5HWCA

Aspergillus fumigatus fkbp12 p90g protein bound with fk506 in p212121 space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
HMGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPGVIPGNSTLIFEVELLGINNKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
total genus 30
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hwcA00
1FKJA 2FAPA 3KACA 2LGOA 3NRKA 5D75A 2KO7A 2F4EA 1KT1A 2MPHA 4TNSA 1PINA 2PBCA 4BF8A 5HWBA 4ODRA 1J4RA 3H9RB 2XP4A 4MGVA 2XPAA 2LPVA 4O2TA 1EYMA 5DIUA 1T11A 4U85A 3KAGA 2MLYA 3O5DA 2PPNA 1QZ2A 4ODPA 4JFIA 3RGCA 2RUDA 3CGMA 3JXVA 2ZR6A 2PV3A 4J4NA 2VN1A 2UZ5A 4DT4A 5HW7A 4ODNA 2N87A 4U84A 1JVWA 4QT2A 1BL4A 4IPXA 2DG9A 4NNRA 3NTPA 4ODQA 2XP7A 3O5FA 1FKDA 4DRNA 2M1IA 4FAPA 4GIVA 4LAYA 1Q1CA 1FKLA 4ITZA 5GPGA 4G50A 3FAPA 1R9HA 4DROA 3CGNA 1PBKA 4DRQA 1BKFA 3JYJA 3O5OA 3PRDA 3UI4A 1W26A 1KT0A 3KAIA 2XP5A 3IHZA 2Q5AA 2DG4A 1NSGA 5HKGA 4R0XA 2RURA 1Q6HA 3O5JA 4MSPA 4JFKA 2IF4A 4JFJA 1M5YA 5B8IC 2Y78A 2XPBA 3KAFA 3O5KA 3EY6A 1QPFA 2F2DA 5BXJA 4TW6A 2OFNA 1B6CA 5DIVA 1HXVA 1ZK6A 3UQIA 4FN2A 3TC5A 1FKGA 2DG3A 2PPOA 3B7XA 3UQAA 2L2SA 3O5IA 1YATA 4JYSA 2ZR4A 3UQBA 4LAXA 4DRJA 3O5GA 4DRKA 2XP3A 3ODKA 4IQCA 2XP6A 3OOBA 1L1PA 5DITA 3KAHA 1FKTA 2KGJA 1FAPA 2LJ4A 3KADA 3RFWA 3LUOA 3IKDA 2RQSA 3VAWA 1ZCNA 5I98A 3O5RA 4ODOA 1JNTA 4N19A 1NMVA 2AWGA 4TW7A 2K8IA 3JYMA 5HUAA 1F40A 1JNSA 4JFMA 1N1AA 2KI3A 2PPPA 3NI6A 3O5QA 2RSEA 4W9OA 3O5MA 1J6YA 2M2AA 5HTGA 4LAVA 4IQ2A 1ROUA 1Y0OA 3O5LA 1FJDA 4DZ2A 5HWCA 3O5PA 2XP9A 5J6EA 1J4IA 2PV2A 2MF9A 5HT1A 3GPKA 1A7XA 4C02B 3KCEA 3UF8A 1FKSA 1J4HA 4J4OA 1FKHA 1Q6UA 2ZQTA 2ITKA 2KFWA 2XP8A 2RUCA 1FD9A 1TCOC 3KABA 3MDYB 4DRMA 1FKFA 1QPLA 2ZQUA 2ZQVA 4ODMA 4U86A 5HW8A 3UI6A 1FKIA 4ODKA 2F21A 1EQ3A 3TCZA 4DRHA 4TYOA 4LAWA 1D7HA 3TDBA 2MLZA 4W9PA 1FKRA 2M08A 1D7JA 1C9HA 2MLXA 2PV1A 1NMWA 2FKEA 4ODLA 4DRPA 2ZR5A 4JFLA 4DZ3A 2ZQSA 1D6OA 3O5EA 2RUQA 1F8AB 4DH0A 1FKBA 3I6CA 1D7IA 2VCDA 4W9QA 3WH0A 2JZVA 4GGQA 2MNTA 3UI5A 1FKKA 3KZ7A 4DRIA 4G2PA 4TX0A 4QT3A 1U79A 3PA7A 5HW6A 1ROTA 2KR7A 4DIPA 1Q6IA 3PRBA 2KE0A 1P5QA 2LKNA 3IKGA 2D9FA 1YW5A 4QIBA 4TW8A 3IK8A
chains in the Genus database with same CATH superfamily
2G41A 1FKJA 2DPEA 2LGOA 5HWBA 2PBCA 3H9RB 1OWQA 4O2TA 1EYMA 1E44A 1T11A 1EDQA 1LJYA 4DWSA 1GOIA 2WLYA 2PPNA 1QZ2A 1X6LA 4ODPA 2RUDA 3CGMA 1E6PA 2UZ5A 4DT4A 3EIPA 5HW7A 4NNRA 5DF0A 2XP7A 1LQ0A 2M1IA 3ALGA 1W1VA 1Q1CA 1FKLA 1ITXA 1E9LA 3CHCA 4ITZA 5GPGA 1R9HA 1KFWA 2DG4A 1NSGA 3B9AA 3CH9A 4MNJA 4R0XA 2EULA 4JFKA 4AY1A 5BXJA 2OFNA 4WKHA 4S3JA 1LL4A 3UQIA 4Z2JA 1GUVA 3UQAA 3B9EA 2A3CA 1YATA 4JYSA 3FY1A 3O5GA 3ARSA 2OLHA 3WD0A 2YBUA 3KAHA 