5HWTA

Crystal structure of apo-pas1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
b'GAMALYEFVGLLDAHGNVLEVNQVALEGGGITLEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
molecule tags Transferase
total genus 35
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwtA00
4R6LA 3UB7A 3LIDA 3LUQA 4L9FA 1OTBA 5F68A 4JGOA 1T1AA 3LYXA 2HV1A 3P7NA 1OT9A 2J80A 2QWSA 2VV6A 4EEPA 3LI9A 2A24B 5DJTA 2KDKA 3FC7A 5HDCA 5HWWA 2I9VA 4GW9A 4PKYG 4HI4A 1OJ5A 5AVFA 4LRXC 5DJUA 1KOUA 1LL8A 4HP9A 5HSQA 2VEAA 3CLOA 4HP4A 1NWZA 1GSXA 5DKLA 4I3AA 3NOPC 3UB9A 3NHQA 1F98A 3K3DA 3BWLA 3G6OA 4JGRA 2BASA 1DP8A 4BBUA 4HOIA 4F3LB 2VV8A 4HHDA 5F5YA 3IBRA 4WL9A 3UMDA 1WA9A 3LICA 2PD7A 5TBMA 3MJQA 4I38A 4EXOA 3NJAA 2VV7A 1DP9A 2JN7A 3A0SA 4HIAA 1S66L 5HD5A 2PYPA 2QHKA 2WKPA 4WF0A 3ULFA 4I3JA 3UB6A 3VE3A 1OTIA 4HJ4A 4JGPA 4EQ1A 1D7EA 4DJ3A 2L0WA 1GSWA 4WUJA 4BBTA 4B9OA 3H9WA 1T1BA 1Y28A 5TBMB 1G28A 3NOTC 2A24A 2L1MA 3B33A 3F1NA 5EFWA 1S4SA 3RTYA 3UE6A 5J3WA 4HY8A 3LI8A 5G4ZA 3MR0A 1XFQA 2L4RA 4BBVA 2INWA 4HJ6A 4MN6A 5J7EA 4M4XA 4MN5A 3IS2B 5I5LA 1ODVA 4LPZA 3CAXA 4LRYC 3C2WA 3F1NB 3SW1A 2V1AA 2W27A 3VOLA 3BY8A 1TS7A 4EW7A 3F1OB 2B02A 3K3CA 1OJGA 2PYRA 1T19A 4I5SA 1XJ6A 3E4OA 4EETB 3OLOA 2V0WA 1UGUA 2OWJA 3E4QA 1OTDA 3CWFA 3A0VA 4KQDA 2V1BA 5HDSA 5A8BA 4XT2A 4HJ3A 4PKYA 2D02A 4R3AA 1P97A 4F3LA 3LIEA 2OWHA 1V9ZA 3KX0X 3MQOA 4EEUA 1LT0A 3FG8A 2D01A 5KIZA 2GJ3A 2R78A 4H6JB 1EW0A 4GCZA 4KUKA 4WN5A 1LSVA 3ZQ5A 3UB8A 3LIFA 4R70A 4XT2B 3UMEA 4GS9B 2ZBBA 4WLAA 5IU1A 2QJ5A 3MFXA 2PR6A 5HWTA 1OT6A 4HH2A 2PHYA 1N9OA 2QKPA 2YKFA 5J4EA 2YKHA 4NXGA 2OOLA 3C8CA 5AVEA 3BY9A 4KUOA 4L9GA 4I39A 3HJIA 2W0NA 4L9EA 3LIBA 4DJ2A 1D06A 4HQAA 5F6AA 3IS2A 1T1CA 1LSWA 2H28A 1TS6A 1TS0A 4GHIB 3H7WB 3EWKA 5HZHA 4LRZE 4NXBA 3F1OA 2ZOIA 1S4RA 1N9LA 1UWNX 3EEHA 1LSXA 4RQ9A 1S67L 3H82B 1BYWA 1XJ4A 3A0RA 3T50A 1OTAA 3NOUC 4I3IA 1GSVA 1V9YA 2V9AA 1OTEA 4H6JA 2QJ7A 4GS9A 3HJKA 4JGQA 3MQQA 5HD3A 3PYPA 3GECA 4LLOB 2VLGA 4EESA 3LIAA 3MXQA 2PR5A 3D72A 1JNUA 3ICYA 4EERA 3E4PA 4HH3A 4K08A 5F69A 2KX6A 2WKRA 2K7SA 1X0OA 5HDDA 4YWZA 2Z6CA 1UWPX 2P7JA 5G4YA 1S1ZA 3PHYA 4GHIA 2CMNA 1DP6A 1TS8A 3H7WA 1XJ2A 4HNBA 2V0UA 3RH8B 3F1PA 4R38A 2JHEA 2PD8A 4E04A 1MZUA 1S1YA 5IS1A 1T18A 1DRMA 1N9NA 2ZOHA 5HWVA 3GDIA 2M1CA 5DKKA 3H82A 3VE4A 1P0ZA 1F9IA 4NXEA 1XFNA 3F1PB 2PDRA 2Z6DA 1XJ3A 2EA9A 1VB6A 4NXFA 2WKQA
chains in the Genus database with same CATH superfamily
2LB9A 4K0XA 4Q0HA 1S0WA 4R6LA 3UB7A 3LIDA 1LI9A 3IWQA 3LUQA 4N1HA 2EFUA 3NCKA 4ESPA 2PT7A 1T1AA 4ZDXA 5CGWA 3P7NA 3MQ0A 1NLYA 2QWSA 3VFHA 4R3BA 3LI9A 4HBTA 4Q8IA 1W79A 5FAQA 5FSRA 3QP6A 4OPZA 1CI8A 1NXYA 4R4SA 5HWWA 3NI9A 1CEFA 3B42A 4JXGA 4GW9A 1E3UA 2Y2LA 3IBJA 5EECA 5IHVA 4R4RA 3OPLA 4PM7A 3LO7A 5E2GA 4KZ9A 4WMCA 1J9MA 1LL8A 5FDSA 5HSQA 3TE8A 4Y2FA 5CRFA 4DN0A 5HAPA 2I72A 2IWCA 4OPRA 4UQIS 4HP4A 4Y3IA 1CJFA 4N1XA 4PPRA 5TGFA 2Y2PA 3VP4A 2P74A 2ZMVA 2GZAA 3K3DA 5FI6A 4KZ6A 2O9BA 3BWLA 4JLFA 1DP8A 1P9WA 4YNRA 3T4LA 2VV8A 1JVJA 2EXAA 3UE1A 4HHDA 3IBRA 3ZVTA 5E2FA 3LICA 2XR0A 3MJQA 1FSYA 3IF6C 4UQIM 1DP9A 3EQUA 3V67A 3SH8A 1MC0A 3PR6A 2Y2IA 1XXMA 4I3JA 3OPPA 1OTIA 2ZL1B 3Q81A 1K4FA 4Y13A 3KO6A 4FUWA 1DJBA 4D2OA 3BQ8A 1K54A 4BBTA 5A91A 3IF6B 3IXDA 3F1NA 5FQKA 1AXBA 4M3KA 2ZQ8A 5G4ZA 2VGJA 3C5AA 2JBFA 4MBKA 1IYPA 5HL1A 3O86A 4DXCA 4O8GA 2HPBA 1ZG4A 3EGXC 4R3JA 4UA9A 3WS5A 4HJ6A 2HZ5A 1DJAA 3IS2B 1WE4A 1NLZA 3GSGA 1FCNA 4LPZA 5HARA 3CI6A 4LRYC 3OCNA 3IX8A 3F1NB 1WYBA 3BFCA 3S7NA 1PW8A 1TS7A 3G31A 4EW7A 2O9CA 3F1OB 3BW6A 2ZQDA 2VZWA 4QY5A 3E4OA 4PHTA 1SCWA 3T4KA 2V0WA 3OCLA 1ES2A 1OTDA 2PRFA 1KGEA 4QHCA 3A0VA 1PI5A 4ARZB 2D02A 4BWIA 1PYYA 