5HWTA

Crystal structure of apo-pas1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
GAMALYEFVGLLDAHGNVLEVNQVALEGGGITLEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
molecule tags Transferase
total genus 35
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwtA00
3LIBA 1GSXA 4EXOA 2VV7A 3GECA 2ZOIA 3PHYA 5AVFA 4WN5A 3H7WB 2PR6A 1V9YA 4BBVA 3ULFA 1T19A 3LICA 3MR0A 4L9FA 4HNBA 5IS1A 2WKRA 3HJIA 2KX6A 2W0NA 5TBMB 1OJ5A 2K7SA 1TS6A 2QWSA 3BY9A 2PHYA 1MZUA 4EERA 1DP9A 4XT2B 3VE4A 2VEAA 1LSVA 3MQOA 1OTBA 1JNUA 4HI4A 4I3JA 5HWVA 5J7EA 1OTEA 1P0ZA 4E04A 1UWNX 1V9ZA 3F1PB 3MFXA 5F69A 2YKHA 4NXGA 1XJ3A 5G4YA 3LYXA 4HY8A 3LIDA 2ZOHA 5DJUA 5DJTA 1DP6A 3F1PA 2I9VA 1Y28A 4HH2A 5HWTA 2JHEA 4RQ9A 3C8CA 3FG8A 3H7WA 4I38A 3LIAA 3VE3A 4GCZA 1T18A 3NJAA 5DKKA 4I39A 3LI9A 2R78A 3A0RA 4LRZE 1S66L 5HSQA 1F9IA 3F1NB 2OWHA 4HJ3A 1WA9A 3EWKA 3NOTC 5HDCA 4I3IA 2L0WA 2V1BA 3MXQA 3D72A 1T1AA 4HJ4A 3C2WA 1NWZA 5HD5A 2VV6A 4YWZA 4HQAA 3H82A 3CWFA 5J3WA 5A8BA 5F5YA 4H6JA 4HOIA 3HJKA 2PDRA 4WF0A 1EW0A 4BBTA 4KUKA 4HJ6A 4NXBA 5HWWA 1S4RA 4DJ3A 3LIFA 3UB7A 3K3CA 1N9NA 2H28A 2V9AA 2J80A 2PR5A 1LSWA 4PKYA 4EW7A 2BASA 3SW1A 1LSXA 1OTDA 3UB6A 2V1AA 3P7NA 3E4PA 1TS7A 1S1YA 3ZQ5A 5DKLA 1D7EA 4GS9B 2WKQA 4GHIA 2QJ5A 3F1NA 3UMEA 2YKFA 1BYWA 4DJ2A 2WKPA 4EEPA 5HZHA 3K3DA 3UB9A 3T50A 2Z6DA 3NOPC 3E4OA 4EQ1A 4B9OA 4KUOA 3IS2B 4MN6A 3MJQA 2B02A 4LPZA 4JGRA 2INWA 2W27A 3B33A 4LRXC 2V0UA 1LL8A 4HP9A 2Z6CA 5KIZA 5HD3A 5TBMA 5G4ZA 4EEUA 4XT2A 1G28A 1GSWA 4GS9A 2P7JA 3RH8B 4WLAA 4M4XA 1F98A 2QKPA 3PYPA 3BY8A 4HIAA 1T1CA 5HDSA 1P97A 4LRYC 1TS8A 2L4RA 2PYRA 3FC7A 3E4QA 5EFWA 1N9OA 2EA9A 3LI8A 4MN5A 2A24B 2CMNA 5AVEA 3NHQA 4EETB 2PD8A 2PD7A 1OT9A 4F3LB 1S67L 3IS2A 4R38A 4HHDA 3VOLA 3UMDA 3NOUC 2KDKA 2QJ7A 1DRMA 4K08A 2V0WA 1X0OA 4GW9A 2M1CA 5F68A 3CLOA 3G6OA 2QHKA 5HDDA 1VB6A 2JN7A 1DP8A 2D02A 2PYPA 3F1OB 3BWLA 4I3AA 1LT0A 3KX0X 2VV8A 1N9LA 3UE6A 1S4SA 3MQQA 1GSVA 4LLOB 1UWPX 2L1MA 3UB8A 1XJ6A 4HH3A 4JGPA 3IBRA 1OTIA 2A24A 4NXEA 4HP4A 3H82B 4F3LA 1T1BA 4H6JB 1XFQA 4PKYG 3OLOA 4R70A 1XJ4A 4NXFA 3LUQA 3A0VA 4JGQA 3H9WA 1D06A 4L9EA 4L9GA 2D01A 2ZBBA 3EEHA 4WL9A 1S1ZA 2GJ3A 2OOLA 4EESA 5J4EA 5I5LA 4BBUA 5F6AA 4JGOA 3ICYA 1OJGA 2HV1A 2VLGA 3F1OA 3A0SA 4GHIB 1XFNA 5IU1A 1TS0A 1OT6A 4KQDA 1ODVA 3GDIA 1XJ2A 1OTAA 3RTYA 2OWJA 1UGUA 3CAXA 1KOUA 4R6LA 4WUJA 3LIEA 4I5SA 4R3AA
chains in the Genus database with same CATH superfamily
1GSXA 4P6ZM 4EXOA 2RL3A 1E3UD 5AQ7A 5AVFA 2W3DA 3DTKA 3G31A 1NJ4A 2EX6A 1V9YA 1O07A 4BBVA 4QPRA 3ZHHA 4K91A 2HF6A 1KE4A 4HNBA 2PBYA 3R4KA 5IS1A 1K4FA 2IA2A 3KSFA 3GSGA 3CG5A 5TBMB 4CLCA 2W1TA 1TS6A 3BM6A 1IYQA 4XT2B 4BENA 3G30A 2HJ9C 4C3QA 5E2HA 2W1RA 1YMSA 1ONHA 2VX8A 2PU4A 1LHYA 3E0YA 4S2MA 2XFSA 3BW6A 2J9PA 1P0ZA 4ETXA 1V9ZA 1FIKA 3MFXA 3LEZA 3B47A 3QP6A 4NXGA 2HP6A 5G4YA 2Y2QA 4HY8A 4OOLA 1VQQA 4ZJ3A 5K5BA 5DJTA 2HDQA 1ES4A 4P87A 1K57C 3OPPA 3CJMA 4HH2A 5HWTA 1PNEA 2JHEA 1BLPA 3EGXC 4OLDA 3OOVA 4I38A 3H7WA 2H0TA 1VETA 3TE8A 2ZC5B 2UWXA 2H5SA 3HUMA 2EWWA 2WGWA 3KYEA 3VE3A 4BD1A 3BEBA 4BJPA 2OSUA 4I39A 1CI8A 1GA0A 1CEFA 1TF1A 4JF4A 2EX2A 4QU3A 1TEMA 1WA9A 5DTKA 3MXRA 3KSGA 3ZG7B 2ZM8A 3UPNA 2Q9MA 1SKFA 1KGFA 2X71A 3UB5P 1PZOA 2JKRI 4E3MA 1K6RA 3ZYTA 1ZG4A 3D72A 5KMWA 1T1AA 3BFCA 4GJ4A 4HJ4A 5HD5A 4YWZA 3VMAA 3ZNYA 5A8BA 5M19A 4H6JA 4HOIA 4QWOA 5EVIA 4DN0A 2Y2HA 1FR6A 3U2AA 3ITAA 2HZ5A 4HJ6A 2XQZA 5HWWA 4DJ3A 4JXGA 3S4XA 2V9AA 3B42A 5FAPA 2B95A 4O0PA 1OTDA 3Q82A 1TD5A 2WUQA 3P7NA 2ZC7A 1TS7A 3MZDA 3ZQ5A 2XA7M 4Y5FA 1H8YA 4LV0A 4BL3A 4GZBA 3IH8A 3M6HA 5TFQA 4NG2A 1ZKJA 5EUAA 3MQ0A 3F1NA 3TW8A 4WZ5C 1BTLA 4RA7A 4RYEA 2O9CA 3GTCA 1BYWA 4FH2A 4Q8IA 3K2NA 1NLYA 5HZHA 1BT5A 3E2KA 4UAAA 3TOIA 3HUNA 3OPHA 4EQ1A 3QNCA 5A90A 3NIAA 3IS2B 2Y2IA 1HVBA 4MN6A 1G68A 5CHMA 3MJQA 2V1ZA 1CJFA 3IWOA 3EEAA 3BFEA 3IXGA 2J3WA 2INWA 2W27A 4GDNA 3B33A 3UNWA 2VA0A 2Z6CA 5KZHA 4OOMA 5GLDA 4B93A 4ETZA 3W8KA 4LGWA 2IWDA 4EEUA 3SS3A 2C5WB 2XSSA 1GSWA 2Y2MA 2P7JA 4WLAA 4M4XA 1MBLA 1YSQA 5HAQA 4HIAA 3VP2A 3T1XA 4LRYC 4UQIM 1FQGA 5DF7A 3FC7A 3E4QA 3BRMA 1K56A 4KZ4A 5HAIA 4EETB 5CEBA 1K55A 4KZ5A 2WKEA 2ZD8A 4DXCA 1ACFA 4F3LB 3A3DA 3IXDA 2QZ6A 4S2KA 1S67L 4GKUA 1TDGA 4HHDA 4D2OA 3IF6C 4D60A 3KO6A 4A5RA 3UE0A 3PBTA 4R3BA 5DF9A 1XPBA 3NDGA 3N4IA 2QHKA 1KVMA 2XR0A 4ID4A 4O7DA 3VP1A 3NDEA 5I94A 1YAXA 3BWLA 3F1OB 1ES5A 5E43A 4E3JA 2VV8A 4YFMA 1Q2QA 3GMWA 3MQQA 3IQAA 4O01A 1GSVA 1K55C 5GLBA 1UWPX 4KZ7A 1JWVA 1VEUA 2ZMFA 1IKIA 5TJJA 3O86A 2Y2PA 4H6JB 1L0FA 3UDXA 1XFQA 4PKYG 3OLOA 1XJ4A 3G2YA 4NXFA 1D06A 4MBHA 3PR6A 2IWCA 4PM5A 4OPZA 2WKHA 1NYMA 2OOLA 3CZDA 3T4QA 2VGLM 3OC2A 1HLUP 1BZAA 1MWUA 5FQJA 1OJGA 3MMHA 3C4OA 4II7A 1XFNA 1TS0A 1ESIA 3ZVTA 1S0WA 3ISGA 1ODVA 3RXWA 1OTAA 2OWJA 3PBOA 3CAXA 4Z9QA 5FATA 2EX8A 5M18A 1Z6FA 2P04A 4N9KA 3FPVA 2VGKA 2H0YA 1K54C 3PBSA 3F1PB 3O3VA 1IKGA 3IHAA 3GECA 3PHYA 3FZCA 3DTMA 1NLZA 2W3HA 2PR6A 4KG2A 2HDUA 4X69A 2Z2LB 1IOUA 3G2ZA 2LB9A 4ZJ2A 4HEFA 5J8XA 3WRZA 4JF5A 2QWSA 4IUKA 1ZTUA 3A3IA 1MZUA 1BLSA 3R7WB 4M3KA 3TSGA 3PAGA 