  3ARY A;  3B9E A;  1EYM A;  1FKH A;  3O5M A;  3KAG A;  2DT0 A;  4ODO A;  1W9U A;  3CGN A;  3RM8 A;  2DG4 A;  4Z2L A;  1FKI A;  1FKL A;  1E6N A;  1Q1C A;  1E9L A;  2EUL A;  1SYT A;  1FAP A;  1ZB5 A;  1FKD A;  3RM9 A;  4QT2 A;  4DRO A;  1EIB A;  4ODN A;  1E6R A;  2RUQ A;  1FFQ A;  1QZ2 A;  2AOS A;  4TW7 A;  1WNO A;  4O2T A;  4ODQ A;  1UR8 A;  5D75 A;  5GPR A;  3ODK A;  3PR9 A;  5BXJ A;  1JNT A;  3CGM A;  1Q6U A;  3GU0 A;  1H0I A;  3B9D A;  2XP5 A;  4WKA A;  2XP9 A;  2WLZ A;  1OGG A;  4LAV A;  4QZV B;  2MF9 A;  1WAW A;  1J6Y A;  2JZV A;  1EDQ A;  4FN2 A;  4NNR A;  3CHC A;  3GPK A;  5I98 A;  2KGJ A;  2KFW A;  4DRN A;  2WLY A;  2RQS A;  4DRK A;  3KAF A;  2RUC A;  1JND A;  3IK8 A;  3CHF A;  1KT1 A;  1U79 A;  4WKF A;  2RUD A;  3LUO A;  4UDM A;  5HT1 A;  2PI6 A;  5DO2 A;  1K9T A;  2KR7 A;  1HKJ A;  3AS3 A;  3WD2 A;  5DF0 A;  1ZBV A;  2OLH A;  3KAD A;  4ZPT R;  4LAX A;  3ALG A;  4DRQ A;  4DZ3 A;  2PN0 A;  1EHN A;  1F40 A;  1LG1 A;  1E6P A;  3UI4 A;  3OOB A;  1KT0 A;  4DRI A;  1HKI A;  3WD0 A;  3G6M A;  4LAW A;  1PIN A;  3MDY B;  1FKT A;  1N1A A;  1JNS A;  1W1P A;  5HW6 A;  4ZPV R;  4Q7N A;  5HTG A;  3KAI A;  4DRJ A;  1OGB A;  4Q22 A;  4WJX A;  4TNS A;  1H0G A;  4DRH A;  1O6I A; 
#chains in the Genus database with same CATH homology
 3KAB A;  1FD9 A;  3WKZ A;  2F21 A;  3KAH A;  4TX0 A;  4IQ2 A;  3TC5 A;  3IHZ A;  1OWQ A;  4IQC A;  2VN1 A;  1ROU A;  4DT4 A;  2A3E A;  1FFR A;  3ALF A;  4IT6 A;  4DWS A;  1A7X A;  1Q6I A;  3UQB A;  2PV3 A;  2DT3 A;  4MNJ A;  3RM4 A;  2LGO A;  3I6C A;  1W1V A;  4Z2K A;  2ZR5 A;  1LQ0 A;  3ARQ A;  1FKR A;  4G2P A;  2DT2 A;  1FJD A;  1FKK A;  3WIJ A;  1E6Z A;  1D6O A;  4DWS C;  1LL7 A;  4MAV A;  3IKD A;  1BKF A;  1NWS A;  3B7X A;  3PRB A;  4L3N A;  2LKN A;  4DWS B;  2F2D A;  2Y78 A;  4DWS D;  4QT3 A;  1FKS A;  1D7H A;  2ZR4 A;  1LJY A;  4JYS A;  4KR0 B;  2XP8 A;  4JFL A;  4XAK A;  1FKG A;  2WK2 A;  1FKB A;  1LL4 A;  4P8U A;  4LGX A;  4DRM A;  2PV2 A;  5HUA A;  2LJ4 A;  1EQ3 A;  3UF8 A;  1VF8 