1P97A 3Q82A 4F3LA 3MZFA 1K56D 5M19A 1M40A 4NETA 1H8YA 1YLYA 3KX0X 5TR7A 3LFVA 3NULA 3OPHA 3FG8A 2D01A 4H6JB 4MEZA 4KUKA 1BLPA 3UB8A 1XA1A 4PM8A 1IYOA 1G68A 1MBLA 3FPVA 3GR2A 1TD5A 2PHYA 1BUEA 3AGDA 1JWPA 2K31A 2JE5A 2HDQA 5AVEA 1ACFA 4RX3A 4Y15A 1LI0A 2CC1A 2OAP1 4DRTA 1XGJA 2P9VA 4HQAA 5F6AA 3EQVA 4GJ4A 4Y0TA 4G3VA 1LSWA 5M18A 5L09A 2P04A 2H28A 4DXBA 1PWGA 3OPRA 2WADA 3BM6A 2ZM0A 3H7WB 2EFXA 4N9KA 5E43A 3TOIA 3NDEA 4KZ4A 2GDNA 1H0MA 4QD4A 1HTZA 5EVLA 2H10A 1N9LA 3BRMA 1LSXA 3HLEA 4KG6A 4LENA 3FPWA 4GN2A 2UV0E 3NC8A 3A0RA 3T50A 3UDIA 3VP2A 5IT5A 3UDFA 1GA9A 1L0GA 4G3WA 4I3IA 4E3JA 4EWFA 1PWDA 2XGNA 1V9YA 3DBAA 3Q7VB 2BG1A 3UPNA 4EUVA 4GS9A 5HD3A 4Y7PA 3GECA 3PYPA 4LLOB 4R1GA 4MBHA 1W8QA 2XF3A 2VLGA 2R9WA 5A93A 2PR5A 2QZ6A 3S7QA 1CQAA 2XA7S 1JWVA 2G2WA 1JNUA 3ICYA 3FKVA 3S7OA 3P01A 2HDRA 3E4PA 3R7WA 1VEUB 2J3TC 1NRJA 1MY8A 2XK1A 2XFSA 5GHZA 2K7SA 2WYXA 3ZG5A 5GLAA 3OOVA 4YINA 1VETB 2XD5A 2W3FA 2XA7M 4U3TA 4Y0UA 1DJCA 4E3MA 4GDNA 3MF0A 2B95A 3GRJA 2NUTC 4HNBA 3LR4A 4WEJA 2XQZA 4LCLA 1YLTA 2PD8A 5EE8A 2JKRI 1S1YA 3FYZA 1YKDA 3ZCZA 1T18A 5GLCA 1N9NA 4BENA 3V39A 4G3KA 2OV5A 3U4LP 5JYPA 3GDIA 4R0QA 4E3LA 3H82A 3S4XA 3VE4A 4C75A 2HDSA 1F9IA 2G7UA 4P85A 4OKPA 4NXEA 3JVUA 4II7A 1I2WA 3HLBA 3WS0A 2ZM2A 4LV1A 3N8SA 1PIOA 1YM1A 4OQGA 1VB6A 4X6TA 1SDNA 2Y2GA 3MKEA 1K6RA 5BOHA 3PAEA 4LV0A 3BFGA 2Y91A 3Q07A 1Q2PA 3VOYA 5FQ9A 2J3TD 4GD6A 5DFYA 5CX7A 2XDMA 2HV1A 3A3JA 1ZHHB 1OT9A 3HUMA 2HP6A 3KYQA 1IKIA 1N4OA 3SH7A 3HLCA 3UN7A 2XSSA 4OVDA 2VK3A 3DWZA 5FA7A 4D60A 2A24B 3IT9A 3DTMA 2JKTI 4OQIA 1SHVA 1KE3A 2KDKA 3FC7A 4DDSA 4EBPA 4OP8A 3HLWA 5CERA 5HDCA 4A5RA 1G5UA 2WKEA 2XD1A 3D4FA 3UY6A 2ZD8A 4HI4A 1YSQA 1OJ5A 5AVFA 4KZ5A 3O88A 3D9YA 3PXPA 5CTMA 5DJUA 2IWBA 4HP9A 3OZHA 4X1LA 4OOMA 3CLOA 3CUEC 3UPOA 4KZAA 1HZOA 4OPQA 4B93A 2H0YA 4JKTA 2WGIA 4PM9A 3NOPC 1LL5A 5AJGA 2J9OA 4GLQA 5EM1A 4JGRA 4BBUA 4HOIA 5F5YA 4WL9A 4KZ7A 3UMDA 4GKUA 5CECA 2PD7A 4L0LA 3V3SA 3NJAA 3E0YA 2PU4A 5HX9A 5HD5A 4QB8A 3GV9A 4WF0A 3ULFA 4S2IA 3N6IA 1M6KA 1BLHA 4KG5A 3SS3A 1YT4A 3G32A 4P87A 4JGPA 4EQ1A 2FFYA 3LR0A 2L0WA 3TW8A 4RVAA 3G30A 4X25A 3NOTC 1ALQA 4QJGA 2AVXA 1S4SA 4B4XA 3KYEA 3UE6A 3LI8A 4NG2A 5FASA 1XPBA 3TSGA 1YSPA 2Y55A 5J7EA 1KGGA 2ZQCA 2ZC4B 2ZMFA 4X53A 4MN5A 5CEDA 4S2KA 5DTTA 5AQ9A 4CJNA 3G2YA 1YPRA 3CAXA 4PMAA 3BLSA 1KDWA 1PW1A 3SW1A 2V1AA 2W27A 4KQQA 3HLDA 2X71A 5I94A 1ES4A 5AQBA 5GLBA 1N9BA 1OJGA 4MMNA 5FQQA 3A3DA 1T19A 3T4JA 4OQHA 1W5DA 1NYMA 3M6HA 3OLOA 1NYYA 5TJJA 4XT2A 5A8BA 4PKYA 1BT5A 3VV4A 3IH8A 1BSGA 2DMWA 2LB5A 4UA7A 2O9AA 3E2KA 4MBFA 5L10A 1LLBA 3W4PA 2HGVA 3RXWA 3UO9A 3ZYTA 2EWVA 3S7PA 1K57C 4EEUA 3ZVWA 3B47A 4RYEA 1EW0A 3ZQ5A 4X69A 4XT2B 2ZBBA 2ZL1A 5A92A 4WLAA 4GOGA 2QJ5A 4IUKA 3C7VA 2EX6A 1OT6A 3PBQA 3IF6A 3CHWP 1N9OA 1YMXA 1I2SA 5J4EA 3BYDA 2YKHA 4NXGA 2OOLA 4QPRA 4PM5A 4WEKA 3E2LA 4IEDA 3D3OA 1K56A 2Y2KA 4K0WA 3FWLA 4I39A 2J9PA 2W0NA 4E6WA 3MZEA 4DJ2A 1D06A 1H3QA 4MDZA 5E2HA 1XKZA 2EX8A 3IS2A 1T1CA 3JYIA 1PFLA 1Z09A 2Y59A 3CPTB 3ZG8B 1TS6A 1TS0A 3ITAA 4GHIB 2XFTA 4O01A 3EGDC 3EWKA 1C3BA 4LRZE 3F1OA 3G2ZA 3UE3A 1H8ZA 3HVFA 3C38A 4OOLA 4KENB 5CHUA 5K5BA 3VP3A 1ESIA 4ARZA 2Y2QA 2VJWA 5G18A 1S67L 1BYWA 1Z6FA 1DY6A 3HUNA 1JWZA 3KSGA 1ES3A 5GLDA 3QP2A 4QU3A 5HPFA 2HP9A 4BQMA 3LEQA 1PZPA 4IVIA 5FQJA 3BJNA 2C5WB 1W63M 3P98A 4DE2A 3T1QB 3W2ZA 1CI9A 5EM0A 2V20A 4H6JA 5HL6A 3DWKA 1K6SA 2X02A 2A49A 4S2NC 3T4TA 4BL2A 5J8XA 2W3HA 1MPLA 4OH0A 4JGQA 3S22A 3MQQA 2VX8A 1L0DA 2RCXA 4N9LA 3QNBA 5HAQA 1IEMA 4OONA 2FZ0A 4XUXA 3RJUA 1L0EA 1YLWA 3WS4A 2RL3A 4EERA 4HH3A 4K08A 1L0FA 1GA0A 3ZGAB 5F82A 2KX6A 1GHMA 5HDDA 4YWZA 2Z6CA 2Y2NA 4F94A 4GNUA 