1VF8A 2LJ4A 1JNDA 1H0GA 3ARWA 1HKKA 2PN0A 3IKDA 1ZBVA 5I98A 5HUAA 4Z2IA 4S3KA 4JFMA 3ARVA 3NI6A 2PPPA 3O5QA 4HBOA 4P8XA 4IQ2A 1ROUA 4Z2GA 4DZ2A 5HWCA 1WB0A 1FKSA 1E15A 3CHEA 4LAVA 2ITKA 4UDMA 3MDYB 3KABA 2ZQUA 2ZQVA 4ZPWR 2F21A 4IT4A 1HKIA 1D7JA 2B31A 2WK2A 3CHFA 3G6MA 3ARQA 1F8AB 4DH0A 1FKBA 2MNTA 3KZ7A 1U79A 1Q6IA 2D9FA 4WJXA 5GQBA 2O92A 4GIVA 2FAPA 4TNSA 1KT1A 2WLZA 4ODRA 1NH6A 3RM4A 4MGVA 1FFQA 2MLYA 1NWSA 4JFIA 4MPKA 2ZR6A 2VN1A 4ODNA 2N87A 2AOSA 4QT2A 4IPXA 4NZCA 3O5FA 3FAPA 4KQZA 1PBKA 2P4VA 1W26A 1GPFA 1KT0A 3IHZA 5DEZA 5HBFA 4PTMA 2XPBA 1H0IA 1HKJA 1QPFA 2F2DA 4TW6A 4P8UA 2PI6A 2DG3A 2DT2A 1SR0A 5DO2A 3ARUA 3AS1A 4LAXA 2A3EA 4DRJA 4DRKA 2XP6A 1L1PA 5DITA 4Z2HA 3VAWA 3AROA 4ODOA 1RD6A 2AWGA 1ZBWA 3AS2A 2QF8A 1E6ZA 1JNSA 2KI3A 4W9OA 1JNEA 3G6LA 2M2AA 2DT3A 3ARYA 5GPRA 2DSWA 4HARA 3GPKA 1O6IA 1SYTA 4J4OA 4HBEA 2ZQTA 3ARRA 2KFWA 1GRJA 1FD9A 1W9PA 1TFVA 1FKFA 1QPLA 4ODMA 4U86A 1W9VA 3ARPA 2G8ZA 2DSZA 3BMBA 3OA5A 2ETNA 1WNOA 4W9PA 2M08A 1C9HA 2PV1A 2FKEA 2ZR5A 3O5EA 2RUQA 3AS0A 5JH8A 2VCDA 1FKKA 1NWUA 4KR0B 4DWSC 2KR7A 1X6NA 3PRBA 1P5QA 2LKNA 3IKGA 1YW5A 4P8WA 3KACA 3NRKA 5D75A 2KO7A 2F4EA 2MPHA 1ZU8A 2XP4A 2LPVA 1W1PA 5DIUA 4U85A 4LGXA 2DT1A 4WIWA 2IUZA 3RGCA 3WD1A 4P8VA 1EIBA 2DSVA 4U84A 1JVWA 1HJXA 4ODQA 2DG9A 1FKDA 4DRNA 1NWRA 3GU0A 4DRQA 1BKFA 3JYJA 3O5OA 3KAIA 1K9TA 1Q6HA 4MSPA 4DWSD 4JFJA 5B8IC 2Y78A 1B6CA 5DIVA 1HXVA 1ZK6A 4ZPTR 3ARTA 3TC5A 3WL0A 3ARZA 2PPOA 1HJVA 3O5IA 2ZR4A 3UQBA 4ML4A 1JCHB 2XP3A 3ODKA 4IQCA 3WD4A 3OOBA 4L3NA 2KGJA 3KADA 3RFWA 1UR8A 3LUOA 3B9DA 4URIA 4N19A 1N1AA 4QZVB 2B5UB 1LG2A 1J6YA 5HTGA 3FXYA 3O5LA 1Y0OA 3AQUA 1FJDA 4MNKA 2DT0A 1J4IA 2MF9A 5HT1A 4C02B 3UF8A 1ZL1A 1J4HA 1FKHA 1WAWA 4DRMA 2RUCA 1TCOC 1LG1A 1FKIA 4ODKA 1EQ3A 4DRHA 4TYOA 4LAWA 1D7HA 3WKZA 2WM0A 4ZS6A 3QOKA 3WQWA 3AS3A 3RM8A 2DSUA 4W5UA 2F23A 4DZ3A 1FFRA 1D6OA 1D7IA 4W9QA 4WKFA 3WH0A 2JZVA 4GGQA 3UI5A 4TX0A 4QT3A 3BXWA 3PA7A 1ROTA 2KE0A 4QIBA 3ARXA 3W4RA 3IK8A 1XHGA 1E6NA 3WIJA 1CTNA 4BF8A 3RMEA 1PINA 1IX5A 1J4RA 2XPAA 3KAGA 3O5DA 4Z2LA 2A3BA 3JXVA 2PV3A 4J4NA 1W1YA 1XRVA 4L72B 1BL4A 3NTPA 1OGGA 4MNMA 4FAPA 4LAYA 3ALFA 4G50A 4DROA 3CGNA 3WL1A 3UI4A 1W9UA 3PRDA 4IT6A 2XP5A 2Q5AA 1HJWA 3RM9A 5HKGA 2RURA 3O5JA 3B8SA 4ZPVR 2IF4A 1M5YA 4Q22A 4NSBA 3KAFA 3O5KA 1LL7A 1UR9A 3EY6A 4MAVA 1D2KA 4DWSB 3WD3A 4FN2A 1NWTA 2O9OA 2ESCA 4XAKA 1FKGA 3B7XA 2L2SA 3CZ8A 3PRAA 4R5EA 4MNLA 3WD2A 3CHDA 1FKTA 1FAPA 1LL6A 1ZBCA 2RQSA 1ZCNA 3O5RA 1F40A 1JNTA 1HKMA 1NMVA 4TW7A 2K8IA 3JYMA 2RSEA 1E6RA 3O5MA 1W1TA 1ZBKA 3PR9A 3O5PA 2XP9A 5J6EA 2A3AA 2PV2A 3WQVA 4Q7NA 1A7XA 3KCEA 4MTVA 1Q6UA 2XP8A 1EHNA 5HW8A 3UI6A 3TCZA 3TDBA 2MLZA 4WKAA 1FKRA 2MLXA 4ODLA 1NMWA 4DRPA 4JFLA 2ZQSA 4Z2KA 2YBTA 3I6CA 4DRIA 1OGBA 4WK9A 4G2PA 2FDMA 5HW6A 3GTYX 4DIPA 4TW8A 1ZB5A