A;  1J4H A;  3RFW A;  2DSZ A;  1IX5 A;  4TYO A;  2FKE A;  1T11 A;  1LG2 A;  4TW6 A;  2ZR6 A;  3KZ7 A;  2Q5A A;  3ARO A;  2ESC A;  3WH0 A;  2A3A A;  1D7J A;  5HW8 A;  3W4R A;  1ZBW A;  4P8X A;  3UQA A;  2PPO A;  3NTP A;  5HWB A;  2PPN A;  4DH0 A;  4J4N A;  2DG3 A;  1HKM A;  3WL1 A;  1GOI A;  1ZK6 A;  4GGQ A;  4IT4 A;  1D7I A;  3NI6 A;  1NWT A;  3ARR A;  4HAR A;  3OA5 A;  4U84 A;  1TCO C;  4QIB A;  4MNM A;  4Z2I A;  3ART A;  3O5F A;  1NSG A;  1C9H A;  2FAP A;  3AS1 A;  3NRK A;  3G6L A;  2AWG A;  1YW5 A;  4JFI A;  3WL0 A;  4DZ2 A;  1QPL A;  3VAW A;  5HBF A;  1X6L A;  2G41 A;  2ZQT A;  3UQI A;  1LL6 A;  2O92 A;  2RSE A;  5GPG A;  1ZBC A;  3CHD A;  1HKK A;  3ARW A;  2DG9 A;  1L1P A;  4S3J A;  3WD4 A;  1YAT A;  3TCZ A;  4KQZ A;  4ML4 A;  1D2K A;  3RME A;  3O5D A;  4URI A;  4LAY A;  3UI6 A;  3IKG A;  4WIW A;  3EY6 A;  2IF4 A;  1WB0 A;  3O5J A;  2FDM A;  3O5I A;  4WK9 A;  4W5U A;  4P8W A;  4NSB A;  4N19 A;  4MPK A;  1M5Y A;  4NZC A;  3TDB A;  2PV1 A;  4Z2G A;  1J4R A;  1ZU8 A;  3O5L A;  5J6E A;  1FKF A;  1XHG A;  4C02 B;  3O5O A;  1KFW A;  3ARV A;  3UI5 A;  1UR9 A;  1ZBK A;  1ZL1 A;  2DSW A;  4AY1 A;  2PBC A;  4PTM A;  2K8I A;  3FAP A;  3O5E A;  1JNE A;  1XRV A;  2UZ5 A;  4P8V A;  5HWC A;  2DSU A;  3AS2 A;  4U86 A;  3O5G A;  4WKH A;  4HBE A;  1FKJ A;  1TFV A;  3O5R A;  3BXW A;  2DT1 A;  1GUV A;  4J4O A;  4TW8 A;  2ITK A;  2QF8 A;  2KE0 A;  2MLZ A;  5DEZ A;  4ZS6 A;  1SR0 A;  2YBT A;  1W1Y A;  2XP3 A;  2RUR A;  1BL4 A;  2XPB A;  4MSP A;  1NWU A;  1Y0O A;  2YBU A;  2ZQS A;  4R5E A;  5JH8 A;  3ARU A;  1W26 A;  3JXV A;  3PA7 A;  3ARS A;  2A3C A;  1HJX A;  3PRA A;  3QOK A;  1Q6H A;  1HJW A;  4GIV A;  4JFK A;  4ZPW R;  1W9V A;  2MPH A;  3B9A A;  4ODM A;  1HXV A;  1NWR A;  4FAP A;  4BF8 A;  3WD3 A;  3WQV A;  5HW7 A;  1ROT A;  2WM0 A;  2F4E A;  5DIV A;  3ARP A;  2MLY A;  2M1I A;  2O9O A;  1P5Q A;  5DIU A;  2XP4 A;  4ODK A;  2G8Z A;  3WD1 A;  3FY1 A;  4R0X A;  2MLX A;  3CHE A;  1W1T A;  1ZCN A;  2A3B A;  1NH6 A;  2L2S A;  3ARX