1ZKJA 5HPIA 5DF7A 5CEBA 1S1ZA 3ZG9B 4P0MA 3W8KA 4KQOA 1TS8A 2W1TA 3H7WA 3RH8B 5DTSA 4R38A 2VKSA 3G34A 3T4SA 4P6ZS 1DRMA 4HESA 5MC7A 2ZOHA 5HWVA 2QYBA 1PWCA 3QP5A 4Y0OA 2EXBA 3TRCA 3MS6A 1E4DA 4MNRA 4BMWA 2ZM8A 3DTKA 3T4QA 2W1TB 3BFDA 3NIAA 3JVVA 1XJ3A 4BLMA 4P6ZM 3O5YA 3HUOA 2OLVA 4WZ5C 3FZCA 3Q7VA 1MWRA 4IBRA 2E8JA 4DKIA 3EOIA 1OTBA 3MXSA 4BD0A 5LBRA 3ZG7B 1G6OA 4S2JA 3UPPA 4JGOA 3A3IA 2JKFA 2IA2A 3I7JA 2V8CA 4EQIA 3MZDA 3IHAA 4QWOA 1FILA 1SKOA 1VEUA 4B88A 3HREA 3PAGA 1IELA 3ZNYA 1HD8A 2MJ6A 3M6BA 2W3GA 1NZUA 3VOZA 1PZOA 1ZTUA 1MKMA 2B18A 3BEBA 1VETA 3G4PA 3LY4A 3IH9A 4KZ8A 4LV2A 1F5MA 3QP1A 1K0KA 4FSFA 2ZJ9A 2XEPA 2W1RA 1Y4OA 1SKOB 4LRXC 4B4ZA 4X1MA 4U0XA 1KOUA 1F2KA 2WUQA 2KOIA 1FOFA 3L9KA 4IHQA 3ZDJA 3WRTA 4CQHA 5AQ7A 1JTGA 3MSHA 1NWZA 3LGOA 5FI2A 5DKLA 4LGWA 5F1GA 3SOIA 5DFXA 3UB9A 4MN7A 1F98A 1L2SA 3G6OA 1D1JA 2BASA 2BLSA 1BLCA 4KZBA 4HEFA 5KMWA 3CG5A 1GCEA 1I5QA 5JYOA 2GNXA 4ZAMA 4I38A 2ZQAA 4EXOA 2JN7A 4DDYA 1S66L 5FL3A 2J8YA 2PYPA 4EV4A 5EVEA 5EVIC 2WZXA 3MKFA 2VA0A 1Y54A 2DRWA 4KZ3A 3P09A 2J3WA 2H0TA 4B9OA 4X68A 3QP4A 1T1BA 1Y28A 4YOFA 1G28A 2A24A 2L1MA 4EU0A 3CZDA 2ZMAA 3N7WA 3ZG0A 1K38A 5L2FA 1YMSA 5EVIB 3V50A 2L4RA 1NJ4A 2O99A 2INWA 3W4OA 4MN6A 4M4XA 3UDXA 3M2KA 2Z2LB 4DMZA 1BTLA 3WRZA 5DTKA 3KSIA 1TF1A 4RX2A 3C2WA 2WGWA 1MWSA 3RFBA 2M7UA 3SZTA 5EPHA 1E25A 2B5RA 3K3CA 3N8RA 3NBLA 2PYRA 4I5SA 5AQAA 1XJ6A 2EX9A 4EETB 3K2NA 3V5MA 4AFIA 1YQSA 2KLIA 3CWFA 2VGLS 4KQDA 3VP0A 4HJ3A 2Y79A 1GHPA 3NECA 4R3AA 4X55A 5EVID 2OWHA 3ZNTA 4DE3A 5F1FA 2WGWB 3CUEA 4E3NA 3MQOA 1NRFA 3VSLA 1KVLA 3TJZC 2VGKA 2ZC3B 3HCYA 1SKFA 2R78A 1P9RA 4JPMA 4WN5A 1LSVA 1TVFA 2VGLM 3LIFA 4R70A 5IU1A 4OPYA 3GQZA 4EUZA 4C6YA 2PBDP 3MFXA 3VMAA 4Y5FA 3U2AA 5EOEA 1K55C 1EI5A 2QKPA 4H8RA 3G35A 3E98A 2XRNA 4EBNA 2XROA 2Y2MA 4ZJ2A 4UA6A 3NY4A 5CTNA 4KUOA 4CLCC 3PBOA 1OPXA 4JBFA 3HJIA 3IX3A 3ITBA 3LIBA 4FCFA 3HLGA 4Z9QA 3T4OA 2WK0A 3M2JA 4JXVA 1O07A 5FAPA 2OAQ1 2M7VA 1TEMA 1YLPA 2K2NA 1YLJA 3MFDA 3UB5P 4Q0JA 2WAEA 1ZC2A 4CLCB 1XGIA 1RGZA 3C30A 1UWNX 3QP8A 3EEHA 1IFQA 3GMWA 4UAAA 2FFFB 4RQ9A 3SS5A 3PTEA 2BTFP 1GHIA 4U0TA 1XJ4A 2W3EA 1ZG6A 2Y2JA 4QY6A 4WELA 3ZFZA 2Q9MA 3EEAA 1OTAA 5HAIA 4ZRRA 4DE1A 4S2MA 5DF9A 5D3OA 1OTEA 1ONHA 1EROA 2QJ7A 4WBGA 4ETXA 2A2LA 3HJKA 1RGYA 3RXXA 3FV7A 1RP5A 3B3XA 1KVMA 4CLCD 2QMIA 5FQMA 5TFQA 5HFOA 5KSCA 3N4IA 2WZZA 1W7FA 4EBLA 1K57A 4NEED 4JF6A 1OMEA 2WAFA 3IX4A 3AGEA 1RCJA 4OLGA 4R23A 3BFFA 1FR1A 3CITA 4O7DA 2WKRA 2OSUA 1X0OA 4NK3A 3KSHA 1FSWA 1UWPX 3WS1A 1ERQA 2P08A 3OBFA 5G4YA 5GHXA 2WGVA 3CPTA 1FR6A 4GHIA 3IF5A 2CMNA 4WZ4A 2FH5A 4KQRA 5DF8A 2NUPC 2V0UA 1KE4A 3F1PA 3BECA 3BLMA 2JHEA 1MXOA 4DE0A 1H5XA 3WWXA 2Y4AA 5CHMA 4GDBA 5L07A 4OP5A 4YFMA 1U60A 3FKWA 1WYCA 5DKKA 4S2PA 1BZAA 1P0ZA 3QNCA 4GB7A 3IXGA 3CJMA 4JXWA 3F1PB 2PDRA 4CPKA 2X01A 4E6XA 1IKGA 1PI4A 2EA9A 4O0PA 1SDEA 1K54C 1E3UD 3IXBA 5A90A 2H5SA 3WS2A 2GX5A 4L9FA 4WMCD 4E3KA 5CGSA 5F68A 4BD1A 4WYYA 3LYXA 4IJGA 4NKPA 1FCMA 3NDGA 3T1SA 4K91A 3VFFA 2J80A 5EV0A 2Y8HA 1NY0A 3OC2A 2VV6A 3DTEA 4EEPA 2V1ZA 4S2NA 5DJTA 4C3QA 3DAVA 1LL9A 1MWTA 3PBTA 1ONGA 4FD8A 4HBUA 1ES5A 1CF0A 4IUHA 2I9VA 2JCHA 1ESUA 2DNSA 3DW0A 4PKYG 2Q0OA 3T1XA 4UHUA 2Z2MB 4RA7A 2JKGA 3LR5A 3PBSA 2VEAA 2EX2A 1Q2QA 2O0YA 4N92A 2XLNA 2C6WB 2V8FA 2UWXA 5KSHA 1IYSA 1GSXA 3N8LA 4I3AA 2WKIA 2DCFA 3NHQA 4GD8A 2PAVP 5FEFA 5C5KA 2EWWA 4JF4A 3A3FA 4F3LB 3C7UA 1O7EA 5FI7A 3ZHHA 1WA9A 5TBMA 2VV7A 1KDSA 3A0SA 3IHBA 4HIAA 4OLDA 1VHMA 2QHKA 2WKPA 2Y2HA 1TDLA 4MCWA 3UB6A 3VE3A 3IWOA 5KZHA 4HJ4A 4WM9A 2HJ9C 3QHYA 1HVBA 4OQ0A 1D7EA 4DJ3A 1YAXA 3O87A 5U47A 1GSWA 5FATA 1JTDA 4WUJA 4WZ5A 1MWUA 3H9WA 5TBMB 2PU2A 3B33A 