chains in the Genus database with same CATH topology
2G41A 1FKJA 2DPEA 2LGOA 5HWBA 2PBCA 3H9RB 1OWQA 4O2TA 1EYMA 1T11A 1EDQA 1LJYA 4DWSA 1GOIA 2WLYA 2PPNA 1QZ2A 1X6LA 4ODPA 2RUDA 3CGMA 1E6PA 2UZ5A 4DT4A 5HW7A 4NNRA 5DF0A 2XP7A 1LQ0A 2M1IA 3ALGA 1W1VA 1Q1CA 1FKLA 1ITXA 1E9LA 3CHCA 4ITZA 5GPGA 1R9HA 1KFWA 2DG4A 1NSGA 3B9AA 3CH9A 4MNJA 4R0XA 4JFKA 4AY1A 5BXJA 2OFNA 4WKHA 4S3JA 1LL4A 3UQIA 4Z2JA 1GUVA 3UQAA 3B9EA 2A3CA 1YATA 4JYSA 3FY1A 3O5GA 3ARSA 2OLHA 3WD0A 2YBUA 3KAHA 1VF8A 2LJ4A 1JNDA 1H0GA 3ARWA 1HKKA 3IKDA 1ZBVA 5I98A 5HUAA 4Z2IA 4S3KA 4JFMA 3ARVA 3NI6A 2PPPA 3O5QA 4HBOA 4P8XA 4IQ2A 1ROUA 4Z2GA 4DZ2A 5HWCA 1WB0A 1FKSA 1E15A 3CHEA 4LAVA 2ITKA 3MDYB 3KABA 2ZQUA 2ZQVA 4ZPWR 2F21A 4IT4A 1HKIA 1D7JA 2B31A 2WK2A 3CHFA 3G6MA 3ARQA 1F8AB 4DH0A 1FKBA 2MNTA 3KZ7A 1U79A 1Q6IA 2D9FA 4WJXA 5GQBA 2O92A 4GIVA 2FAPA 4TNSA 1KT1A 2WLZA 4ODRA 1NH6A 3RM4A 4MGVA 1FFQA 2MLYA 1NWSA 4JFIA 4MPKA 2ZR6A 2VN1A 4ODNA 2N87A 2AOSA 4QT2A 4IPXA 4NZCA 3O5FA 3FAPA 4KQZA 1PBKA 1W26A 1GPFA 1KT0A 3IHZA 5DEZA 5HBFA 4PTMA 2XPBA 1H0IA 1HKJA 1QPFA 2F2DA 4TW6A 4P8UA 2PI6A 2DG3A 2DT2A 1SR0A 5DO2A 3ARUA 3AS1A 4LAXA 2A3EA 4DRJA 4DRKA 2XP6A 1L1PA 5DITA 4Z2HA 3VAWA 3AROA 4ODOA 1RD6A 2AWGA 1ZBWA 3AS2A 2QF8A 1E6ZA 1JNSA 2KI3A 4W9OA 1JNEA 3G6LA 2M2AA 2DT3A 3ARYA 5GPRA 2DSWA 4HARA 3GPKA 1O6IA 1SYTA 4J4OA 4HBEA 2ZQTA 3ARRA 2KFWA 1FD9A 1W9PA 1TFVA 1FKFA 1QPLA 4ODMA 4U86A 1W9VA 3ARPA 2G8ZA 2DSZA 3OA5A 1WNOA 4W9PA 2M08A 1C9HA 2PV1A 2FKEA 2ZR5A 3O5EA 2RUQA 3AS0A 5JH8A 2VCDA 1FKKA 1NWUA 4KR0B 4DWSC 2KR7A 1X6NA 3PRBA 1P5QA 2LKNA 3IKGA 1YW5A 4P8WA 3KACA 3NRKA 5D75A 2KO7A 2F4EA 2MPHA 1ZU8A 2XP4A 2LPVA 1W1PA 5DIUA 4U85A 4LGXA 2DT1A 4WIWA 2IUZA 3RGCA 3WD1A 4P8VA 1EIBA 2DSVA 4U84A 1JVWA 1HJXA 4ODQA 2DG9A 1FKDA 4DRNA 1NWRA 4DRQA 1BKFA 3JYJA 3O5OA 3KAIA 1K9TA 1Q6HA 4MSPA 4DWSD 4JFJA 5B8IC 2Y78A 1B6CA 5DIVA 1HXVA 1ZK6A 4ZPTR 3ARTA 3TC5A 3WL0A 3ARZA 2PPOA 1HJVA 3O5IA 2ZR4A 3UQBA 4ML4A 2XP3A 3ODKA 4IQCA 3WD4A 3OOBA 4L3NA 2KGJA 3KADA 3RFWA 1UR8A 3LUOA 3B9DA 4URIA 4N19A 1N1AA 4QZVB 1LG2A 1J6YA 5HTGA 3FXYA 3O5LA 1Y0OA 3AQUA 1FJDA 4MNKA 2DT0A 1J4IA 2MF9A 5HT1A 4C02B 3UF8A 1ZL1A 1J4HA 1FKHA 1WAWA 4DRMA 2RUCA 1TCOC 1LG1A 1FKIA 4ODKA 1EQ3A 4DRHA 4TYOA 4LAWA 1D7HA 3WKZA 2WM0A 4ZS6A 3QOKA 3WQWA 3AS3A 3RM8A 2DSUA 4W5UA 4DZ3A 1FFRA 1D6OA 1D7IA 4W9QA 4WKFA 3WH0A 2JZVA 4GGQA 3UI5A 4TX0A 4QT3A 3BXWA 3PA7A 1ROTA 2KE0A 4QIBA 3ARXA 3W4RA 3IK8A 1XHGA 1E6NA 3WIJA 1CTNA 4BF8A 3RMEA 1PINA 1IX5A 1J4RA 2XPAA 3KAGA 3O5DA 4Z2LA 