4LV3A 3VE4A 1LSVA 1OTBA 1WYBA 2HPBA 1YLYA 5E2FA 3V3SA 4JKTA 2GZAA 1DJBA 4I3JA 5HWVA 3M2KA 2JCHA 3IXBA 4OKPA 4N1HA 1YT4A 5FAOA 2EFXA 3HUOA 3WS4A 2YKHA 4MDZA 4XUZA 4YINA 5TGFA 3FYZA 4UA6A 3FKWA 1YPRA 5AQAA 4E6WA 4EBLA 3MZEA 4OQHA 2KLIA 2ZC6B 3M2JA 5DJUA 2P08A 2Z2MB 2WKIA 4MEZA 4RX2A 1H8ZA 2VK3A 1CQAA 4PAUA 2VZWA 5CGSA 4S2NC 2ZMVA 1NXYA 1ES2A 3DWKA 3T12B 3RXXA 3LIAA 4QD4A 5EVEA 4IHQA 5GHXA 1XKZA 1IEMA 3EOIA 2Y55A 1MWRA 3VP0A 1T18A 3LGOA 4WEJA 1BLHA 3Q1FA 2BG1A 3P09A 2KOIA 3BYDA 4KG5A 1ZHHB 3QP2A 2ZM0A 1L2SA 3PBNA 3HLFA 2L0WA 1QMEA 4Y13A 2V1BA 1RP5A 4OPQA 4ZTKA 5A93A 1W8QA 1EROA 1SHVA 4OPRA 3BFDA 5BOHA 3SH9A 5F5YA 2PDRA 4WF0A 2XD5A 4X6TA 4JXVA 3ZG5A 1W63M 2XDMA 4IBXA 4KUKA 3ZFZA 3T1RA 2O9AA 3LIFA 4IBRA 2G7UA 3K3CA 1K38A 1L0EA 4AFIA 1LSWA 2BASA 3SW1A 2B5RA 1DJCA 4KQOA 2V1AA 1H8MA 2EX9A 1PIOA 4R0QA 5F82A 2GNXA 1GCEA 1KDSA 3QNBA 1CK3A 2WKQA 5EV0A 3UO9A 3UPPA 4OP8A 3D3OA 3CPTA 4EBPA 3VP3A 5DTSA 4IJGA 1F5MA 3UMEA 3IH9A 4S2PA 4FCFA 4Q0IA 4DJ2A 2WKPA 3UB9A 4BD0A 2QMIA 3T50A 4IVIA 2EXAA 3NY4A 2ZQAA 5EVLA 1ONGA 4BMWA 4DF6A 4CJNA 3O88A 3T4TA 1WYCA 1PWCA 5CGWA 4JXWA 3VSKA 5IT5A 4Y0TA 4K0WA 3ZG9B 3DW0A 3MBZA 5EECA 4LPZA 4O8GA 4CLCC 1ZC2A 3QP5A 4LRXC 1MKMA 1WE4A 4KZ8A 4P6ZS 2WYXA 2NUPC 1I2WA 2OLUA 2X01A 4EQIA 4E3IA 1DY6A 1GHPA 1G28A 1GA9A 4GS9A 4DE0A 4P85A 5A91A 3QHYA 5TR7A 3U4LP 4X68A 3HCYA 3IX3A 5HDSA 3HBRA 5DF8A 2L4RA 3KSHA 4YNRA 5EFWA 3Q7VB 2XD1A 4MN5A 2A24B 2O9BA 2Y79A 4ZDXA 5HPFA 5EOEA 3NHQA 4CLCD 3N7WA 3GV9A 1OT9A 3D4FA 1KGGA 3OPRA 5DVAA 2OLVA 4HBTA 3FPWA 4R38A 2ZJ9A 3VOLA 2WAEA 2VGJA 3LFVA 4K08A 1W5DA 4WZ4A 3OCNA 2FFFB 5HDDA 5HW3A 1VB6A 2ZQ8A 3BFGA 2JE5A 4EV4A 5CTNA 5HL6A 4LCMA 2J7VA 2ACGA 4I3AA 1LT0A 5FQIA 2E8IA 1ES3A 1N9LA 3VSLA 1CEGA 5FA7A 1LL5A 5FDSA 1TVFA 4EWFA 5EVIC 4JGPA 1A0KA 3IBRA 4NXEA 3WS2A 3BECA 3D9YA 3W4PA 3SH7A 1T1BA 1Q2PA 4GNUA 1PWGA 3BQ8A 4R23A 5AJGA 3N6IA 4UEYA 1YLPA 4OQGA 5L07A 4R70A 4WMCA 4OONA 4X1MA 4B4ZA 2H10A 4DKIA 3CUEA 3EEHA 1ALQA 3CMZA 3S7NA 4MN7A 3VV4A 3FKVA 5FSRA 2GDNA 5I5LA 2FH5A 4BBUA 3IBJA 1FCMA 5EVID 4JGOA 4CLCB 2M7UA 2W1TB 2WGVA 2Q0OA 4Y0UA 1AWIA 1KDWA 4Y0OA 5KSHA 3L9KA 1AXBA 4NEED 2EWVA 3G32A 3E2LA 2XA7S 4KQDA 2Y2JA 1BUEA 3GQZA 3GVBA 3VOZA 5GHYA 1XJ2A 1UGUA 4OQIA 4FD8A 2JKGA 4R4SA 4RVAA 4Y2FA 1NZUA 3HVFA 1U60A 4WUJA 5CGXA 4QJGA 1SDEA 4R3AA 5MC7A 2XGNA 4WEKA 4NK3A 4LENA 3LIBA 2RCXA 1PW1A 1W7FA 2G2UA 5JYOA 3H7WB 1VETB 1PWDA 2W3GA 2W3EA 4OLGA 4ME4A 1G6OA 4MLLA 3Q07A 3VP4A 2WGWB 2WZXA 2OAQ1 3HLEA 3ULFA 5CHJA 1T19A 3LICA 4ZBEA 3MR0A 4LV2A 4L9FA 1NRFA 2WKRA 3HJIA 2KX6A 5E2GA 4C6YA 3CI6A 3S22A 2K2NA 1IFQA 2W0NA 4OP5A 3W4QA 3G34A 3BY9A 3V3RA 1JTGA 4EERA 5G18A 1DP9A 5CERA 1XGJA 5FL3A 4DRTA 5DTTA 2VEAA 1SCWA 2WGIA 1DJAA 4X25A 2WADA 2Y2GA 5J7EA 2DMWA 2J9OA 3C38A 2A2LA 1GHIA 3GR2A 4E04A 2ZC4B 1FCNA 2JKTI 3AGFA 1FSYA 3IT9A 4FSFA 2A49A 3MF0A 1XJ3A 5EVIB 4E3OA 4UQIS 3LIDA 4DE3A 4KQRA 2I9VA 2V20A 4Z1WA 1XX2A 3C8CA 4S2LA 3W4OA 1OPXA 1K56D 4QY6A 4QB8A 2M7VA 4FUWA 1FILA 2FZ0A 3LI9A 3A0RA 3HLGA 4HBUA 4LRZE 1S66L 4UA9A 5GHZA 5HPIA 1F9IA 4ESPA 3F1NB 4HJ3A 3UDFA 1FOFA 3EWKA 3A3EA 4WELA 4I3IA 1QMFA 2VKSA 3MXQA 1PI4A 2B18A 3LEQA 4X53A 4KZ3A 3PXPA 3C2WA 1VM1A 3H82A 3HL9A 2BTFP 4GB7A 1M40A 1KE3A 3HLWA 1EW0A 4MBKA 3SS5A 5FAQA 1MWTA 4BBTA 3Q81A 1S4RA 5HFOA 3LR5A 1O7EA 3UE1A 1N9NA 3V67A 2H28A 1MC0A 5CX7A 2PR5A 4WYYA 3WWXA 4PM7A 3N8LA 1K0KA 1LSXA 3DBAA 4K0XA 4PM6A 3MKEA 3E4PA 1S1YA 4ZAMA 1EI5A 2XROA 3WS5A 1YLZA 1ERQA 4GD8A 1P9WA 1RGYA 2QJ5A 3MKFA 4HESA 3CITA 1IYSA 3SZTA 4G3KA 1PFLA 2K31A 2HDSA 2ZL1A 3FV7A 4PM9A 1E3UA 5L2FA 2Z6DA 3NOPC 2EXBA 4KQQA 3E4OA 1H3QA 4ARZA 1M6KA 4MNRA 4B9OA 2PBDP 2HDRA 5GL9A 2R9WA 4H8RA 1H5XA 2XRNA 4B88A 1BLCA 5CRFA 2HJEA 2B02A 3V5MA 2Y2OA 4EU0A 1G5UA 2EFUA 3V39A 1KGEA 3HLDA 3L7HA 5GLCA 1S6RA 3AGEA 2XEPA 2ZQ7A 3A3JA 1YQSA 3T4LA 5KIZA 1SDNA 2Y8HA 4MBFA 4ZRRA 3E98A 3OZHA 5G4ZA 5IHVA 4PMAA 3T4JA 3DTEA 5FQ9A 5CEDA 3I7JA 3PYPA 1T1CA 3LO7A 4R4RA 5EPHA 3QP8A 1VEUB 1P9RA 3LI8A 3QP4A 2CMNA 4E6XA 1W63Q 5DFYA 4X56A 2PD8A 1ZG6A 1YM1A 3O5YA 4WM9A 2Q9NA 2Y2NA 3IX8A 1STZA 2I72A 3IS2A 1SZVA 4Q0JA 4BLMA 2KDKA 2QJ7A 1DRMA 2A3UA 2V0WA 4OQ0A 3IX4A 5F68A 4JF6A 1JWPA 3ZCZA 3ITBA 1K57A 2Y2KA 3UPOA 3C30A 3DWZA 2JN7A 1NYYA 2D02A 1YLWA 1MKIA 3JVVA 1XA1A 4GLQA 3KX0X 4EUVA 3UE6A 1PW8A 1IELA 1YSPA 4LLOB 5AQ9A 3BFFA 2AVXA 3P98A 2XF3A 4S2IA 3UB8A 4HH3A 2JBFA 4N9LA 1OTIA 4RX3A 4XXRA 4BL2A 3P01A 3KYQA 2HGVA 1CI9A 3H82B 4OVDA 4P0MA 4F3LA 1XP4A 4DMZA 2QYBA 3TRCA 2PT7A 2JKFA 3HLCA 2DNSA 4CQHA 3HLBA 1ESUA 3A0VA 4JGQA 1NRJA 1F2KA 4L9GA 2D01A 3WRTA 2O0YA 5FI2A 2ZBBA 3UDIA 4KG6A 1S1ZA 2GJ3A 1NY0A 3RJUA 3TJZC 5J4EA 4B4XA 4GDBA 1ERMA 4Q0HA 2UV0E 5F6AA 1SKOA 2DCFA 2J8YA 1YMXA 4JBFA 5HARA 4C75A 3UN7A 5AQBA 5L8MA 3WS1A 4XUXA 2VLGA 3F1OA 3RFBA 4G3VA 3A0SA 5IU1A 2C6WB 3EGDC 1MPLA 1YLJA 3G4PA 3ZVWA 1I2SA 1W79A 3ZG8B 2JKRM 1FR1A 3RTYA 2ZL1B 1J3WA 4KZ6A 1PYYA 5HX9A 4WZ5A 1KOUA 4ARZB 4BWIA 2R9XA 4GOGA 1YKDA 3PAEA 2ZQCA 4I5SA 3BLSA 3S7OA 1XGIA 2G2WA 1RGZA 2VV7A 4S2OA 2ZOIA 5DFXA 4WN5A 2GX5A 3QP1A 1J9MA 4FTXA 3T4KA 2V8FA 