4GZBA 5EFWA 4XXRA 1BLSA 2WKHA 3RTYA 3V3RA 3R4KA 5J3WA 4HY8A 3MR0A 1A0KA 2ACGA 1XFQA 2QPNA 5M1AA 3IWIA 4BBVA 3O3VA 2P9VB 2ZLYA 3HL9A 1BULA 5I5LA 4FTXA 3LY3A 1ODVA 5F83A 3DTIA 2JC7A 3PBNA 3KSFA 4JXSA 3VOLA 1W63Q 3BY8A 4P6BA 4KG2A 2B02A 3UE0A 3L7HA 3MXRA 1UGUA 2OWJA 3E4QA 2HJEA 2XH9A 2HDUA 2V1BA 5HDSA 3IXHA 4UEYA 1L3LA 3LIEA 4FH4A 1KGFA 1V9ZA 1EWZA 2A3UA 1QMEA 1XA7A 5E2EA 4PM6A 3GTCA 5GL9A 1LT0A 4S2OA 4BJPA 3S1YA 5GHYA 4OOYA 5KIZA 1TDGA 2R9XA 2GJ3A 3IQAA 4ZBEA 4GCZA 3UMEA 4GS9B 1FQGA 3C4PA 2ZC6B 4IVKA 1FIKA 4FH2A 2E8IA 4ID4A 2PR6A 5HWTA 4HH2A 1QMFA 3BFEA 1SZVA 3SS4A 2YKFA 3C4OA 4E3IA 3BQAA 3R7WB 4LV3A 2W3DA 3C8CA 3UNWA 3BY9A 5EVIA 4L9GA 5FDHA 4L9EA 3Q7ZA 3W4QA 4X56A 2G2UA 1VQQA 2ZQ7A 3ISGA 1NZOA 5DVAA 1AWIA 3T1RA 2J7VA 1CK3A 5HZHA 2IWDA 2ZQ9A 4NXBA 3TG9A 2ZOIA 1IOUA 1S4RA 5HW3A 2OLUA 3VP1A 1K25A 1XP4A 5CXWA 4MLLA 3H82B 5CHJA 4ZJ3A 1KE0A 1J3WA 2HP5A 2PBYA 4DF6A 5CGXA 3NOUC 1GSVA 4BL3A 3CMZA 2Y2OA 1CEGA 2JKRM 1IYQA 2V9AA 4JF5A 5FQIA 3KYZA 4Y17A 5FEGA 1G6AA 1STZA 3A3EA 1VM1A 1FCOA 4IBXA 3LR3A 3SH9A 5FAOA 4EESA 3LIAA 3MMHA 3MXQA 3LCEA 5L8MA 3D72A 1PNEA 4ETZA 3HBRA 3LEZA 4CLCE 1LHYA 5EUAA 5F69A 3T12B 3VSKA 4Z1WA 1HLUP 1W8YA 4FOFA 4E3OA 2P7JA 2Q9NA 1MKIA 1K55A 3PHYA 1DP6A 3Q1FA 4Q0IA 1XJ2A 1YLZA 4ZTKA 4CLCA 4E04A 1MZUA 5IS1A 1K4EA 1S6RA 2V2FF 2JKTM 4S2LA 3HLFA 4LFUA 1PRQA 4PAUA 2ZC7A 2M1CA 1ERMA 2ZC5B 3JPUA 1XX2A 4ZJ1A 3MBZA 4ME4A 1H8MA 1XFNA 3AGFA 2Z6DA 5EOOA 3PBRA 3GVBA 4LCMA 4NXFA 2WKQA 2HF6A 4XUZA
chains in the Genus database with same CATH topology
2LB9A 4Q0HA 4R6LA 3UB7A 3LIDA 3LUQA 2GX5A 3EOIA 1OTBA 4L9FA 2J3TD 5LBRA 5F68A 1G6OA 5DFYA 5CX7A 4JGOA 2PT7A 1T1AA 2IA2A 3LYXA 2HV1A 4IJGA 4NKPA 1ZHHB 3P7NA 1OT9A 3KYQA 3MQ0A 2J80A 2Y8HA 1NLYA 2QWSA 3OC2A 2VV6A 2XSSA 4EEPA 3LI9A 2A24B 5DJTA 2MJ6A 2JKTI 2W3GA 2KDKA 3FC7A 3PBTA 1ZTUA 1MKMA 2B18A 5HDCA 5HWWA 3B42A 4IUHA 2I9VA 4GW9A 4PKYG 1F5MA 4HI4A 1YSQA 1OJ5A 3IBJA 4FSFA 2W1RA 5AVFA 4LRXC 3LR5A 3PXPA 3PBSA 5DJUA 1KOUA 1LL8A 4HP9A 5HSQA 2VEAA 3TE8A 4Y2FA 4OOMA 4DN0A 2O0YA 2KOIA 3CLOA 3CUEC 4IHQA 4UQIS 4B93A 4CQHA 4HP4A 4Y3IA 5KSHA 1NWZA 1GSXA 5DKLA 4I3AA 3NOPC 5DFXA 3UB9A 3NHQA 4MN7A 5AJGA 1F98A 2ZMVA 2GZAA 3K3DA 4GLQA 5C5KA 2EWWA 2O9BA 3BWLA 3G6OA 4JGRA 2BASA 1DP8A 4BBUA 1P9WA 4HOIA 4F3LB 4YNRA 3T4LA 2VV8A 4HHDA 5F5YA 3IBRA 4WL9A 3UMDA 1WA9A 3LICA 2GNXA 2PD7A 5TBMA 3MJQA 4I38A 4L0LA 4EXOA 4UQIM 3NJAA 2VV7A 1DP9A 3E0YA 2JN7A 3A0SA 4HIAA 3EQUA 1S66L 5FL3A 3V67A 5HD5A 1VHMA 2PYPA 2QHKA 2WKPA 4WF0A 1MC0A 3PR6A 3ULFA 4MCWA 4I3JA 3UB6A 3VE3A 1OTIA 2VA0A 4HJ4A 3KO6A 4JGPA 2HJ9C 4EQ1A 3LR0A 1D7EA 4DJ3A 1YAXA 2L0WA 3TW8A 2J3WA 3BQ8A 1GSWA 4WUJA 4BBTA 4B9OA 3H9WA 1T1BA 1Y28A 4YOFA 5TBMB 1G28A 3NOTC 2A24A 2L1MA 4EU0A 3B33A 3F1NA 5EFWA 1S4SA 3RTYA 3R4KA 3UE6A 5J3WA 4HY8A 3LI8A 5G4ZA 3MR0A 1XFQA 4O8GA 3EGXC 2L4RA 4BBVA 2O99A 2INWA 1YSPA 4HJ6A 4MN6A 5J7EA 4M4XA 2ZMFA 4MN5A 3IS2B 5I5LA 4DMZA 1NLZA 1ODVA 4LPZA 3CAXA 3PBNA 3CI6A 4LRYC 3KSIA 3OCNA 3KSFA 1TF1A 3C2WA 3F1NB 3SW1A 2V1AA 2W27A 3VOLA 3RFBA 2M7UA 1W63Q 3BY8A 3S7NA 1TS7A 4EW7A 2O9CA 3F1OB 2B02A 3BW6A 3K3CA 1OJGA 4MMNA 2PYRA 1T19A 2VZWA 4I5SA 1XJ6A 3E4OA 4PHTA 3T4JA 4EETB 3T4KA 3K2NA 3OLOA 2V0WA 1UGUA 2OWJA 3E4QA 3OCLA 1OTDA 2HJEA 4AFIA 2KLIA 3CWFA 3A0VA 2VGLS 4KQDA 2V1BA 5HDSA 5TJJA 4XT2A 5A8BA 4HJ3A 4ARZB 2Y79A 2D02A 4PKYA 4BWIA 3VV4A 4R3AA 1P97A 4UEYA 4F3LA 3LIEA 2DMWA 2LB5A 2OWHA 1V9ZA 2O9AA 3CUEA 2HGVA 3ZYTA 2EWVA 3KX0X 3MQOA 3LFVA 3S7PA 4EEUA 1LT0A 3B47A 3FG8A 4BJPA 2D01A 5KIZA 3TJZC 2GJ3A 3HCYA 2R78A 1P9RA 4H6JB 1EW0A 4GCZA 4KUKA 4WN5A 1LSVA 3UB8A 3ZQ5A 2VGLM 3LIFA 4R70A 4XT2B 3UMEA 4GS9B 2ZBBA 4WLAA 5IU1A 2QJ5A 4IUKA 