2A3BA 3JXVA 2PV3A 4J4NA 1W1YA 1XRVA 4L72B 1BL4A 3NTPA 1OGGA 4MNMA 4FAPA 4LAYA 3ALFA 4G50A 4DROA 3CGNA 3WL1A 3UI4A 1W9UA 3PRDA 4IT6A 2XP5A 2Q5AA 1HJWA 3RM9A 5HKGA 2RURA 3O5JA 3B8SA 4ZPVR 2IF4A 1M5YA 4Q22A 4NSBA 3KAFA 3O5KA 1LL7A 1UR9A 3EY6A 4MAVA 1D2KA 4DWSB 3WD3A 4FN2A 1NWTA 2O9OA 2ESCA 4XAKA 1FKGA 3B7XA 2L2SA 3CZ8A 3PRAA 4R5EA 4MNLA 3WD2A 3CHDA 1FKTA 1FAPA 1LL6A 1ZBCA 2RQSA 1ZCNA 3O5RA 1F40A 1JNTA 1HKMA 1NMVA 4TW7A 2K8IA 3JYMA 2RSEA 1E6RA 3O5MA 1W1TA 1ZBKA 3PR9A 3O5PA 2XP9A 5J6EA 2A3AA 2PV2A 3WQVA 4Q7NA 1A7XA 3KCEA 4MTVA 1Q6UA 2XP8A 1EHNA 5HW8A 3UI6A 3TCZA 3TDBA 2MLZA 4WKAA 1FKRA 2MLXA 4ODLA 1NMWA 4DRPA 4JFLA 2ZQSA 4Z2KA 2YBTA 3I6CA 4DRIA 1OGBA 4WK9A 4G2PA 2FDMA 5HW6A 4DIPA 4TW8A 1ZB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKJ A;  2FAP A;  3KAC A;  2LGO A;  3NRK A;  5D75 A;  2KO7 A;  2F4E A;  1KT1 A;  2MPH A;  4TNS A;  1PIN A;  2PBC A;  4BF8 A;  5HWB A;  4ODR A;  1J4R A;  3H9R B;  2XP4 A;  4MGV A;  2XPA A;  2LPV A;  4O2T A;  1EYM A;  5DIU A;  1T11 A;  4U85 A;  3KAG A;  2MLY A;  3O5D A;  2PPN A;  1QZ2 A;  4ODP A;  4JFI A;  3RGC A;  2RUD A;  3CGM A;  3JXV A;  2ZR6 A;  2PV3 A;  4J4N A;  2VN1 A;  2UZ5 A;  4DT4 A;  5HW7 A;  4ODN A;  2N87 A;  4U84 A;  1JVW A;  4QT2 A;  1BL4 A;  4IPX A;  2DG9 A;  4NNR A;  3NTP A;  4ODQ A;  2XP7 A;  3O5F A;  1FKD A;  4DRN A;  2M1I A;  4FAP A;  4GIV A;  4LAY A;  1Q1C A;  1FKL A;  4ITZ A;  5GPG A;  4G50 A;  3FAP A;  1R9H A;  4DRO A;  3CGN A;  1PBK A;  4DRQ A;  1BKF A;  3JYJ A;  3O5O A;  3PRD A;  3UI4 A;  1W26 A;  1KT0 A;  3KAI A;  2XP5 A;  3IHZ A;  2Q5A A;  2DG4 A;  1NSG A;  5HKG A;  4R0X A;  2RUR A;  1Q6H A;  3O5J A;  4MSP A;  4JFK A;  2IF4 A;  4JFJ A;  1M5Y A;  5B8I C;  2Y78 A;  2XPB A;  3KAF A;  3O5K A;  3EY6 A;  1QPF A;  2F2D A;  5BXJ A;  4TW6 A;  2OFN A;  1B6C A;  5DIV A;  1HXV A;  1ZK6 A;  3UQI A;  4FN2 A;  3TC5 A;  1FKG A;  2DG3 A;  2PPO A;  3B7X A;  3UQA A;  2L2S A;  3O5I A;  1YAT A;  4JYS A;  2ZR4 A;  3UQB A;  4LAX A;  4DRJ A;  3O5G A;  4DRK A;  2XP3 A;  3ODK A;  4IQC A;  2XP6 A;  3OOB A;  1L1P A;  5DIT A;  3KAH A;  1FKT A;  2KGJ A;  1FAP A;  2LJ4 A;  3KAD A;  3RFW A;  3LUO A;  3IKD A;  2RQS A;  3VAW A;  1ZCN A;  5I98 A;  3O5R A;  4ODO A;  1JNT A;  4N19 A;  1NMV A;  2AWG A;  4TW7 A;  2K8I A;  3JYM A;  5HUA A;  1F40 A;  1JNS A;  4JFM A;  1N1A A;  2KI3 A;  2PPP A;  3NI6 A;  3O5Q A;  2RSE A;  4W9O A;  3O5M A;  1J6Y A;  2M2A A;  5HTG A;  4LAV A;  4IQ2 A;  1ROU A;  1Y0O A;  3O5L A;  1FJD A;  4DZ2 A;  5HWC A;  3O5P A;  2XP9 A;  5J6E A;  1J4I A;  2PV2 A;  2MF9 A;  5HT1 A;  3GPK A;  1A7X A;  4C02 B;  3KCE A;  3UF8 A;  1FKS A;  1J4H A;  4J4O A;  1FKH