2DRWA 5CHUA 3EQVA 5FEGA 2Y91A 2NUTC 4PM8A 3IWQA 4IVKA 5EE8A 1TDLA 3C7UA 3NI9A 3MZFA 4ZJ1A 1OJ5A 2K7SA 2PHYA 4OOYA 4CLCE 3UE3A 2Y59A 3MQOA 1JNUA 4HI4A 1C3BA 2O99A 3MS6A 5E2EA 3NC8A 3A3FA 1OTEA 3TG9A 1CF0A 2WK0A 1UWNX 1NZOA 5F69A 1D1JA 1LI0A 3LYXA 4E3LA 2PRFA 3C5AA 2ZOHA 3ZGAB 4U0XA 1E25A 1DP6A 3F1PA 1Y28A 1PZPA 3JPUA 1JTDA 5LBRA 4Y3IA 4RQ9A 3Q7ZA 3FG8A 5FQKA 5FEFA 3DTIA 1PRQA 3IF5A 2HP9A 4GCZA 3PBRA 3IF6A 3NJAA 3MXSA 3OBFA 4YOFA 5DKKA 2R78A 2XFTA 2ZM2A 3SOIA 4MCWA 3NCKA 3T1QB 5F1GA 4LFUA 5FDHA 4E3NA 5HSQA 3CPTB 3N8SA 3C4PA 5EOOA 2OWHA 4UHUA 4X55A 4IEDA 2LB5A 3R7WA 1GHMA 5EM0A 1LLBA 3NOTC 5HDCA 3KSIA 3NULA 5U47A 4CPKA 1IYPA 4DDYA 1NWZA 1YLTA 1FCOA 2VV6A 4NETA 1N4OA 3N8RA 4HQAA 3CWFA 2E8JA 2JC7A 5J3WA 1MXOA 1HZOA 3HJKA 4PPRA 5EM1A 3CUEC 3DAVA 2ZQ9A 5L10A 4KENB 4NXBA 1Z09A 4PHTA 2ZQDA 3UB7A 2MJ6A 5FI6A 4MMNA 3V50A 2J3TC 3JVUA 2J80A 4L0LA 5CECA 4PKYA 4EW7A 3UB6A 1L3LA 4JXSA 2BLSA 4U3TA 1BSGA 5GLAA 3ZNTA 1SKOB 5DKLA 1D7EA 4WMCD 4DDSA 4GS9B 4GHIA 3LY4A 1FSWA 1JWZA 4E3KA 2YKFA 3M6BA 3PBQA 4EEPA 3K3DA 2P9VA 1K25A 3LCEA 2FFYA 2J3TD 3VFFA 3ZDJA 4F94A 3FWLA 4DXBA 2JKTM 5HAPA 3OCLA 4KUOA 4GN2A 3S1YA 2XLNA 4QY5A 4FH4A 1K54A 1G6AA 4JGRA 3VFHA 4U0TA 1KVLA 2V0UA 1LL8A 4R1GA 2V8CA 4HP9A 4LV1A 3SS4A 5HD3A 5TBMA 4OH0A 3OPLA 4S2JA 4XT2A 2X02A 2QPNA 4QHCA 3RH8B 3UY6A 1F98A 4Y7PA 1KE0A 5A92A 2QKPA 4KZ9A 5FI7A 5FQQA 3S7QA 2W3FA 3BY8A 1H0MA 1P97A 4GD6A 1EWZA 1TS8A 1XXMA 1XA7A 2PYRA 2P74A 1N9OA 2EA9A 4WBGA 2V2FF 1E4DA 3LY3A 1MY8A 5AVEA 2PD7A 2Y2LA 2WAFA 3CHWP 3MFDA 3BQAA 2XK1A 4X1LA 5D3OA 4JLFA 4EBNA 3W2ZA 4IUHA 3UMDA 3NOUC 4DE2A 1X0OA 1K6SA 4GW9A 2M1CA 1LL9A 5KSCA 2ZMAA 2XH9A 3PTEA 5CTMA 3CLOA 3G6OA 3IHBA 3NECA 3IF6B 4LCLA 4P6BA 1HTZA 4S2NA 3T1SA 2ZC3B 1DP8A 2OAP1 2PYPA 5CXWA 3O87A 3LR4A 5FQMA 1Y54A 3GRJA 2VGLS 1MWSA 3AGDA 3LR3A 4KZAA 4G3WA 5FASA 5L09A 1S4SA 2ZLYA 3IXHA 3VOYA 1K4EA 2PAVP 3HREA 2L1MA 4Y17A 1XJ6A 1N9BA 3Q7VA 3NBLA 3IWIA 5HL1A 2A24A 4JPMA 2HP5A 3WS0A 3B3XA 4NKPA 3KYZA 5C5KA 3LR0A 4HP4A 2PU2A 5F83A 3BJNA 2IWBA 1HD8A 3S7PA 3BLMA 4N92A 4N1XA 5JYPA 1Y4OA 3LUQA 1IYOA 3H9WA 4L9EA 1L0DA 4DE1A 1LI9A 2WZZA 3ZG0A 3G35A 4WL9A 1L0GA 4EESA 3SH8A 3JYIA 2OV5A 1RCJA 1VHMA 2VJWA 3ICYA 2HV1A 4R3JA 4OPYA 4Y15A 3C7VA 4GHIB 1BULA 1W8YA 1JVJA 3EQUA 3T4OA 1I5QA 4FOFA 1OT6A 3T4SA 4EUZA 3GDIA 1OMEA 4UA7A 2P9VB 3MSHA 1PI5A 4BQMA 2CC1A 4KZBA 5M1AA 5F1FA 4R6LA 3LIEA 2Y4AA
chains in the Genus database with same CATH topology
4WEKA 3LIBA 1GSXA 4P6ZM 4EXOA 2VV7A 3GECA 2ZOIA 3PHYA 5DFXA 5AVFA 4WN5A 2W3DA 2GX5A 3H7WB 1NLZA 2W3HA 2W3GA 2W3EA 2PR6A 1G6OA 4ME4A 3T4KA 1V9YA 4BBVA 2OAQ1 3ULFA 3EQVA 4QPRA 1IOUA 1T19A 3LICA 2LB9A 2NUTC 3MR0A 2HF6A 4L9FA 4HNBA 3R4KA 5IS1A 2WKRA 3HJIA 2KX6A 2IA2A 3KSFA 3CI6A 2K2NA 1IFQA 2W0NA 5TBMB 1OJ5A 4CLCA 2K7SA 2W1TA 1TS6A 2QWSA 3BY9A 4IUKA 1ZTUA 2PHYA 1MZUA 4EERA 1DP9A 3R7WB 4CLCE 3UE3A 4XT2B 2HJ9C 5FL3A 2W1RA 2VEAA 1LSVA 3MQOA 1OTBA 1JNUA 3VE4A 2VX8A 4HI4A 2O99A 3E0YA 2GZAA 4I3JA 5HWVA 3BW6A 5J7EA 2DMWA 1OTEA 1P0ZA 3C38A 2A2LA 4E04A 4ETXA 2JKTI 1UWNX 1V9ZA 3MFXA 5F69A 4FSFA 3B47A 2YKHA 4MDZA 4NXGA 3MF0A 1XJ3A 5G4YA 3LYXA 4HY8A 4UQIS 4OOLA 3LIDA 2KLIA 2ZOHA 5K5BA 5DJUA 5DJTA 2P08A 1DP6A 3F1PA 2I9VA 1Y28A 4PAUA 4HH2A 2VZWA 5HWTA 2JHEA 4Z1WA 5LBRA 3EGXC 4Y3IA 2ZMVA 3OOVA 4RQ9A 3C8CA 1OPXA 3FG8A 3H7WA 4I38A 3TE8A 3LIAA 4IHQA 2EWWA 2M7VA 3EOIA 3VE3A 4GCZA 3PBRA 1T18A 4WEJA 4BJPA 3NJAA 4YOFA 3OBFA 4I39A 5DKKA 2FZ0A 3LI9A 2R78A 2KOIA 3A0RA 4LRZE 1S66L 4MCWA 1TF1A 5HPIA 5HSQA 1F9IA 1ZHHB 3F1NB 2OWHA 4HJ3A 1WA9A 3EWKA 3KSGA 2LB5A 4WELA 3R7WA 3PBNA 3NOTC 5HDCA 4I3IA 2L0WA 3KSIA 2JKRI 2V1BA 2VKSA 3MXQA 3ZYTA 2B18A 3D72A 1T1AA 4GJ4A 4HJ4A 3PXPA 3C2WA 1NWZA 5HD5A 2VV6A 4YWZA 4HQAA 3H82A 3CWFA 5J3WA 5A8BA 5F5YA 4H6JA 4HOIA 3HJKA 2PDRA 4DN0A 4WF0A 3CUEC 1EW0A 3U2AA 1W63M 4BBTA 4KUKA 4HJ6A 4NXBA 5HWWA 1S4RA 2O9AA 4PHTA 4DJ3A 3LIFA 3UB7A 2MJ6A 3LR5A 2G7UA 3K3CA 1N9NA 4MMNA 3V67A 2H28A 1MC0A 2J3TC 2V9AA 3JVUA 3B42A 5CX7A 2J80A 4L0LA 4AFIA 2PR5A 1LSWA 4PKYA 4EW7A 2BASA 3SW1A 4O0PA 1LSXA 1OTDA 3DBAA 3UB6A 1TD5A 4KQOA 2V1AA 1H8MA 3P7NA 3E4PA 1TS7A 1S1YA 3ZQ5A 2GNXA 2XA7M 4Y5FA 5DKLA 1D7EA 2XROA 4GS9B 2WKQA 1P9WA 3D3OA 4GHIA 2QJ5A 3F1NA 3MQ0A 4IJGA 3TW8A 1F5MA 3UMEA 2YKFA 2O9CA 3CITA 4Q0IA 1BYWA 3PBQA 4DJ2A 4G3KA 2WKPA 3K2NA 1NLYA 2K31A 4EEPA 5HZHA 3K3DA 3UB9A 3T50A 2Z6DA 3NOPC 3E4OA 1H3QA 2J3TD 4ARZA 4EQ1A 4BMWA 4B9OA 2JKTM 3OCLA 4KUOA 3IS2B 3T4TA 4MN6A 3MJQA 2XRNA 5IT5A 3EEAA 2HJEA 2B02A 2J3WA 4LPZA 4JGRA 4EU0A 2INWA 4O8GA 2W27A 4CLCC 3B33A 1MKMA 4LRXC 2V0UA 1LL8A 4P6ZS 2VA0A 4HP9A 2Z6CA 2NUPC 3T4LA 5KIZA 2Y8HA 4OOMA 4ZRRA 5HD3A 5TBMA 4B93A 4ETZA 3E98A 5G4ZA 4EEUA 3T4JA 4XT2A 2XSSA 1G28A 1GSWA 4GS9A 2P7JA 3RH8B 4WLAA 4M4XA 1F98A 2QKPA 3S7QA 1YSQA 2W3FA 3PYPA 3BY8A 4HIAA 1T1CA 3HCYA 5HDSA 1P97A 4LRYC 1TS8A 4UQIM 2L4RA 3KSHA 2PYRA 4YNRA 3FC7A 3E4QA 5EFWA 1P9RA 1N9OA 2EA9A 3LI8A 4MN5A 2A24B 2CMNA 2O9BA 2Y79A 1W63Q 5HPFA 5DFYA 3NHQA 5AVEA 4CLCD 4EETB 2PD8A 2PD7A 3O5YA 1OT9A 3BQAA 4F3LB 1STZA 1S67L 3IS2A 3FPWA 4R38A 4HHDA 3VOLA 