3MFXA 2PR6A 3FPVA 5HWTA 4Y5FA 1OT6A 3U2AA 1TD5A 4HH2A 3PBQA 2PHYA 1N9OA 2QKPA 2YKFA 5J4EA 3E98A 2XRNA 3BQAA 3R7WB 2YKHA 4NXGA 2OOLA 4QPRA 2K31A 2XROA 2W3DA 3C8CA 4WEKA 5AVEA 3BY9A 3D3OA 4KUOA 4CLCC 3PBOA 4L9GA 1OPXA 4I39A 3HJIA 2W0NA 4L9EA 2OAP1 3LIBA 4DJ2A 1D06A 1H3QA 4MDZA 3T4OA 4HQAA 5F6AA 3EQVA 3IS2A 1T1CA 4GJ4A 4G3VA 1LSWA 2OAQ1 2P04A 2H28A 2M7VA 1TS6A 1TS0A 4GHIB 2K2NA 4O01A 3H7WB 3EGDC 3EWKA 5HZHA 4LRZE 4NXBA 3F1OA 4Q0JA 3UE3A 3C38A 4CLCB 2ZOIA 4OOLA 1IOUA 1S4RA 1N9LA 5K5BA 3C30A 1UWNX 3EEHA 1LSXA 1IFQA 4ARZA 4RQ9A 2VJWA 3FPWA 1S67L 3H82B 1BYWA 1XJ4A 2W3EA 3KSGA 3A0RA 3T50A 5HPFA 4WELA 5IT5A 3EEAA 1OTAA 3BJNA 4G3WA 4ZRRA 1W63M 3NOUC 3W2ZA 4I3IA 1GSVA 1V9YA 2JKRM 3DBAA 2V9AA 5DF9A 1OTEA 4H6JA 5HL6A 3T4TA 3KYZA 4EUVA 2QJ7A 4ETXA 1STZA 2A2LA 2W3HA 4GS9A 3HJKA 4JGQA 3MQQA 2VX8A 5HD3A 3PYPA 3GECA 4LLOB 3LR3A 2VLGA 4EESA 3LIAA 4CLCD 3MMHA 3MXQA 2PR5A 5L8MA 3D72A 2FZ0A 3S7QA 2XA7S 4ETZA 1JNUA 3ICYA 3S7OA 4NEED 4EERA 4CLCE 3P01A 3E4PA 4HH3A 3R7WA 4K08A 5F69A 2J3TC 1NRJA 2KX6A 3CITA 2WKRA 2K7SA 1X0OA 4Z1WA 5HDDA 4YWZA 2Z6CA 3KSHA 3OOVA 1UWPX 4FOFA 2P08A 3OBFA 2W3FA 5HPIA 2P7JA 5G4YA 1S1ZA 2XA7M 3PHYA 4GHIA 2CMNA 3MF0A 1DP6A 1TS8A 4KQOA 4Q0IA 2W1TA 3H7WA 2FH5A 1XJ2A 2NUTC 4HNBA 2NUPC 3LR4A 2V0UA 4WEJA 3RH8B 3F1PA 4R38A 2VKSA 3T4SA 2JHEA 2PD8A 4CLCA 4E04A 4P6ZS 2JKRI 1MZUA 1S1YA 1YKDA 5IS1A 1T18A 1DRMA 1N9NA 2JKTM 5MC7A 2ZOHA 5HWVA 2QYBA 4G3KA 3GDIA 3TRCA 4PAUA 2M1CA 4BMWA 5DKKA 3H82A 3VE4A 1P0ZA 1F9IA 2G7UA 3T4QA 4NXEA 3JVUA 2W1TB 4II7A 4ME4A 1H8MA 1XFNA 3F1PB 2PDRA 2Z6DA 3PBRA 3JVVA 1XJ3A 1VB6A 2EA9A 4NXFA 4O0PA 4P6ZM 3O5YA 2WKQA 2HF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6L A;  3UB7 A;  3LID A;  3LUQ A;  4L9F A;  1OTB A;  5F68 A;  4JGO A;  1T1A A;  3LYX A;  2HV1 A;  3P7N A;  1OT9 A;  2J80 A;  2QWS A;  2VV6 A;  4EEP A;  3LI9 A;  2A24 B;  5DJT A;  2KDK A;  3FC7 A;  5HDC A;  5HWW A;  2I9V A;  4GW9 A;  4PKY G;  4HI4 A;  1OJ5 A;  5AVF A;  4LRX C;  5DJU A;  1KOU A;  1LL8 A;  4HP9 A;  5HSQ A;  2VEA A;  3CLO A;  4HP4 A;  1NWZ A;  1GSX A;  5DKL A;  4I3A A;  3NOP C;  3UB9 A;  3NHQ A;  1F98 A;  3K3D A;  3BWL A;  3G6O A;  4JGR A;  2BAS A;  1DP8 A;  4BBU A;  4HOI A;  4F3L B;  2VV8 A;  4HHD A;  5F5Y A;  3IBR A;  4WL9 A;  3UMD A;  1WA9 A;  3LIC A;  2PD7 A;  5TBM A;  3MJQ A;  4I38 A;  4EXO A;  3NJA A;  2VV7 A;  1DP9 A;  2JN7 A;  3A0S A;  4HIA A;  1S66 L;  5HD5 A;  2PYP A;  2QHK A;  2WKP A;  4WF0 A;  3ULF A;  4I3J A;  3UB6 A;  3VE3 A;  1OTI A;  4HJ4 A;  4JGP A;  4EQ1 A;  1D7E A;  4DJ3 A;  2L0W A;  1GSW A;  4WUJ A;  4BBT A;  4B9O A;  3H9W A;  1T1B A;  1Y28 A;  5TBM B;  1G28 A;  3NOT C;  2A24 A;  2L1M A;  3B33 A;  3F1N A;  5EFW A;  1S4S A;  3RTY A;  3UE6 A;  5J3W A;  4HY8 A;  3LI8 A;  5G4Z A;  3MR0 A;  1XFQ A;  2L4R A;  4BBV A;  2INW A;  4HJ6 A;  4MN6 A;  5J7E A;  4M4X A;  4MN5 A;  3IS2 B;  5I5L A;  1ODV A;  4LPZ A;  3CAX A;  4LRY C;  3C2W A;  3F1N B;  3SW1 A;  2V1A A;  2W27 A;  3VOL A;  3BY8 A;  1TS7 A;  4EW7 A;  3F1O B;  2B02 A;  3K3C A;  1OJG A;  2PYR A;  1T19 A;  4I5S A;  1XJ6 A;  3E4O A;  4EET B;  3OLO A;  2V0W A;  1UGU A;  2OWJ A;  3E4Q A;  1OTD A;  3CWF A;  3A0V A;  4KQD A;  2V1B A;  5HDS A;  5A8B A;  4XT2 A;  4HJ3 A;  4PKY A;  2D02 A;  4R3A A;  1P97 A;  4F3L A;  3LIE A;  2OWH A;  1V9Z A;  3KX0 X;  3MQO A;  4EEU A;  1LT0 A;  3FG8 A;  2D01 A;  5KIZ A;  2GJ3 A;  2R78 A;  4H6J B;  1EW0 A;  4GCZ A;  4KUK A;  4WN5 A;  1LSV A;  3ZQ5 A;  3UB8 A;  3LIF A;  4R70 A;  4XT2 B;  3UME A;  4GS9 B;  2ZBB A;  4WLA A;  5IU1 A;  2QJ5 A;  3MFX A;  2PR6 A;  5HWT A;  1OT6 A;  4HH2 A;  2PHY A;  1N9O A;  2QKP A;  2YKF A;  5J4E A;  