A;  4ODP A;  4MNL A;  3CZ8 A;  3B8S A;  3JYJ A;  2MNT A;  1RD6 A;  3AQU A;  4JFJ A;  1ITX A;  2DSV A;  1PBK A;  4ITZ A;  2XP6 A;  4MNK A;  5GQB A;  4S3K A;  1W9P A;  1X6N A;  2VCD A;  2OFN A;  4ODR A;  4Z2J A;  1J4I A;  3H9R B;  4JFM A;  2M08 A;  4MTV A;  3AS0 A;  4Z2H A;  3CH9 A;  3KCE A;  2M2A A;  2ZQU A;  2N87 A;  4DIP A;  2XPA A;  3O5K A;  1GPF A;  2LPV A;  1CTN A;  5B8I C;  4G50 A;  1NMW A;  1E15 A;  1QPF A;  1R9H A;  4L72 B;  2IUZ A;  4W9Q A;  3FXY A;  4DRP A;  2D9F A;  2KI3 A;  2XP7 A;  2PPP A;  2KO7 A;  4ODL A;  4W9P A;  4IPX A;  4HBO A;  3WQW A;  4W9O A;  2DPE A;  1B6C A;  2ZQV A;  3O5Q A;  1NMV A;  4MGV A;  3KAC A;  3ARZ A;  1HJV A;  1F8A B;  3O5P A;  4U85 A;  2B31 A;  3RGC A;  3PRD A;  1JVW A;  3JYM A;  5DIT A;  5HKG A;  3ARY A;  3B9E A;  1EYM A;  1FKH A;  3O5M A;  3KAG A;  2DT0 A;  4ODO A;  1W9U A;  3CGN A;  3RM8 A;  2DG4 A;  4Z2L A;  1FKI A;  1FKL A;  1E6N A;  1Q1C A;  1E9L A;  1SYT A;  1FAP A;  1ZB5 A;  1FKD A;  3RM9 A;  4QT2 A;  4DRO A;  1EIB A;  4ODN A;  1E6R A;  2RUQ A;  1FFQ A;  1QZ2 A;  2AOS A;  4TW7 A;  1WNO A;  4O2T A;  4ODQ A;  1UR8 A;  5D75 A;  5GPR A;  3ODK A;  3PR9 A;  5BXJ A;  1JNT A;  3CGM A;  1Q6U A;  1H0I A;  3B9D A;  2XP5 A;  4WKA A;  2XP9 A;  2WLZ A;  1OGG A;  4LAV A;  4QZV B;  2MF9 A;  1WAW A;  1J6Y A;  2JZV A;  1EDQ A;  4FN2 A;  4NNR A;  3CHC A;  3GPK A;  5I98 A;  2KGJ A;  2KFW A;  4DRN A;  2WLY A;  2RQS A;  4DRK A;  3KAF A;  2RUC A;  1JND A;  3IK8 A;  3CHF A;  1KT1 A;  1U79 A;  4WKF A;  2RUD A;  3LUO A;  5HT1 A;  2PI6 A;  5DO2 A;  1K9T A;  2KR7 A;  1HKJ A;  3AS3 A;  3WD2 A;  5DF0 A;  1ZBV A;  2OLH A;  3KAD A;  4ZPT R;  4LAX A;  3ALG A;  4DRQ A;  4DZ3 A;  1EHN A;  1F40 A;  1LG1 A;  1E6P A;  3UI4 A;  3OOB A;  1KT0 A;  4DRI A;  1HKI A;  3WD0 A;  3G6M A;  4LAW A;  1PIN A;  3MDY B;  1FKT A;  1N1A A;  1JNS A;  1W1P A;  5HW6 A;  4ZPV R;  4Q7N A;  5HTG A;  3KAI A;  4DRJ A;  1OGB A;  4Q22 A;  4WJX A;  4TNS A;  1H0G A;  4DRH A;  1O6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...