A;  1Q6U A;  2ZQT A;  2ITK A;  2KFW A;  2XP8 A;  2RUC A;  1FD9 A;  1TCO C;  3KAB A;  3MDY B;  4DRM A;  1FKF A;  1QPL A;  2ZQU A;  2ZQV A;  4ODM A;  4U86 A;  5HW8 A;  3UI6 A;  1FKI A;  4ODK A;  2F21 A;  1EQ3 A;  3TCZ A;  4DRH A;  4TYO A;  4LAW A;  1D7H A;  3TDB A;  2MLZ A;  4W9P A;  1FKR A;  2M08 A;  1D7J A;  1C9H A;  2MLX A;  2PV1 A;  1NMW A;  2FKE A;  4ODL A;  4DRP A;  2ZR5 A;  4JFL A;  4DZ3 A;  2ZQS A;  1D6O A;  3O5E A;  2RUQ A;  1F8A B;  4DH0 A;  1FKB A;  3I6C A;  1D7I A;  2VCD A;  4W9Q A;  3WH0 A;  2JZV A;  4GGQ A;  2MNT A;  3UI5 A;  1FKK A;  3KZ7 A;  4DRI A;  4G2P A;  4TX0 A;  4QT3 A;  1U79 A;  3PA7 A;  5HW6 A;  1ROT A;  2KR7 A;  4DIP A;  1Q6I A;  3PRB A;  2KE0 A;  1P5Q A;  2LKN A;  3IKG A;  2D9F A;  1YW5 A;  4QIB A;  4TW8 A;  3IK8 A; 
#chains in the Genus database with same CATH topology
 2G41 A;  1FKJ A;  2DPE A;  2LGO A;  5HWB A;  2PBC A;  3H9R B;  1OWQ A;  4O2T A;  1EYM A;  1E44 A;  1T11 A;  1EDQ A;  1LJY A;  4DWS A;  1GOI A;  2WLY A;  2PPN A;  1QZ2 A;  1X6L A;  4ODP A;  2RUD A;  3CGM A;  1E6P A;  2UZ5 A;  4DT4 A;  3EIP A;  5HW7 A;  4NNR A;  5DF0 A;  2XP7 A;  1LQ0 A;  2M1I A;  3ALG A;  1W1V A;  1Q1C A;  1FKL A;  1ITX A;  1E9L A;  3CHC A;  4ITZ A;  5GPG A;  1R9H A;  1KFW A;  2DG4 A;  1NSG A;  3B9A A;  3CH9 A;  4MNJ A;  4R0X A;  2EUL A;  4JFK A;  4AY1 A;  5BXJ A;  2OFN A;  4WKH A;  4S3J A;  1LL4 A;  3UQI A;  4Z2J A;  1GUV A;  3UQA A;  3B9E A;  2A3C A;  1YAT A;  4JYS A;  3FY1 A;  3O5G A;  3ARS A;  2OLH A;  3WD0 A;  2YBU A;  3KAH A;  1VF8 A;  2LJ4 A;  1JND A;  1H0G A;  3ARW A;  1HKK A;  2PN0 A;  3IKD A;  1ZBV A;  5I98 A;  5HUA A;  4Z2I A;  4S3K A;  4JFM A;  3ARV A;  3NI6 A;  2PPP A;  3O5Q A;  4HBO A;  4P8X A;  4IQ2 A;  1ROU A;  4Z2G A;  4DZ2 A;  5HWC A;  1WB0 A;  1FKS A;  1E15 A;  3CHE A;  4LAV A;  2ITK A;  4UDM A;  3MDY B;  3KAB A;  2ZQU A;  2ZQV A;  4ZPW R;  2F21 A;  4IT4 A;  1HKI A;  1D7J A;  2B31 A;  2WK2 A;  3CHF A;  3G6M A;  3ARQ A;  1F8A B;  4DH0 A;  1FKB A;  2MNT A;  3KZ7 A;  1U79 A;  1Q6I A;  2D9F A;  4WJX A;  5GQB A;  2O92 A;  4GIV A;  2FAP A;  4TNS A;  1KT1 A;  2WLZ A;  4ODR A;  1NH6 A;  3RM4 A;  4MGV A;  1FFQ A;  2MLY A;  1NWS A;  4JFI A;  4MPK A;  2ZR6 A;  2VN1 A;  4ODN A;  2N87 A;  2AOS A;  4QT2 A;  4IPX A;  4NZC A;  3O5F A;  3FAP A;  4KQZ A;  1PBK A;  2P4V A;  1W26 A;  1GPF A;  1KT0 A;  3IHZ A;  5DEZ A;  5HBF A;  4PTM A;  2XPB A;  1H0I A;  1HKJ A;  1QPF A;  2F2D A;  4TW6 A;  4P8U A;  2PI6 A;  2DG3 A;  2DT2 A;  1SR0 A;  5DO2 A;  3ARU A;  3AS1 A;  4LAX A;  2A3E A;  4DRJ A;  4DRK A;  2XP6 A;  1L1P A;  5DIT A;  4Z2H A;  3VAW A;  3ARO A;  4ODO A;  1RD6 A;  2AWG A;  