2YKH A;  4NXG A;  2OOL A;  3C8C A;  5AVE A;  3BY9 A;  4KUO A;  4L9G A;  4I39 A;  3HJI A;  2W0N A;  4L9E A;  3LIB A;  4DJ2 A;  1D06 A;  4HQA A;  5F6A A;  3IS2 A;  1T1C A;  1LSW A;  2H28 A;  1TS6 A;  1TS0 A;  4GHI B;  3H7W B;  3EWK A;  5HZH A;  4LRZ E;  4NXB A;  3F1O A;  2ZOI A;  1S4R A;  1N9L A;  1UWN X;  3EEH A;  1LSX A;  4RQ9 A;  1S67 L;  3H82 B;  1BYW A;  1XJ4 A;  3A0R A;  3T50 A;  1OTA A;  3NOU C;  4I3I A;  1GSV A;  1V9Y A;  2V9A A;  1OTE A;  4H6J A;  2QJ7 A;  4GS9 A;  3HJK A;  4JGQ A;  3MQQ A;  5HD3 A;  3PYP A;  3GEC A;  4LLO B;  2VLG A;  4EES A;  3LIA A;  3MXQ A;  2PR5 A;  3D72 A;  1JNU A;  3ICY A;  4EER A;  3E4P A;  4HH3 A;  4K08 A;  5F69 A;  2KX6 A;  2WKR A;  2K7S A;  1X0O A;  5HDD A;  4YWZ A;  2Z6C A;  1UWP X;  2P7J A;  5G4Y A;  1S1Z A;  3PHY A;  4GHI A;  2CMN A;  1DP6 A;  1TS8 A;  3H7W A;  1XJ2 A;  4HNB A;  2V0U A;  3RH8 B;  3F1P A;  4R38 A;  2JHE A;  2PD8 A;  4E04 A;  1MZU A;  1S1Y A;  5IS1 A;  1T18 A;  1DRM A;  1N9N A;  2ZOH A;  5HWV A;  3GDI A;  2M1C A;  5DKK A;  3H82 A;  3VE4 A;  1P0Z A;  1F9I A;  4NXE A;  1XFN A;  3F1P B;  2PDR A;  2Z6D A;  1XJ3 A;  2EA9 A;  1VB6 A;  4NXF A;  2WKQ A; 
#chains in the Genus database with same CATH topology
 2LB9 A;  4K0X A;  4Q0H A;  1S0W A;  4R6L A;  3UB7 A;  3LID A;  1LI9 A;  3IWQ A;  3LUQ A;  4N1H A;  2EFU A;  3NCK A;  4ESP A;  2PT7 A;  1T1A A;  4ZDX A;  5CGW A;  3P7N A;  3MQ0 A;  1NLY A;  2QWS A;  3VFH A;  4R3B A;  3LI9 A;  4HBT A;  4Q8I A;  1W79 A;  5FAQ A;  5FSR A;  3QP6 A;  4OPZ A;  1CI8 A;  1NXY A;  4R4S A;  5HWW A;  3NI9 A;  1CEF A;  3B42 A;  4JXG A;  4GW9 A;  1E3U A;  2Y2L A;  3IBJ A;  5EEC A;  5IHV A;  4R4R A;  3OPL A;  4PM7 A;  3LO7 A;  5E2G A;  4KZ9 A;  4WMC A;  1J9M A;  1LL8 A;  5FDS A;  5HSQ A;  3TE8 A;  4Y2F A;  5CRF A;  4DN0 A;  5HAP A;  2I72 A;  2IWC A;  4OPR A;  4UQI S;  4HP4 A;  4Y3I A;  1CJF A;  4N1X A;  4PPR A;  5TGF A;  2Y2P A;  3VP4 A;  2P74 A;  2ZMV A;  2GZA A;  3K3D A;  5FI6 A;  4KZ6 A;  2O9B A;  3BWL A;  4JLF A;  1DP8 A;  1P9W A;  4YNR A;  3T4L A;  2VV8 A;  1JVJ A;  2EXA A;  3UE1 A;  4HHD A;  3IBR A;  3ZVT A;  5E2F A;  3LIC A;  2XR0 A;  3MJQ A;  1FSY A;  3IF6 C;  4UQI M;  1DP9 A;  3EQU A;  3V67 A;  3SH8 A;  1MC0 A;  3PR6 A;  2Y2I A;  1XXM A;  4I3J A;  3OPP A;  1OTI A;  2ZL1 B;  3Q81 A;  1K4F A;  4Y13 A;  3KO6 A;  4FUW A;  1DJB A;  4D2O A;  3BQ8 A;  1K54 A;  4BBT A;  5A91 A;  3IF6 B;  3IXD A;  3F1N A;  5FQK A;  1AXB A;  4M3K A;  2ZQ8 A;  5G4Z A;  2VGJ A;  3C5A A;  2JBF A;  4MBK A;  1IYP A;  5HL1 A;  3O86 A;  4DXC A;  4O8G A;  2HPB A;  1ZG4 A;  3EGX C;  4R3J A;  4UA9 A;  3WS5 A;  4HJ6 A;  2HZ5 A;  1DJA A;  3IS2 B;  1WE4 A;  1NLZ A;  3GSG A;  1FCN A;  4LPZ A;  5HAR A;  3CI6 A;  4LRY C;  3OCN A;  3IX8 A;  3F1N B;  1WYB A;  3BFC A;  3S7N A;  1PW8 A;  1TS7 A;  3G31 A;  4EW7 A;  2O9C A;  3F1O B;  3BW6 A;  2ZQD A;  2VZW A;  4QY5 A;  3E4O A;  4PHT A;  1SCW A;  3T4K A;  2V0W A;  3OCL A;  1ES2 A;  1OTD A;  2PRF A;  1KGE A;  4QHC A;  3A0V A;  1PI5 A;  4ARZ B;  2D02 A;  4BWI A;  1PYY A;  1P97 A;  3Q82 A;  4F3L A;  3MZF A;  1K56 D;  5M19 A;  1M40 A;  4NET A;  1H8Y A;  1YLY A;  3KX0 X;  5TR7 A;  3LFV A;  3NUL A;  3OPH A;  3FG8 A;  2D01 A;  4H6J B;  4MEZ A;  4KUK A;  1BLP A;  3UB8 A;  1XA1 A;  4PM8 A;  1IYO A;  1G68 A;  1MBL A;  3FPV A;  3GR2 A;  1TD5 A;  2PHY A;  1BUE A;  3AGD A;  1JWP A;  2K31 A;  2JE5 A;  2HDQ A;  5AVE A;  1ACF A;  4RX3 A;  4Y15 A;  1LI0 A;  2CC1 A;  2OAP 1;  4DRT A;  1XGJ A;  2P9V A;  4HQA A;  5F6A A;  3EQV A;  4GJ4 A;  4Y0T A;  4G3V A;  1LSW A;  5M18 A;  5L09 A;  2P04 A;  2H28 A;  4DXB A;  1PWG A;  3OPR A;  2WAD A;  3BM6 A;  2ZM0 A;  3H7W B;  2EFX A;  4N9K A;  5E43 A;  3TOI A;  3NDE A;  4KZ4 A;  2GDN A;  1H0M A;  4QD4 A;  1HTZ A;  5EVL A;  2H10 A;  1N9L A;  3BRM A;  1LSX A;  3HLE A;  4KG6 A;  4LEN A;  3FPW A;  4GN2 A;  2UV0 E;  3NC8 A;  3A0R A;  3T50 A;  3UDI A;  3VP2 A;  5IT5 A;  3UDF A;  1GA9 A;  1L0G A;  4G3W A;  4I3I A;  4E3J A;  4EWF A;  1PWD A;  2XGN A;  1V9Y A;  3DBA A;  3Q7V B;  2BG1 A;  3UPN A;  4EUV A;  4GS9 A;  5HD3 A;  4Y7P A;  3GEC A;  3PYP A;  4LLO B;  4R1G A;  4MBH A;  1W8Q A;  2XF3 A;  2VLG A;  2R9W A;  5A93 A;  2PR5 A;  2QZ6 A;  3S7Q A;  1CQA A;  2XA7 S;  1JWV A;  2G2W A;  1JNU A;  3ICY A;  3FKV A;  3S7O A;  3P01 A;  2HDR A;  3E4P A;  3R7W A;  1VEU B;  2J3T C;  1NRJ A;  1MY8 A;  2XK1 A;  2XFS A;  5GHZ A;  2K7S A;  2WYX A;  3ZG5 A;  5GLA A;  3OOV A;  4YIN A;  1VET B;  2XD5 A;  2W3F A;  2XA7 M;  4U3T A;  4Y0U A;  1DJC A;  4E3M A;  4GDN A;  3MF0 A;  2B95 A;  3GRJ A;  2NUT C;  4HNB A;  3LR4 A;  4WEJ A;  2XQZ A;  4LCL A;  1YLT A;  2PD8 A;  5EE8 A;  2JKR I;  1S1Y A;  3FYZ A;  1YKD A;  3ZCZ A;  1T18 A;  5GLC A;  1N9N A;  4BEN A;  3V39 A;  4G3K A;  2OV5 A;  3U4L P;  5JYP A;  3GDI A;  4R0Q A;  4E3L A;  3H82 A;  3S4X A;  3VE4 A;  4C75 A;  2HDS A;  1F9I A;  2G7U A;  4P85 A;  4OKP A;  4NXE A;  3JVU A;  4II7 A;  1I2W A;  3HLB A;  3WS0 A;  2ZM2 A;  4LV1 A;  3N8S A;  1PIO A;  1YM1 A;  4OQG A;  1VB6 A;  4X6T A;  1SDN A;  2Y2G A;  3MKE A;  1K6R A;  5BOH A;  3PAE A;  4LV0 A;  3BFG A;  2Y91 A;  3Q07 A;  1Q2P A;  3VOY A;  5FQ9 A;  2J3T D;  4GD6 A;  5DFY A;  5CX7 A;  2XDM A;  2HV1 A;  3A3J A;  1ZHH B;  1OT9 A;  3HUM A;  2HP6 A;  3KYQ A;  1IKI A;  1N4O A;  3SH7 A;  3HLC A;  3UN7 A;  2XSS A;  4OVD A;  2VK3 A;  3DWZ A;  5FA7 A;  4D60 A;  2A24 B;  3IT9 A;  3DTM A;  2JKT I;  4OQI A;  1SHV A;  1KE3 A;  2KDK A;  3FC7 A;  4DDS A;  4EBP A;  4OP8 A;  3HLW A;  5CER A;  5HDC A;  4A5R A;  1G5U A;  2WKE A;  2XD1 A;  3D4F A;  3UY6 A;  2ZD8 A;  4HI4 A;  1YSQ A;  1OJ5 A;  5AVF A;  4KZ5 A;  3O88 A;  3D9Y A;  3PXP A;  5CTM A;  5DJU A;  2IWB A;  4HP9 A;  3OZH A;  4X1L A;  4OOM A;  3CLO A;  3CUE C;  3UPO A;  4KZA A;  1HZO A;  4OPQ A;  4B93 A;  2H0Y A;  4JKT A;  2WGI A;  4PM9 A;  3NOP C;  1LL5 A;  5AJG A;  2J9O A;  4GLQ A;  5EM1 A;  4JGR A;  4BBU A;  4HOI A;  5F5Y A;  4WL9 A;  4KZ7 A;  3UMD A;  4GKU A;  5CEC A;  2PD7 A;  4L0L A;  3V3S A;  3NJA A;  3E0Y A;  2PU4 A;  5HX9 A;  5HD5 A;  4QB8 A;  3GV9 A;  4WF0 A;  3ULF A;  4S2I A;  3N6I A;  1M6K A;  1BLH A;  4KG5 A;  3SS3 A;  1YT4 A;  3G32 A;  4P87 A;  4JGP A;  4EQ1 A;  2FFY A;  3LR0 A;  2L0W A;  3TW8 A;  4RVA A;  3G30 A;  4X25 A;  3NOT C;  1ALQ A;  4QJG A;  2AVX A;  1S4S A;  4B4X A;  3KYE A;  3UE6 A;  3LI8 A;  4NG2 A;  5FAS A;  1XPB A;  3TSG A;  1YSP A;  2Y55 A;  5J7E A;  1KGG A;  2ZQC A;  2ZC4 B;  2ZMF A;  4X53 A;  4MN5 A;  5CED A;  4S2K A;  5DTT A;  5AQ9 A;  4CJN A;  3G2Y A;  1YPR A;  3CAX A;  4PMA A;  3BLS A;  1KDW A;  1PW1 A;  3SW1 A;  2V1A A;  2W27 A;  4KQQ A;  3HLD A;  2X71 A;  5I94 A;  1ES4 A;  5AQB A;  5GLB A;  1N9B A;  1OJG A;  4MMN A;  5FQQ A;  3A3D A;  1T19 A;  3T4J A;  4OQH A;  1W5D A;  1NYM A;  3M6H A;  3OLO A;  1NYY A;  5TJJ A;  4XT2 A;  5A8B A;  4PKY A;  1BT5 A;  3VV4 A;  3IH8 A;  1BSG A;  2DMW A;  2LB5 A;  4UA7 A;  2O9A A;  3E2K A;  4MBF A;  5L10 A;  1LLB A;  3W4P A;  2HGV A;  3RXW A;  3UO9 A;  3ZYT A;  2EWV A;  3S7P A;  1K57 C;  4EEU A;  3ZVW A;  3B47 A;  4RYE A;  1EW0 A;  3ZQ5 A;  4X69 A;  4XT2 B;  2ZBB A;  2ZL1 A;  5A92 A;  4WLA A;  4GOG A;  2QJ5 A;  4IUK A;  3C7V A;  2EX6 A;  1OT6 A;  3PBQ A;  3IF6 A;  3CHW P;  1N9O A;  1YMX A;  1I2S A;  5J4E A;  3BYD A;  2YKH A;  4NXG A;  2OOL A;  4QPR A;  4PM5 