3W2ZA 4IUHA 4Q0JA 3UMDA 3KO6A 3NOUC 2KDKA 2QJ7A 3LFVA 1DRMA 4K08A 2V0WA 3PBTA 1X0OA 4GW9A 2M1CA 5DF9A 5F68A 3OCNA 3CLOA 3G6OA 2QHKA 5HDDA 1VB6A 3C30A 5HL6A 2JN7A 1DP8A 2OAP1 2D02A 2PYPA 3LR4A 3BWLA 3F1OB 1YAXA 3JVVA 4I3AA 2VGLS 1LT0A 4GLQA 3KX0X 3LR3A 2VV8A 1N9LA 4EUVA 3UE6A 4G3WA 1S4SA 3MQQA 1YSPA 4O01A 1GSVA 4LLOB 1UWPX 2L1MA 3UB8A 1XJ6A 4HH3A 4JGPA 3IBRA 1OTIA 2ZMFA 2A24A 4NXEA 3P01A 4NKPA 3KYZA 3KYQA 5C5KA 3LR0A 4HP4A 2HGVA 3BJNA 5TJJA 3H82B 3S7PA 4F3LA 1T1BA 4H6JB 4DMZA 2QYBA 1XFQA 3BQ8A 5AJGA 3TRCA 4PKYG 2PT7A 4UEYA 3OLOA 4R70A 1XJ4A 4CQHA 4NXFA 3LUQA 3A0VA 4JGQA 3H9WA 1D06A 4L9EA 3PR6A 1NRJA 4L9GA 2D01A 2O0YA 2ZBBA 3CUEA 3EEHA 1S1ZA 2GJ3A 4WL9A 2OOLA 3S7NA 3TJZC 4EESA 5J4EA 4MN7A 3VV4A 5I5LA 2FH5A 4BBUA 3IBJA 4Q0HA 3T4QA 2VGLM 3OC2A 5F6AA 4JGOA 4CLCB 2M7UA 2W1TB 1VHMA 2VJWA 3ICYA 1OJGA 4R3AA 2HV1A 5L8MA 3MMHA 2VLGA 3F1OA 3RFBA 5KSHA 4G3VA 4II7A 3A0SA 4GHIB 1XFNA 5IU1A 3EGDC 1TS0A 4NEED 3EQUA 3T4OA 2EWVA 4FOFA 1OT6A 2XA7S 4KQDA 1ODVA 3T4SA 2JKRM 3GDIA 1XJ2A 1OTAA 3RTYA 2OWJA 1UGUA 3PBOA 3CAXA 2P04A 1KOUA 4ARZB 3FPVA 4BWIA 4Y2FA 4R6LA 3PBSA 4WUJA 1YKDA 3LIEA 4I5SA 3F1PB 3S7OA 5MC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIB A;  1GSX A;  4EXO A;  2VV7 A;  3GEC A;  2ZOI A;  3PHY A;  5AVF A;  4WN5 A;  3H7W B;  2PR6 A;  1V9Y A;  4BBV A;  3ULF A;  1T19 A;  3LIC A;  3MR0 A;  4L9F A;  4HNB A;  5IS1 A;  2WKR A;  3HJI A;  2KX6 A;  2W0N A;  5TBM B;  1OJ5 A;  2K7S A;  1TS6 A;  2QWS A;  3BY9 A;  2PHY A;  1MZU A;  4EER A;  1DP9 A;  4XT2 B;  3VE4 A;  2VEA A;  1LSV A;  3MQO A;  1OTB A;  1JNU A;  4HI4 A;  4I3J A;  5HWV A;  5J7E A;  1OTE A;  1P0Z A;  4E04 A;  1UWN X;  1V9Z A;  3F1P B;  3MFX A;  5F69 A;  2YKH A;  4NXG A;  1XJ3 A;  5G4Y A;  3LYX A;  4HY8 A;  3LID A;  2ZOH A;  5DJU A;  5DJT A;  1DP6 A;  3F1P A;  2I9V A;  1Y28 A;  4HH2 A;  5HWT A;  2JHE A;  4RQ9 A;  3C8C A;  3FG8 A;  3H7W A;  4I38 A;  3LIA A;  3VE3 A;  4GCZ A;  1T18 A;  3NJA A;  5DKK A;  4I39 A;  3LI9 A;  2R78 A;  3A0R A;  4LRZ E;  1S66 L;  5HSQ A;  1F9I A;  3F1N B;  2OWH A;  4HJ3 A;  1WA9 A;  3EWK A;  3NOT C;  5HDC A;  4I3I A;  2L0W A;  2V1B A;  3MXQ A;  3D72 A;  1T1A A;  4HJ4 A;  3C2W A;  1NWZ A;  5HD5 A;  2VV6 A;  4YWZ A;  4HQA A;  3H82 A;  3CWF A;  5J3W A;  5A8B A;  5F5Y A;  4H6J A;  4HOI A;  3HJK A;  2PDR A;  4WF0 A;  1EW0 A;  4BBT A;  4KUK A;  4HJ6 A;  4NXB A;  5HWW A;  1S4R A;  4DJ3 A;  3LIF A;  3UB7 A;  3K3C A;  1N9N A;  2H28 A;  2V9A A;  2J80 A;  2PR5 A;  1LSW A;  4PKY A;  4EW7 A;  2BAS A;  3SW1 A;  1LSX A;  1OTD A;  3UB6 A;  2V1A A;  3P7N A;  3E4P A;  1TS7 A;  1S1Y A;  3ZQ5 A;  5DKL A;  1D7E A;  4GS9 B;  2WKQ A;  4GHI A;  2QJ5 A;  3F1N A;  3UME A;  2YKF A;  1BYW A;  4DJ2 A;  2WKP A;  4EEP A;  5HZH A;  3K3D A;  3UB9 A;  3T50 A;  2Z6D A;  3NOP C;  3E4O A;  4EQ1 A;  4B9O A;  4KUO A;  3IS2 B;  4MN6 A;  3MJQ A;  2B02 A;  4LPZ A;  4JGR A;  2INW A;  2W27 A;  3B33 A;  4LRX C;  2V0U A;  1LL8 A;  4HP9 A;  2Z6C A;  5KIZ A;  5HD3 A;  5TBM A;  5G4Z A;  4EEU A;  4XT2 A;  1G28 A;  1GSW A;  4GS9 A;  2P7J A;  3RH8 B;  4WLA A;  4M4X A;  1F98 A;  2QKP A;  3PYP A;  3BY8 A;  4HIA A;  1T1C A;  5HDS A;  1P97 A;  4LRY C;  1TS8 A;  2L4R A;  2PYR A;  3FC7 A;  3E4Q A;  5EFW A;  1N9O A;  2EA9 A;  3LI8 A;  4MN5 A;  2A24 B;  2CMN A;  5AVE A;  3NHQ A;  4EET B;  2PD8 A;  2PD7 A;  1OT9 A;  4F3L B;  1S67 L;  3IS2 A;  4R38 A;  4HHD A;  3VOL A;  3UMD A;  3NOU C;  2KDK A;  2QJ7 A;  1DRM A;  4K08 A;  2V0W A;  1X0O A;  4GW9 A;  2M1C A;  5F68 A;  3CLO A;  3G6O A;  2QHK A;  5HDD A;  1VB6 A;  2JN7 A;  1DP8 A;  2D02 A;  2PYP A;  3F1O B;  3BWL A;  4I3A A;  1LT0 A;  3KX0 X;  2VV8 A;  1N9L A;  3UE6 A;  1S4S A;  3MQQ A;  1GSV A;  4LLO B;  1UWP X;  2L1M A;  3UB8 A;  1XJ6 A;  4HH3 A;  4JGP A;  3IBR A;  1OTI A;  2A24 A;  4NXE A;  4HP4 A;  3H82 B;  4F3L A;  1T1B A;  4H6J B;  1XFQ A;  4PKY G;  3OLO A;  4R70 A;  1XJ4 A;  4NXF A;  3LUQ A;  3A0V A;  4JGQ A;  3H9W A;  1D06 A;  4L9E A;  4L9G A;  2D01 A;  2ZBB A;  3EEH A;  4WL9 A;  1S1Z A;  2GJ3 A;  2OOL A;  4EES A;  5J4E A;  5I5L A;  4BBU A;  5F6A A;  4JGO A;  3ICY A;  1OJG A;  2HV1 A;  2VLG A;  3F1O A;  3A0S A;  4GHI B;  1XFN A;  5IU1 A;  1TS0 A;  1OT6 A;  4KQD A;  1ODV A;  3GDI A;  1XJ2 A;  1OTA A;  3RTY A;  2OWJ A;  1UGU A;  3CAX A;  1KOU A;  4R6L A;  4WUJ A;  3LIE A;  4I5S A;  4R3A A; 
#chains in the Genus database with same CATH topology