1ZBW A;  3AS2 A;  2QF8 A;  1E6Z A;  1JNS A;  2KI3 A;  4W9O A;  1JNE A;  3G6L A;  2M2A A;  2DT3 A;  3ARY A;  5GPR A;  2DSW A;  4HAR A;  3GPK A;  1O6I A;  1SYT A;  4J4O A;  4HBE A;  2ZQT A;  3ARR A;  2KFW A;  1GRJ A;  1FD9 A;  1W9P A;  1TFV A;  1FKF A;  1QPL A;  4ODM A;  4U86 A;  1W9V A;  3ARP A;  2G8Z A;  2DSZ A;  3BMB A;  3OA5 A;  2ETN A;  1WNO A;  4W9P A;  2M08 A;  1C9H A;  2PV1 A;  2FKE A;  2ZR5 A;  3O5E A;  2RUQ A;  3AS0 A;  5JH8 A;  2VCD A;  1FKK A;  1NWU A;  4KR0 B;  4DWS C;  2KR7 A;  1X6N A;  3PRB A;  1P5Q A;  2LKN A;  3IKG A;  1YW5 A;  4P8W A;  3KAC A;  3NRK A;  5D75 A;  2KO7 A;  2F4E A;  2MPH A;  1ZU8 A;  2XP4 A;  2LPV A;  1W1P A;  5DIU A;  4U85 A;  4LGX A;  2DT1 A;  4WIW A;  2IUZ A;  3RGC A;  3WD1 A;  4P8V A;  1EIB A;  2DSV A;  4U84 A;  1JVW A;  1HJX A;  4ODQ A;  2DG9 A;  1FKD A;  4DRN A;  1NWR A;  3GU0 A;  4DRQ A;  1BKF A;  3JYJ A;  3O5O A;  3KAI A;  1K9T A;  1Q6H A;  4MSP A;  4DWS D;  4JFJ A;  5B8I C;  2Y78 A;  1B6C A;  5DIV A;  1HXV A;  1ZK6 A;  4ZPT R;  3ART A;  3TC5 A;  3WL0 A;  3ARZ A;  2PPO A;  1HJV A;  3O5I A;  2ZR4 A;  3UQB A;  4ML4 A;  1JCH B;  2XP3 A;  3ODK A;  4IQC A;  3WD4 A;  3OOB A;  4L3N A;  2KGJ A;  3KAD A;  3RFW A;  1UR8 A;  3LUO A;  3B9D A;  4URI A;  4N19 A;  1N1A A;  4QZV B;  2B5U B;  1LG2 A;  1J6Y A;  5HTG A;  3FXY A;  3O5L A;  1Y0O A;  3AQU A;  1FJD A;  4MNK A;  2DT0 A;  1J4I A;  2MF9 A;  5HT1 A;  4C02 B;  3UF8 A;  1ZL1 A;  1J4H A;  1FKH A;  1WAW A;  4DRM A;  2RUC A;  1TCO C;  1LG1 A;  1FKI A;  4ODK A;  1EQ3 A;  4DRH A;  4TYO A;  4LAW A;  1D7H A;  3WKZ A;  2WM0 A;  4ZS6 A;  3QOK A;  3WQW A;  3AS3 A;  3RM8 A;  2DSU A;  4W5U A;  2F23 A;  4DZ3 A;  1FFR A;  1D6O A;  1D7I A;  4W9Q A;  4WKF A;  3WH0 A;  2JZV A;  4GGQ A;  3UI5 A;  4TX0 A;  4QT3 A;  3BXW A;  3PA7 A;  1ROT A;  2KE0 A;  4QIB A;  3ARX A;  3W4R A;  3IK8 A;  1XHG A;  1E6N A;  3WIJ A;  1CTN A;  4BF8 A;  3RME A;  1PIN A;  1IX5 A;  1J4R A;  2XPA A;  3KAG A;  3O5D A;  4Z2L A;  2A3B A;  3JXV A;  2PV3 A;  4J4N A;  1W1Y A;  1XRV A;  4L72 B;  1BL4 A;  3NTP A;  1OGG A;  4MNM A;  4FAP A;  4LAY A;  3ALF A;  4G50 A;  4DRO A;  3CGN A;  3WL1 A;  3UI4 A;  1W9U A;  3PRD A;  4IT6 A;  2XP5 A;  2Q5A A;  1HJW A;  3RM9 A;  5HKG A;  2RUR A;  3O5J A;  3B8S A;  4ZPV R;  2IF4 A;  1M5Y A;  4Q22 A;  4NSB A;  3KAF A;  3O5K A;  1LL7 A;  1UR9 A;  3EY6 A;  4MAV A;  1D2K A;  4DWS B;  3WD3 A;  4FN2 A;  1NWT A;  2O9O A;  2ESC A;  4XAK A;  1FKG A;  3B7X A;  2L2S A;  3CZ8 A;  3PRA A;  4R5E A;  4MNL A;  3WD2 A;  3CHD A;  1FKT A;  1FAP A;  1LL6 A;  1ZBC A;  2RQS A;  1ZCN A;  3O5R A;  1F40 A;  1JNT A;  1HKM A;  1NMV A;  4TW7 A;  2K8I A;  