 1GSX A;  4P6Z M;  4EXO A;  2RL3 A;  1E3U D;  5AQ7 A;  5AVF A;  2W3D A;  3DTK A;  3G31 A;  1NJ4 A;  2EX6 A;  1V9Y A;  1O07 A;  4BBV A;  4QPR A;  3ZHH A;  4K91 A;  2HF6 A;  1KE4 A;  4HNB A;  2PBY A;  3R4K A;  5IS1 A;  1K4F A;  2IA2 A;  3KSF A;  3GSG A;  3CG5 A;  5TBM B;  4CLC A;  2W1T A;  1TS6 A;  3BM6 A;  1IYQ A;  4XT2 B;  4BEN A;  3G30 A;  2HJ9 C;  4C3Q A;  5E2H A;  2W1R A;  1YMS A;  1ONH A;  2VX8 A;  2PU4 A;  1LHY A;  3E0Y A;  4S2M A;  2XFS A;  3BW6 A;  2J9P A;  1P0Z A;  4ETX A;  1V9Z A;  1FIK A;  3MFX A;  3LEZ A;  3B47 A;  3QP6 A;  4NXG A;  2HP6 A;  5G4Y A;  2Y2Q A;  4HY8 A;  4OOL A;  1VQQ A;  4ZJ3 A;  5K5B A;  5DJT A;  2HDQ A;  1ES4 A;  4P87 A;  1K57 C;  3OPP A;  3CJM A;  4HH2 A;  5HWT A;  1PNE A;  2JHE A;  1BLP A;  3EGX C;  4OLD A;  3OOV A;  4I38 A;  3H7W A;  2H0T A;  1VET A;  3TE8 A;  2ZC5 B;  2UWX A;  2H5S A;  3HUM A;  2EWW A;  2WGW A;  3KYE A;  3VE3 A;  4BD1 A;  3BEB A;  4BJP A;  2OSU A;  4I39 A;  1CI8 A;  1GA0 A;  1CEF A;  1TF1 A;  4JF4 A;  2EX2 A;  4QU3 A;  1TEM A;  1WA9 A;  5DTK A;  3MXR A;  3KSG A;  3ZG7 B;  2ZM8 A;  3UPN A;  2Q9M A;  1SKF A;  1KGF A;  2X71 A;  3UB5 P;  1PZO A;  2JKR I;  4E3M A;  1K6R A;  3ZYT A;  1ZG4 A;  3D72 A;  5KMW A;  1T1A A;  3BFC A;  4GJ4 A;  4HJ4 A;  5HD5 A;  4YWZ A;  3VMA A;  3ZNY A;  5A8B A;  5M19 A;  4H6J A;  4HOI A;  4QWO A;  5EVI A;  4DN0 A;  2Y2H A;  1FR6 A;  3U2A A;  3ITA A;  2HZ5 A;  4HJ6 A;  2XQZ A;  5HWW A;  4DJ3 A;  4JXG A;  3S4X A;  2V9A A;  3B42 A;  5FAP A;  2B95 A;  4O0P A;  1OTD A;  3Q82 A;  1TD5 A;  2WUQ A;  3P7N A;  2ZC7 A;  1TS7 A;  3MZD A;  3ZQ5 A;  2XA7 M;  4Y5F A;  1H8Y A;  4LV0 A;  4BL3 A;  4GZB A;  3IH8 A;  3M6H A;  5TFQ A;  4NG2 A;  1ZKJ A;  5EUA A;  3MQ0 A;  3F1N A;  3TW8 A;  4WZ5 C;  1BTL A;  4RA7 A;  4RYE A;  2O9C A;  3GTC A;  1BYW A;  4FH2 A;  4Q8I A;  3K2N A;  1NLY A;  5HZH A;  1BT5 A;  3E2K A;  4UAA A;  3TOI A;  3HUN A;  3OPH A;  4EQ1 A;  3QNC A;  5A90 A;  3NIA A;  3IS2 B;  2Y2I A;  1HVB A;  4MN6 A;  1G68 A;  5CHM A;  3MJQ A;  2V1Z A;  1CJF A;  3IWO A;  3EEA A;  3BFE A;  3IXG A;  2J3W A;  2INW A;  2W27 A;  4GDN A;  3B33 A;  3UNW A;  2VA0 A;  2Z6C A;  5KZH A;  4OOM A;  5GLD A;  4B93 A;  4ETZ A;  3W8K A;  4LGW A;  2IWD A;  4EEU A;  3SS3 A;  2C5W B;  2XSS A;  1GSW A;  2Y2M A;  2P7J A;  4WLA A;  4M4X A;  1MBL A;  1YSQ A;  5HAQ A;  4HIA A;  3VP2 A;  3T1X A;  4LRY C;  4UQI M;  1FQG A;  5DF7 A;  3FC7 A;  3E4Q A;  3BRM A;  1K56 A;  4KZ4 A;  5HAI A;  4EET B;  5CEB A;  1K55 A;  4KZ5 A;  2WKE A;  2ZD8 A;  4DXC A;  1ACF A;  4F3L B;  3A3D A;  3IXD A;  2QZ6 A;  4S2K A;  1S67 L;  4GKU A;  1TDG A;  4HHD A;  4D2O A;  3IF6 C;  4D60 A;  3KO6 A;  4A5R A;  3UE0 A;  3PBT A;  4R3B A;  5DF9 A;  1XPB A;  3NDG A;  3N4I A;  2QHK A;  1KVM A;  2XR0 A;  4ID4 A;  4O7D A;  3VP1 A;  3NDE A;  5I94 A;  1YAX A;  3BWL A;  3F1O B;  1ES5 A;  5E43 A;  4E3J A;  2VV8 A;  4YFM A;  1Q2Q A;  3GMW A;  3MQQ A;  3IQA A;  4O01 A;  1GSV A;  1K55 C;  5GLB A;  1UWP X;  4KZ7 A;  1JWV A;  1VEU A;  2ZMF A;  1IKI A;  5TJJ A;  3O86 A;  2Y2P A;  4H6J B;  1L0F A;  3UDX A;  1XFQ A;  4PKY G;  3OLO A;  1XJ4 A;  3G2Y A;  4NXF A;  1D06 A;  4MBH A;  3PR6 A;  2IWC A;  4PM5 A;  4OPZ A;  2WKH A;  1NYM A;  2OOL A;  3CZD A;  3T4Q A;  2VGL M;  3OC2 A;  1HLU P;  1BZA A;  1MWU A;  5FQJ A;  1OJG A;  3MMH A;  3C4O A;  4II7 A;  1XFN A;  1TS0 A;  1ESI A;  3ZVT A;  1S0W A;  3ISG A;  1ODV A;  3RXW A;  1OTA A;  2OWJ A;  3PBO A;  3CAX A;  4Z9Q A;  5FAT A;  2EX8 A;  5M18 A;  1Z6F A;  2P04 A;  4N9K A;  3FPV A;  2VGK A;  2H0Y A;  1K54 C;  3PBS A;  3F1P B;  3O3V A;  1IKG A;  3IHA A;  3GEC A;  3PHY A;  3FZC A;  3DTM A;  1NLZ A;  2W3H A;  2PR6 A;  4KG2 A;  2HDU A;  4X69 A;  2Z2L B;  1IOU A;  3G2Z A;  2LB9 A;  4ZJ2 A;  4HEF A;  5J8X A;  3WRZ A;  4JF5 A;  2QWS A;  4IUK A;  1ZTU A;  3A3I A;  1MZU A;  1BLS A;  3R7W B;  4M3K A;  3TSG A;  3PAG A;  4LV3 A;  3VE4 A;  1LSV A;  1OTB A;  1WYB A;  2HPB A;  1YLY A;  5E2F A;  3V3S A;  4JKT A;  2GZA A;  1DJB A;  4I3J A;  5HWV A;  3M2K A;  2JCH A;  3IXB A;  4OKP A;  4N1H A;  1YT4 A;  5FAO A;  2EFX A;  3HUO A;  3WS4 A;  2YKH A;  4MDZ A;  4XUZ A;  4YIN A;  5TGF A;  3FYZ A;  4UA6 A;  3FKW A;  1YPR A;  5AQA A;  4E6W A;  4EBL A;  3MZE A;  4OQH A;  2KLI A;  2ZC6 B;  3M2J A;  5DJU A;  2P08 A;  2Z2M B;  2WKI A;  4MEZ A;  4RX2 A;  1H8Z A;  2VK3 A;  1CQA A;  4PAU A;  2VZW A;  5CGS A;  4S2N C;  2ZMV A;  1NXY A;  1ES2 A;  3DWK A;  3T12 B;  3RXX A;  3LIA A;  4QD4 A;  5EVE A;  4IHQ A;  5GHX A;  1XKZ A;  1IEM A;  3EOI A;  2Y55 A;  1MWR A;  3VP0 A;  1T18 A;  3LGO A;  4WEJ A;  1BLH A;  3Q1F A;  2BG1 A;  3P09 A;  2KOI A;  3BYD A;  4KG5 A;  1ZHH B;  3QP2 A;  2ZM0 A;  1L2S A;  3PBN A;  3HLF A;  2L0W A;  1QME A;  4Y13 A;  2V1B A;  1RP5 A;  4OPQ A;  4ZTK A;  5A93 A;  1W8Q A;  1ERO A;  1SHV A;  4OPR A;  3BFD A;  5BOH A;  3SH9 A;  5F5Y A;  2PDR A;  4WF0 A;  2XD5 A;  4X6T A;  4JXV A;  3ZG5 A;  1W63 M;  2XDM A;  4IBX A;  4KUK A;  3ZFZ A;  3T1R A;  2O9A A;  3LIF A;  4IBR A;  2G7U A;  3K3C A;  1K38 A;  1L0E A;  4AFI A;  1LSW A;  2BAS A;  3SW1 A;  2B5R A;  1DJC A;  4KQO A;  2V1A A;  1H8M A;  2EX9 A;  1PIO A;  4R0Q A;  5F82 A;  2GNX A;  1GCE A;  1KDS A;  3QNB A;  1CK3 A;  2WKQ A;  5EV0 A;  3UO9 A;  3UPP A;  4OP8 A;  3D3O A;  3CPT A;  4EBP A;  3VP3 A;  5DTS A;  4IJG A;  1F5M A;  3UME A;  3IH9 A;  4S2P A;  4FCF A;  4Q0I A;  4DJ2 A;  2WKP A;  3UB9 A;  4BD0 A;  2QMI A;  3T50 A;  4IVI A;  2EXA A;  3NY4 A;  2ZQA A;  5EVL A;  1ONG A;  4BMW A;  4DF6 A;  4CJN A;  3O88 A;  3T4T A;  1WYC A;  1PWC A;  5CGW A;  4JXW A;  3VSK A;  5IT5 A;  4Y0T A;  4K0W A;  3ZG9 B;  3DW0 A;  3MBZ A;  5EEC A;  4LPZ A;  4O8G A;  4CLC C;  1ZC2 A;  3QP5 A;  4LRX C;  1MKM A;  1WE4 A;  4KZ8 A;  4P6Z S;  2WYX A;  2NUP C;  1I2W A;  2OLU A;  2X01 A;  4EQI A;  4E3I A;  1DY6 A;  1GHP A;  1G28 A;  1GA9 A;  4GS9 A;  4DE0 A;  4P85 A;  5A91 A;  3QHY A;  5TR7 A;  3U4L P;  4X68 A;  3HCY A;  3IX3 A;  5HDS A;  3HBR A;  5DF8 A;  2L4R A;  3KSH A;  4YNR A;  5EFW A;  3Q7V B;  2XD1 A;  4MN5 A;  2A24 B;  2O9B A;  2Y79 A;  4ZDX A;  5HPF A;  5EOE A;  3NHQ A;  4CLC D;  3N7W A;  3GV9 A;  1OT9 A;  3D4F A;  1KGG A;  3OPR A;  5DVA A;  2OLV A;  4HBT A;  3FPW A;  4R38 A;  2ZJ9 A;  3VOL A;  2WAE A;  2VGJ A;  3LFV A;  4K08 A;  1W5D A;  4WZ4 A;  3OCN A;  2FFF B;  5HDD A;  5HW3 A;  1VB6 A;  2ZQ8 A;  3BFG A;  2JE5 A;  4EV4 A;  5CTN A;  5HL6 A;  4LCM A;  2J7V A;  2ACG A;  4I3A A;  1LT0 A;  5FQI A;  2E8I A;  1ES3 A;  1N9L A;  3VSL A;  1CEG A;  5FA7 A;  1LL5 A;  5FDS A;  1TVF A;  4EWF A;  5EVI C;  4JGP A;  1A0K A;  3IBR A;  4NXE A;  3WS2 A;  3BEC A;  3D9Y A;  3W4P A;  3SH7 A;  1T1B A;  1Q2P A;  4GNU A;  1PWG A;  3BQ8 A;  4R23 A;  5AJG A;  3N6I A;  4UEY A;  1YLP A;  4OQG A;  5L07 A;  4R70 A;  4WMC A;  4OON A;  4X1M A;  4B4Z A;  2H10 A;  4DKI A;  3CUE A;  3EEH A;  1ALQ A;  3CMZ A;  3S7N A;  4MN7 A;  3VV4 A;  3FKV A;  5FSR A;  2GDN A;  5I5L A;  2FH5 A;  4BBU A;  3IBJ A;  1FCM A;  5EVI D;  4JGO A;  4CLC B;  2M7U A;  2W1T B;  2WGV A;  2Q0O A;  4Y0U A;  1AWI A;  1KDW A;  4Y0O A;  5KSH A;  3L9K A;  1AXB A;  4NEE D;  2EWV A;  3G32 A;  3E2L A;  2XA7 S;  4KQD A;  2Y2J A;  1BUE A;  3GQZ A;  3GVB A;  3VOZ A;  5GHY A;  1XJ2 A;  1UGU A;  4OQI A;  4FD8 A;  2JKG A;  4R4S A;  4RVA A;  4Y2F A;  1NZU A;  3HVF A;  1U60 A;  4WUJ A;  5CGX A;  4QJG A;  1SDE A;  4R3A A;  5MC7 A;  2XGN A;  4WEK A;  4NK3 A;  4LEN A;  3LIB A;  2RCX A;  1PW1 A;  1W7F A;  2G2U A;  5JYO A;  3H7W B;  1VET B;  1PWD A;  2W3G A;  2W3E A;  4OLG A;  4ME4 A;  1G6O A;  4MLL A;  3Q07 A;  3VP4 A;  2WGW B;  2WZX A;  2OAQ 1;  3HLE A;  3ULF A;  5CHJ A;  1T19 A;  3LIC A;  4ZBE A;  3MR0 A;  4LV2 A;  4L9F A;  1NRF A;  2WKR A;  3HJI A;  2KX6 A;  5E2G A;  4C6Y A;  3CI6 A;  3S22 A;  2K2N A;  1IFQ A;  2W0N A;  4OP5 A;  3W4Q A;  3G34 A;  3BY9 A;  3V3R A;  1JTG A;  4EER A;  5G18 A;  1DP9 A;  5CER A;  1XGJ A;  5FL3 A;  4DRT A;  5DTT A;  2VEA A;  1SCW A;  2WGI A;  1DJA A;  4X25 A;  2WAD A;  2Y2G A;  5J7E A;  2DMW A;  2J9O A;  3C38 A;  2A2L A;  1GHI A;  3GR2 A;  4E04 A;  2ZC4 B;  1FCN A;  2JKT I;  3AGF A;  1FSY A;  3IT9 A;  4FSF A;  2A49 A;  3MF0 A;  1XJ3 A;  5EVI B;  4E3O A;  4UQI S;  3LID A;  4DE3 A;  4KQR A;  2I9V A;  2V20 A;  4Z1W A;  1XX2 A;  3C8C A;  4S2L A;  3W4O A;  1OPX A;  1K56 D;  4QY6 A;  4QB8 A;  2M7V A;  4FUW A;  1FIL A;  2FZ0 A;  3LI9 A;  3A0R A;  3HLG A;  4HBU A;  4LRZ E;  1S66 L;  4UA9 A;  5GHZ A;  5HPI A;  1F9I A;  4ESP A;  3F1N B;  4HJ3 A;  3UDF A;  1FOF A;  3EWK A;  3A3E A;  4WEL A;  4I3I A;  1QMF A;  2VKS A;  3MXQ A;  1PI4 A;  2B18 A;  3LEQ A;  4X53 A;  4KZ3 A;  3PXP A;  3C2W A;  1VM1 A;  3H82 A;  3HL9 A;  2BTF P;  4GB7 A;  1M40 A;  1KE3 A;  3HLW A;  1EW0 A;  4MBK A;  3SS5 A;  5FAQ A;  1MWT A;  4BBT A;  3Q81 A;  1S4R A;  5HFO A;  3LR5 A;  1O7E A;  3UE1 A;  1N9N A;  3V67 A;  2H28 A;  1MC0 A;  5CX7 A;  2PR5 A;  4WYY A;  3WWX A;  4PM7 A;  3N8L A;  1K0K A;  1LSX A;  3DBA A;  4K0X A;  4PM6 A;  3MKE A;  3E4P A;  1S1Y A;  4ZAM A;  1EI5 A;  2XRO A;  3WS5 A;  1YLZ A;  1ERQ A;  4GD8 A;  1P9W A;  1RGY A;  2QJ5 A;  3MKF A;  4HES A;  3CIT A;  1IYS A;  3SZT A;  4G3K A;  1PFL A;  2K31 A;  2HDS A;  2ZL1 A;  3FV7 A;  4PM9 A;  1E3U A;  5L2F A;  2Z6D A;  3NOP C;  2EXB A;  4KQQ A;  3E4O A;  1H3Q A;  4ARZ A;  1M6K A;  4MNR A;  4B9O A;  2PBD P;  2HDR A;  5GL9 A;  2R9W A;  4H8R A;  1H5X A;  2XRN A;  4B88 A;  1BLC A;  5CRF A;  2HJE A;  2B02 A;  3V5M A;  2Y2O A;  4EU0 A;  1G5U A;  2EFU A;  3V39 A;  1KGE A;  3HLD A;  3L7H A;  5GLC A;  1S6R A;  3AGE A;  2XEP A;  2ZQ7 A;  3A3J A;  1YQS A;  3T4L A;  5KIZ A;  1SDN A;  2Y8H A;  4MBF A;  4ZRR A;  3E98 A;  3OZH A;  5G4Z A;  5IHV A;  4PMA A;  3T4J A;  3DTE A;  5FQ9 A;  5CED A;  3I7J A;  3PYP A;  1T1C A;  3LO7 A;  4R4R A;  5EPH A;  3QP8 A;  1VEU B;  1P9R A;  3LI8 A;  3QP4 A;  2CMN A;  4E6X A;  1W63 Q;  5DFY A;  4X56 A;  2PD8 A;  1ZG6 A;  1YM1 A;  3O5Y A;  4WM9 A;  2Q9N A;  2Y2N A;  3IX8 A;  1STZ A;  2I72 A;  3IS2 A;  1SZV A;  4Q0J A;  4BLM A;  2KDK A;  2QJ7 A;  1DRM A;  2A3U A;  2V0W A;  4OQ0 A;  3IX4 A;  5F68 A;  4JF6 A;  1JWP A;  3ZCZ A;  3ITB A;  1K57 A;  2Y2K A;  3UPO A;  3C30 A;  3DWZ A;  2JN7 A;  1NYY A;  2D02 A;  1YLW A;  1MKI A;  3JVV A;  1XA1 A;  4GLQ A;  3KX0 X;  4EUV A;  3UE6 A;  1PW8 A;  1IEL A;  1YSP A;  4LLO B;  5AQ9 A;  3BFF A;  2AVX A;  3P98 A;  2XF3 A;  4S2I A;  3UB8 A;  4HH3 A;  2JBF A;  4N9L A;  1OTI A;  4RX3 A;  4XXR A;  4BL2 A;  3P01 A;  3KYQ A;  2HGV A;  1CI9 A;  3H82 B;  4OVD A;  4P0M A;  4F3L A;  1XP4 A;  4DMZ A;  2QYB A;  3TRC A;  2PT7 A;  2JKF A;  3HLC A;  2DNS A;  4CQH A;  3HLB A;  1ESU A;  3A0V A;  4JGQ A;  1NRJ A;  1F2K A;  4L9G A;  2D01 A;  3WRT A;  2O0Y A;  5FI2 A;  2ZBB A;  3UDI A;  4KG6 A;  1S1Z A;  2GJ3 A;  1NY0 A;  3RJU A;  3TJZ C;  5J4E A;  4B4X A;  4GDB A;  1ERM A;  4Q0H A;  2UV0 E;  5F6A A;  1SKO A;  2DCF A;  2J8Y A;  1YMX A;  4JBF A;  5HAR A;  4C75 A;  3UN7 A;  5AQB A;  5L8M A;  3WS1 A;  4XUX A;  2VLG A;  3F1O A;  3RFB A;  4G3V A;  3A0S A;  5IU1 A;  2C6W B;  3EGD C;  1MPL A;  1YLJ A;  3G4P A;  3ZVW A;  1I2S A;  1W79 A;  3ZG8 B;  2JKR M;  1FR1 A;  3RTY A;  2ZL1 B;  1J3W A;  4KZ6 A;  1PYY A;  5HX9 A;  4WZ5 A;  1KOU A;  4ARZ B;  4BWI A;  2R9X A;  4GOG A;  1YKD A;  3PAE A;  2ZQC A;  4I5S A;  3BLS A;  3S7O A;  1XGI A;  2G2W A;  1RGZ A;  2VV7 A;  4S2O A;  2ZOI A;  5DFX A;  4WN5 A;  2GX5 A;  3QP1 A;  1J9M A;  4FTX A;  3T4K A;  2V8F A;  2DRW A;  5CHU A;  3EQV A;  5FEG A;  2Y91 A;  2NUT C;  4PM8 A;  3IWQ A;  4IVK A;  5EE8 A;  1TDL A;  3C7U A;  3NI9 A;  3MZF A;  4ZJ1 A;  1OJ5 A;  2K7S A;  2PHY A;  4OOY A;  4CLC E;  3UE3 A;  2Y59 A;  3MQO A;  1JNU A;  4HI4 A;  1C3B A;  2O99 A;  3MS6 A;  5E2E A;  3NC8 A;  3A3F A;  1OTE A;  3TG9 A;  1CF0 A;  2WK0 A;  1UWN X;  1NZO A;  5F69 A;  1D1J A;  1LI0 A;  3LYX A;  4E3L A;  2PRF A;  3C5A A;  2ZOH A;  3ZGA B;  4U0X A;  1E25 A;  1DP6 A;  3F1P A;  1Y28 A;  1PZP A;  3JPU A;  1JTD A;  5LBR A;  4Y3I A;  4RQ9 A;  3Q7Z A;  3FG8 A;  5FQK A;  5FEF A;  3DTI A;  1PRQ A;  3IF5 A;  2HP9 A;  4GCZ A;  3PBR A;  3IF6 A;  3NJA A;  3MXS A;  3OBF A;  4YOF A;  5DKK A;  2R78 A;  2XFT A;  2ZM2 A;  3SOI A;  4MCW A;  3NCK A;  3T1Q B;  5F1G A;  4LFU A;  5FDH A;  4E3N A;  5HSQ A;  3CPT B;  3N8S A;  3C4P A;  5EOO A;  2OWH A;  4UHU A;  4X55 A;  4IED A;  2LB5 A;  3R7W A;  1GHM A;  5EM0 A;  1LLB A;  3NOT C;  5HDC A;  3KSI A;  3NUL A;  5U47 A;  4CPK A;  1IYP A;  4DDY A;  1NWZ A;  1YLT A;  1FCO A;  2VV6 A;  4NET A;  1N4O A;  3N8R A;  4HQA A;  3CWF A;  2E8J A;  2JC7 A;  5J3W A;  1MXO A;  1HZO A;  3HJK A;  4PPR A;  5EM1 A;  3CUE C;  3DAV A;  2ZQ9 A;  5L10 A;  4KEN B;  4NXB A;  1Z09 A;  4PHT A;  2ZQD A;  3UB7 A;  2MJ6 A;  5FI6 A;  4MMN A;  3V50 A;  2J3T C;  3JVU A;  2J80 A;  4L0L A;  5CEC A;  4PKY A;  4EW7 A;  3UB6 A;  1L3L A;  4JXS A;  2BLS A;  4U3T A;  1BSG A;  5GLA A;  3ZNT A;  1SKO B;  5DKL A;  1D7E A;  4WMC D;  4DDS A;  4GS9 B;  4GHI A;  3LY4 A;  1FSW A;  1JWZ A;  4E3K A;  2YKF A;  3M6B A;  3PBQ A;  4EEP A;  3K3D A;  2P9V A;  1K25 A;  3LCE A;  2FFY A;  2J3T D;  3VFF A;  3ZDJ A;  4F94 A;  3FWL A;  4DXB A;  2JKT M;  5HAP A;  3OCL A;  4KUO A;  4GN2 A;  3S1Y A;  2XLN A;  4QY5 A;  4FH4 A;  1K54 A;  1G6A A;  4JGR A;  3VFH A;  4U0T A;  1KVL A;  2V0U A;  1LL8 A;  4R1G A;  2V8C A;  4HP9 A;  4LV1 A;  3SS4 A;  5HD3 A;  5TBM A;  4OH0 A;  3OPL A;  4S2J A;  4XT2 A;  2X02 A;  2QPN A;  4QHC A;  3RH8 B;  3UY6 A;  1F98 A;  4Y7P A;  1KE0 A;  5A92 A;  2QKP A;  4KZ9 A;  5FI7 A;  5FQQ A;  3S7Q A;  2W3F A;  3BY8 A;  1H0M A;  1P97 A;  4GD6 A;  1EWZ A;  1TS8 A;  1XXM A;  1XA7 A;  2PYR A;  2P74 A;  1N9O A;  2EA9 A;  4WBG A;  2V2F F;  1E4D A;  3LY3 A;  1MY8 A;  5AVE A;  2PD7 A;  2Y2L A;  2WAF A;  3CHW P;  3MFD A;  3BQA A;  2XK1 A;  4X1L A;  5D3O A;  4JLF A;  4EBN A;  3W2Z A;  4IUH A;  3UMD A;  3NOU C;  4DE2 A;  1X0O A;  1K6S A;  4GW9 A;  2M1C A;  1LL9 A;  5KSC A;  2ZMA A;  2XH9 A;  3PTE A;  5CTM A;  3CLO A;  3G6O A;  3IHB A;  3NEC A;  3IF6 B;  4LCL A;  4P6B A;  1HTZ A;  4S2N A;  3T1S A;  2ZC3 B;  1DP8 A;  2OAP 1;  2PYP A;  5CXW A;  3O87 A;  3LR4 A;  5FQM A;  1Y54 A;  3GRJ A;  2VGL S;  1MWS A;  3AGD A;  3LR3 A;  4KZA A;  4G3W A;  5FAS A;  5L09 A;  1S4S A;  2ZLY A;  3IXH A;  3VOY A;  1K4E A;  2PAV P;  3HRE A;  2L1M A;  4Y17 A;  1XJ6 A;  1N9B A;  3Q7V A;  3NBL A;  3IWI A;  5HL1 A;  2A24 A;  4JPM A;  2HP5 A;  3WS0 A;  3B3X A;  4NKP A;  3KYZ A;  5C5K A;  3LR0 A;  4HP4 A;  2PU2 A;  5F83 A;  3BJN A;  2IWB A;  1HD8 A;  3S7P A;  3BLM A;  4N92 A;  4N1X A;  5JYP A;  1Y4O A;  3LUQ A;  1IYO A;  3H9W A;  4L9E A;  1L0D A;  4DE1 A;  1LI9 A;  2WZZ A;  3ZG0 A;  3G35 A;  4WL9 A;  1L0G A;  4EES A;  3SH8 A;  3JYI A;  2OV5 A;  1RCJ A;  1VHM A;  2VJW A;  3ICY A;  2HV1 A;  4R3J A;  4OPY A;  4Y15 A;  3C7V A;  4GHI B;  1BUL A;  1W8Y A;  1JVJ A;  3EQU A;  3T4O A;  1I5Q A;  4FOF A;  1OT6 A;  3T4S A;  4EUZ A;  3GDI A;  1OME A;  4UA7 A;  2P9V B;  3MSH A;  1PI5 A;  4BQM A;  2CC1 A;  4KZB A;  5M1A A;  5F1F A;  4R6L A;  3LIE A;  2Y4A A; 
#chains in the Genus database with same CATH homology
 4WEK A;  3LIB A;  1GSX A;  4P6Z M;  4EXO A;  2VV7 A;  3GEC A;  2ZOI A;  3PHY A;  5DFX A;  5AVF A;  4WN5 A;  2W3D A;  2GX5 A;  3H7W B;  1NLZ A;  2W3H A;  2W3G A;  2W3E A;  2PR6 A;  1G6O A;  4ME4 A;  3T4K A;  1V9Y A;  4BBV A;  2OAQ 1;  3ULF A;  3EQV A;  4QPR A;  1IOU A;  1T19 A;  3LIC A;  2LB9 A;  2NUT C;  3MR0 A;  2HF6 A;  4L9F A;  4HNB A;  3R4K A;  5IS1 A;  2WKR A;  3HJI A;  2KX6 A;  2IA2 A;  3KSF A;  3CI6 A;  2K2N A;  1IFQ A;  2W0N A;  5TBM B;  1OJ5 A;  4CLC A;  2K7S A;  2W1T A;  1TS6 A;  2QWS A;  3BY9 A;  4IUK A;  1ZTU A;  2PHY A;  1MZU A;  4EER A;  1DP9 A;  3R7W B;  4CLC E;  3UE3 A;  4XT2 B;  2HJ9 C;  5FL3 A;  2W1R A;  2VEA A;  1LSV A;  3MQO A;  1OTB A;  1JNU A;  3VE4 A;  2VX8 A;  4HI4 A;  2O99 A;  3E0Y A;  2GZA A;  4I3J A;  5HWV A;  3BW6 A;  5J7E A;  2DMW A;  1OTE A;  1P0Z A;  3C38 A;  2A2L A;  4E04 A;  4ETX A;  2JKT I;  1UWN X;  1V9Z A;  3MFX A;  5F69 A;  4FSF A;  3B47 A;  2YKH A;  4MDZ A;  4NXG A;  3MF0 A;  1XJ3 A;  5G4Y A;  3LYX A;  4HY8 A;  4UQI S;  4OOL A;  3LID A;  2KLI A;  2ZOH A;  5K5B A;  5DJU A;  5DJT A;  2P08 A;  1DP6 A;  3F1P A;  2I9V A;  1Y28 A;  4PAU A;  4HH2 A;  2VZW A;  5HWT A;  2JHE A;  4Z1W A;  5LBR A;  3EGX C;  4Y3I A;  2ZMV A;  3OOV A;  4RQ9 A;  3C8C A;  1OPX A;  3FG8 A;  3H7W A;  4I38 A;  3TE8 A;  3LIA A;  4IHQ A;  2EWW A;  2M7V A;  3EOI A;  3VE3 A;  4GCZ A;  3PBR A;  1T18 A;  4WEJ A;  4BJP A;  3NJA A;  4YOF A;  3OBF A;  4I39 A;  5DKK A;  2FZ0 A;  3LI9 A;  2R78 A;  2KOI A;  3A0R A;  4LRZ E;  1S66 L;  4MCW A;  1TF1 A;  5HPI A;  5HSQ A;  1F9I A;  1ZHH B;  3F1N B;  2OWH A;  4HJ3 A;  1WA9 A;  3EWK A;  3KSG A;  2LB5 A;  4WEL A;  3R7W A;  3PBN A;  3NOT C;  5HDC A;  4I3I A;  2L0W A;  3KSI A;  2JKR I;  2V1B A;  2VKS A;  3MXQ A;  3ZYT A;  2B18 A;  3D72 A;  1T1A A;  4GJ4 A;  4HJ4 A;  3PXP A;  3C2W A;  1NWZ A;  5HD5 A;  2VV6 A;  4YWZ A;  4HQA A;  3H82 A;  3CWF A;  5J3W A;  5A8B A;  5F5Y A;  4H6J A;  4HOI A;  3HJK A;  2PDR A;  4DN0 A;  4WF0 A;  3CUE C;  1EW0 A;  3U2A A;  1W63 M;  4BBT A;  4KUK A;  4HJ6 A;  4NXB A;  5HWW A;  1S4R A;  2O9A A;  4PHT A;  4DJ3 A;  3LIF A;  3UB7 A;  2MJ6 A;  3LR5 A;  2G7U A;  3K3C A;  1N9N A;  4MMN A;  3V67 A;  2H28 A;  1MC0 A;  2J3T C;  2V9A A;  3JVU A;  3B42 A;  5CX7 A;  2J80 A;  4L0L A;  4AFI A;  2PR5 A;  1LSW A;  4PKY A;  4EW7 A;  2BAS A;  3SW1 A;  4O0P A;  1LSX A;  1OTD A;  3DBA A;  3UB6 A;  1TD5 A;  4KQO A;  2V1A A;  1H8M A;  3P7N A;  3E4P A;  1TS7 A;  1S1Y A;  3ZQ5 A;  2GNX A;  2XA7 M;  4Y5F A;  5DKL A;  1D7E A;  2XRO A;  4GS9 B;  2WKQ A;  1P9W A;  3D3O A;  4GHI A;  2QJ5 A;  3F1N A;  3MQ0 A;  4IJG A;  3TW8 A;  1F5M A;  3UME A;  2YKF A;  2O9C A;  3CIT A;  4Q0I A;  1BYW A;  3PBQ A;  4DJ2 A;  4G3K A;  2WKP A;  3K2N A;  1NLY A;  2K31 A;  4EEP A;  5HZH A;  3K3D A;  3UB9 A;  3T50 A;  2Z6D A;  3NOP C;  3E4O A;  1H3Q A;  2J3T D;  4ARZ A;  4EQ1 A;  4BMW A;  4B9O A;  2JKT M;  3OCL A;  4KUO A;  3IS2 B;  3T4T A;  4MN6 A;  3MJQ A;  2XRN A;  5IT5 A;  3EEA A;  2HJE A;  2B02 A;  2J3W A;  4LPZ A;  4JGR A;  4EU0 A;  2INW A;  4O8G A;  2W27 A;  4CLC C;  3B33 A;  1MKM A;  4LRX C;  2V0U A;  1LL8 A;  4P6Z S;  2VA0 A;  4HP9 A;  2Z6C A;  2NUP C;  3T4L A;  5KIZ A;  2Y8H A;  4OOM A;  4ZRR A;  5HD3 A;  5TBM A;  4B93 A;  4ETZ A;  3E98 A;  5G4Z A;  4EEU A;  3T4J A;  4XT2 A;  2XSS A;  1G28 A;  1GSW A;  4GS9 A;  2P7J A;  3RH8 B;  4WLA A;  4M4X A;  1F98 A;  2QKP A;  3S7Q A;  1YSQ A;  2W3F A;  3PYP A;  3BY8 A;  4HIA A;  1T1C A;  3HCY A;  5HDS A;  1P97 A;  4LRY C;  1TS8 A;  4UQI M;  2L4R A;  3KSH A;  2PYR A;  4YNR A;  3FC7 A;  3E4Q A;  5EFW A;  1P9R A;  1N9O A;  2EA9 A;  3LI8 A;  4MN5 A;  2A24 B;  2CMN A;  2O9B A;  2Y79 A;  1W63 Q;  5HPF A;  5DFY A;  3NHQ A;  5AVE A;  4CLC D;  4EET B;  2PD8 A;  2PD7 A;  3O5Y A;  1OT9 A;  3BQA A;  4F3L B;  1STZ A;  1S67 L;  3IS2 A;  3FPW A;  4R38 A;  4HHD A;  3VOL A;  3W2Z A;  4IUH A;  4Q0J A;  3UMD A;  3KO6 A;  3NOU C;  2KDK A;  2QJ7 A;  3LFV A;  1DRM A;  4K08 A;  2V0W A;  3PBT A;  1X0O A;  4GW9 A;  2M1C A;  5DF9 A;  5F68 A;  3OCN A;  3CLO A;  3G6O A;  2QHK A;  5HDD A;  1VB6 A;  3C30 A;  5HL6 A;  2JN7 A;  1DP8 A;  2OAP 1;  2D02 A;  2PYP A;  3LR4 A;  3BWL A;  3F1O B;  1YAX A;  3JVV A;  4I3A A;  2VGL S;  1LT0 A;  4GLQ A;  3KX0 X;  3LR3 A;  2VV8 A;  1N9L A;  4EUV A;  3UE6 A;  4G3W A;  1S4S A;  3MQQ A;  1YSP A;  4O01 A;  1GSV A;  4LLO B;  1UWP X;  2L1M A;  3UB8 A;  1XJ6 A;  4HH3 A;  4JGP A;  3IBR A;  1OTI A;  2ZMF A;  2A24 A;  4NXE A;  3P01 A;  4NKP A;  3KYZ A;  3KYQ A;  5C5K A;  3LR0 A;  4HP4 A;  2HGV A;  3BJN A;  5TJJ A;  3H82 B;  3S7P A;  4F3L A;  1T1B A;  4H6J B;  4DMZ A;  2QYB A;  1XFQ A;  3BQ8 A;  5AJG A;  3TRC A;  4PKY G;  2PT7 A;  4UEY A;  3OLO A;  4R70 A;  1XJ4 A;  4CQH A;  4NXF A;  3LUQ A;  3A0V A;  4JGQ A;  3H9W A;  1D06 A;  4L9E A;  3PR6 A;  1NRJ A;  4L9G A;  2D01 A;  2O0Y A;  2ZBB A;  3CUE A;  3EEH A;  1S1Z A;  2GJ3 A;  4WL9 A;  2OOL A;  3S7N A;  3TJZ C;  4EES A;  5J4E A;  4MN7 A;  3VV4 A;  5I5L A;  2FH5 A;  4BBU A;  3IBJ A;  4Q0H A;  3T4Q A;  2VGL M;  3OC2 A;  5F6A A;  4JGO A;  4CLC B;  2M7U A;  2W1T B;  1VHM A;  2VJW A;  3ICY A;  1OJG A;  4R3A A;  2HV1 A;  5L8M A;  3MMH A;  2VLG A;  3F1O A;  3RFB A;  5KSH A;  4G3V A;  4II7 A;  3A0S A;  4GHI B;  1XFN A;  5IU1 A;  3EGD C;  1TS0 A;  4NEE D;  3EQU A;  3T4O A;  2EWV A;  4FOF A;  1OT6 A;  2XA7 S;  4KQD A;  1ODV A;  3T4S A;  2JKR M;  3GDI A;  1XJ2 A;  1OTA A;  3RTY A;  2OWJ A;  1UGU A;  3PBO A;  3CAX A;  2P04 A;  1KOU A;  4ARZ B;  3FPV A;  4BWI A;  4Y2F A;  4R6L A;  3PBS A;  4WUJ A;  1YKD A;  3LIE A;  4I5S A;  3F1P B;  3S7O A;  5MC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...