3JYM A;  2RSE A;  1E6R A;  3O5M A;  1W1T A;  1ZBK A;  3PR9 A;  3O5P A;  2XP9 A;  5J6E A;  2A3A A;  2PV2 A;  3WQV A;  4Q7N A;  1A7X A;  3KCE A;  4MTV A;  1Q6U A;  2XP8 A;  1EHN A;  5HW8 A;  3UI6 A;  3TCZ A;  3TDB A;  2MLZ A;  4WKA A;  1FKR A;  2MLX A;  4ODL A;  1NMW A;  4DRP A;  4JFL A;  2ZQS A;  4Z2K A;  2YBT A;  3I6C A;  4DRI A;  1OGB A;  4WK9 A;  4G2P A;  2FDM A;  5HW6 A;  3GTY X;  4DIP A;  4TW8 A;  1ZB5 A; 
#chains in the Genus database with same CATH homology
 2G41 A;  1FKJ A;  2DPE A;  2LGO A;  5HWB A;  2PBC A;  3H9R B;  1OWQ A;  4O2T A;  1EYM A;  1T11 A;  1EDQ A;  1LJY A;  4DWS A;  1GOI A;  2WLY A;  2PPN A;  1QZ2 A;  1X6L A;  4ODP A;  2RUD A;  3CGM A;  1E6P A;  2UZ5 A;  4DT4 A;  5HW7 A;  4NNR A;  5DF0 A;  2XP7 A;  1LQ0 A;  2M1I A;  3ALG A;  1W1V A;  1Q1C A;  1FKL A;  1ITX A;  1E9L A;  3CHC A;  4ITZ A;  5GPG A;  1R9H A;  1KFW A;  2DG4 A;  1NSG A;  3B9A A;  3CH9 A;  4MNJ A;  4R0X A;  4JFK A;  4AY1 A;  5BXJ A;  2OFN A;  4WKH A;  4S3J A;  1LL4 A;  3UQI A;  4Z2J A;  1GUV A;  3UQA A;  3B9E A;  2A3C A;  1YAT A;  4JYS A;  3FY1 A;  3O5G A;  3ARS A;  2OLH A;  3WD0 A;  2YBU A;  3KAH A;  1VF8 A;  2LJ4 A;  1JND A;  1H0G A;  3ARW A;  1HKK A;  3IKD A;  1ZBV A;  5I98 A;  5HUA A;  4Z2I A;  4S3K A;  4JFM A;  3ARV A;  3NI6 A;  2PPP A;  3O5Q A;  4HBO A;  4P8X A;  4IQ2 A;  1ROU A;  4Z2G A;  4DZ2 A;  5HWC A;  1WB0 A;  1FKS A;  1E15 A;  3CHE A;  4LAV A;  2ITK A;  3MDY B;  3KAB A;  2ZQU A;  2ZQV A;  4ZPW R;  2F21 A;  4IT4 A;  1HKI A;  1D7J A;  2B31 A;  2WK2 A;  3CHF A;  3G6M A;  3ARQ A;  1F8A B;  4DH0 A;  1FKB A;  2MNT A;  3KZ7 A;  1U79 A;  1Q6I A;  2D9F A;  4WJX A;  5GQB A;  2O92 A;  4GIV A;  2FAP A;  4TNS A;  1KT1 A;  2WLZ A;  4ODR A;  1NH6 A;  3RM4 A;  4MGV A;  1FFQ A;  2MLY A;  1NWS A;  4JFI A;  4MPK A;  2ZR6 A;  2VN1 A;  4ODN A;  2N87 A;  2AOS A;  4QT2 A;  4IPX A;  4NZC A;  3O5F A;  3FAP A;  4KQZ A;  1PBK A;  1W26 A;  1GPF A;  1KT0 A;  3IHZ A;  5DEZ A;  5HBF A;  4PTM A;  2XPB A;  1H0I A;  1HKJ A;  1QPF A;  2F2D A;  4TW6 A;  4P8U A;  2PI6 A;  2DG3 A;  2DT2 A;  1SR0 A;  5DO2 A;  3ARU A;  3AS1 A;  4LAX A;  2A3E A;  4DRJ A;  4DRK A;  2XP6 A;  1L1P A;  5DIT A;  4Z2H A;  3VAW A;  3ARO A;  4ODO A;  1RD6 A;  2AWG A;  1ZBW A;  3AS2 A;  2QF8 A;  1E6Z A;  1JNS A;  2KI3 A;  4W9O A;  1JNE A;  3G6L A;  2M2A A;  2DT3 A;  3ARY A;  5GPR A;  2DSW A;  4HAR A;  3GPK A;  1O6I A;  1SYT A;  4J4O A;  4HBE A;  2ZQT A;  3ARR A;  2KFW A;  1FD9 A;  1W9P A;  1TFV A;  1FKF A;  1QPL A;  4ODM A;  4U86 A;  1W9V A;  3ARP A;  2G8Z A;  2DSZ A;  3OA5 A;  1WNO A;  4W9P A;  2M08 A;  1C9H A;  2PV1 A;  2FKE A;  2ZR5 A;  3O5E A;  2RUQ A;  3AS0 A;  5JH8 A;  2VCD A;  1FKK A;  1NWU A;  4KR0 B;  4DWS C;  2KR7 A;  1X6N A;  3PRB A;  1P5Q A;  2LKN A;  3IKG A;  1YW5 A;  4P8W A;  3KAC A;  3NRK A;  5D75 A;  2KO7 A;  2F4E A;  2MPH A;  1ZU8 A;  2XP4 A;  2LPV A;  1W1P A;  5DIU A;  4U85 A;  4LGX A;  2DT1 A;  4WIW A;  2IUZ A;  3RGC A;  3WD1 A;  4P8V A;  1EIB A;  2DSV A;  4U84 A;  1JVW A;  1HJX A;  4ODQ A;  2DG9 A;  1FKD A;  4DRN A;  1NWR A;  4DRQ A;  1BKF A;  3JYJ A;  3O5O A;  3KAI A;  1K9T A;  1Q6H A;  4MSP A;  4DWS D;  4JFJ A;  5B8I C;  2Y78 A;  1B6C A;  5DIV A;  1HXV A;  1ZK6 A;  4ZPT R;  3ART A;  3TC5 A;  3WL0 A;  3ARZ A;  2PPO A;  1HJV A;  3O5I A;  2ZR4 A;  3UQB A;  4ML4 A;  2XP3 A;  3ODK A;  4IQC A;  3WD4 A;  3OOB A;  4L3N A;  2KGJ A;  3KAD A;  3RFW A;  1UR8 A;  3LUO A;  3B9D A;  4URI A;  4N19 A;  1N1A A;  4QZV B;  1LG2 A;  1J6Y A;  5HTG A;  3FXY A;  3O5L A;  1Y0O A;  3AQU A;  1FJD A;  4MNK A;  2DT0 A;  1J4I A;  2MF9 A;  5HT1 A;  4C02 B;  3UF8 A;  1ZL1 A;  1J4H A;  1FKH A;  1WAW A;  4DRM A;  2RUC A;  1TCO C;  1LG1 A;  1FKI A;  4ODK A;  1EQ3 A;  4DRH A;  4TYO A;  4LAW A;  1D7H A;  3WKZ A;  2WM0 A;  4ZS6 A;  3QOK A;  3WQW A;  3AS3 A;  3RM8 A;  2DSU A;  4W5U A;  4DZ3 A;  1FFR A;  1D6O A;  1D7I A;  4W9Q A;  4WKF A;  3WH0 A;  2JZV A;  4GGQ A;  3UI5 A;  4TX0 A;  4QT3 A;  3BXW A;  3PA7 A;  1ROT A;  2KE0 A;  4QIB A;  3ARX A;  3W4R A;  3IK8 A;  1XHG A;  1E6N A;  3WIJ A;  1CTN A;  4BF8 A;  3RME A;  1PIN A;  1IX5 A;  1J4R A;  2XPA A;  3KAG A;  3O5D A;  4Z2L A;  2A3B A;  3JXV A;  2PV3 A;  4J4N A;  1W1Y A;  1XRV A;  4L72 B;  1BL4 A;  3NTP A;  1OGG A;  4MNM A;  4FAP A;  4LAY A;  3ALF A;  4G50 A;  4DRO A;  3CGN A;  3WL1 A;  3UI4 A;  1W9U A;  3PRD A;  4IT6 A;  2XP5 A;  2Q5A A;  1HJW A;  3RM9 A;  5HKG A;  2RUR A;  3O5J A;  3B8S A;  4ZPV R;  2IF4 A;  1M5Y A;  4Q22 A;  4NSB A;  3KAF A;  3O5K A;  1LL7 A;  1UR9 A;  3EY6 A;  4MAV A;  1D2K A;  4DWS B;  3WD3 A;  4FN2 A;  1NWT A;  2O9O A;  2ESC A;  4XAK A;  1FKG A;  3B7X A;  2L2S A;  3CZ8 A;  3PRA A;  4R5E A;  4MNL A;  3WD2 A;  3CHD A;  1FKT A;  1FAP A;  1LL6 A;  1ZBC A;  2RQS A;  1ZCN A;  3O5R A;  1F40 A;  1JNT A;  1HKM A;  1NMV A;  4TW7 A;  2K8I A;  3JYM A;  2RSE A;  1E6R A;  3O5M A;  1W1T A;  1ZBK A;  3PR9 A;  3O5P A;  2XP9 A;  5J6E A;  2A3A A;  2PV2 A;  3WQV A;  4Q7N A;  1A7X A;  3KCE A;  4MTV A;  1Q6U A;  2XP8 A;  1EHN A;  5HW8 A;  3UI6 A;  3TCZ A;  3TDB A;  2MLZ A;  4WKA A;  1FKR A;  2MLX A;  4ODL A;  1NMW A;  4DRP A;  4JFL A;  2ZQS A;  4Z2K A;  2YBT A;  3I6C A;  4DRI A;  1OGB A;  4WK9 A;  4G2P A;  2FDM A;  5HW6 A;  4DIP A;  4TW8 A;  1ZB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...