A;  4WEK A;  3E2L A;  4IED A;  3D3O A;  1K56 A;  2Y2K A;  4K0W A;  3FWL A;  4I39 A;  2J9P A;  2W0N A;  4E6W A;  3MZE A;  4DJ2 A;  1D06 A;  1H3Q A;  4MDZ A;  5E2H A;  1XKZ A;  2EX8 A;  3IS2 A;  1T1C A;  3JYI A;  1PFL A;  1Z09 A;  2Y59 A;  3CPT B;  3ZG8 B;  1TS6 A;  1TS0 A;  3ITA A;  4GHI B;  2XFT A;  4O01 A;  3EGD C;  3EWK A;  1C3B A;  4LRZ E;  3F1O A;  3G2Z A;  3UE3 A;  1H8Z A;  3HVF A;  3C38 A;  4OOL A;  4KEN B;  5CHU A;  5K5B A;  3VP3 A;  1ESI A;  4ARZ A;  2Y2Q A;  2VJW A;  5G18 A;  1S67 L;  1BYW A;  1Z6F A;  1DY6 A;  3HUN A;  1JWZ A;  3KSG A;  1ES3 A;  5GLD A;  3QP2 A;  4QU3 A;  5HPF A;  2HP9 A;  4BQM A;  3LEQ A;  1PZP A;  4IVI A;  5FQJ A;  3BJN A;  2C5W B;  1W63 M;  3P98 A;  4DE2 A;  3T1Q B;  3W2Z A;  1CI9 A;  5EM0 A;  2V20 A;  4H6J A;  5HL6 A;  3DWK A;  1K6S A;  2X02 A;  2A49 A;  4S2N C;  3T4T A;  4BL2 A;  5J8X A;  2W3H A;  1MPL A;  4OH0 A;  4JGQ A;  3S22 A;  3MQQ A;  2VX8 A;  1L0D A;  2RCX A;  4N9L A;  3QNB A;  5HAQ A;  1IEM A;  4OON A;  2FZ0 A;  4XUX A;  3RJU A;  1L0E A;  1YLW A;  3WS4 A;  2RL3 A;  4EER A;  4HH3 A;  4K08 A;  1L0F A;  1GA0 A;  3ZGA B;  5F82 A;  2KX6 A;  1GHM A;  5HDD A;  4YWZ A;  2Z6C A;  2Y2N A;  4F94 A;  4GNU A;  1ZKJ A;  5HPI A;  5DF7 A;  5CEB A;  1S1Z A;  3ZG9 B;  4P0M A;  3W8K A;  4KQO A;  1TS8 A;  2W1T A;  3H7W A;  3RH8 B;  5DTS A;  4R38 A;  2VKS A;  3G34 A;  3T4S A;  4P6Z S;  1DRM A;  4HES A;  5MC7 A;  2ZOH A;  5HWV A;  2QYB A;  1PWC A;  3QP5 A;  4Y0O A;  2EXB A;  3TRC A;  3MS6 A;  1E4D A;  4MNR A;  4BMW A;  2ZM8 A;  3DTK A;  3T4Q A;  2W1T B;  3BFD A;  3NIA A;  3JVV A;  1XJ3 A;  4BLM A;  4P6Z M;  3O5Y A;  3HUO A;  2OLV A;  4WZ5 C;  3FZC A;  3Q7V A;  1MWR A;  4IBR A;  2E8J A;  4DKI A;  3EOI A;  1OTB A;  3MXS A;  4BD0 A;  5LBR A;  3ZG7 B;  1G6O A;  4S2J A;  3UPP A;  4JGO A;  3A3I A;  2JKF A;  2IA2 A;  3I7J A;  2V8C A;  4EQI A;  3MZD A;  3IHA A;  4QWO A;  1FIL A;  1SKO A;  1VEU A;  4B88 A;  3HRE A;  3PAG A;  1IEL A;  3ZNY A;  1HD8 A;  2MJ6 A;  3M6B A;  2W3G A;  1NZU A;  3VOZ A;  1PZO A;  1ZTU A;  1MKM A;  2B18 A;  3BEB A;  1VET A;  3G4P A;  3LY4 A;  3IH9 A;  4KZ8 A;  4LV2 A;  1F5M A;  3QP1 A;  1K0K A;  4FSF A;  2ZJ9 A;  2XEP A;  2W1R A;  1Y4O A;  1SKO B;  4LRX C;  4B4Z A;  4X1M A;  4U0X A;  1KOU A;  1F2K A;  2WUQ A;  2KOI A;  1FOF A;  3L9K A;  4IHQ A;  3ZDJ A;  3WRT A;  4CQH A;  5AQ7 A;  1JTG A;  3MSH A;  1NWZ A;  3LGO A;  5FI2 A;  5DKL A;  4LGW A;  5F1G A;  3SOI A;  5DFX A;  3UB9 A;  4MN7 A;  1F98 A;  1L2S A;  3G6O A;  1D1J A;  2BAS A;  2BLS A;  1BLC A;  4KZB A;  4HEF A;  5KMW A;  3CG5 A;  1GCE A;  1I5Q A;  5JYO A;  2GNX A;  4ZAM A;  4I38 A;  2ZQA A;  4EXO A;  2JN7 A;  4DDY A;  1S66 L;  5FL3 A;  2J8Y A;  2PYP A;  4EV4 A;  5EVE A;  5EVI C;  2WZX A;  3MKF A;  2VA0 A;  1Y54 A;  2DRW A;  4KZ3 A;  3P09 A;  2J3W A;  2H0T A;  4B9O A;  4X68 A;  3QP4 A;  1T1B A;  1Y28 A;  4YOF A;  1G28 A;  2A24 A;  2L1M A;  4EU0 A;  3CZD A;  2ZMA A;  3N7W A;  3ZG0 A;  1K38 A;  5L2F A;  1YMS A;  5EVI B;  3V50 A;  2L4R A;  1NJ4 A;  2O99 A;  2INW A;  3W4O A;  4MN6 A;  4M4X A;  3UDX A;  3M2K A;  2Z2L B;  4DMZ A;  1BTL A;  3WRZ A;  5DTK A;  3KSI A;  1TF1 A;  4RX2 A;  3C2W A;  2WGW A;  1MWS A;  3RFB A;  2M7U A;  3SZT A;  5EPH A;  1E25 A;  2B5R A;  3K3C A;  3N8R A;  3NBL A;  2PYR A;  4I5S A;  5AQA A;  1XJ6 A;  2EX9 A;  4EET B;  3K2N A;  3V5M A;  4AFI A;  1YQS A;  2KLI A;  3CWF A;  2VGL S;  4KQD A;  3VP0 A;  4HJ3 A;  2Y79 A;  1GHP A;  3NEC A;  4R3A A;  4X55 A;  5EVI D;  2OWH A;  3ZNT A;  4DE3 A;  5F1F A;  2WGW B;  3CUE A;  4E3N A;  3MQO A;  1NRF A;  3VSL A;  1KVL A;  3TJZ C;  2VGK A;  2ZC3 B;  3HCY A;  1SKF A;  2R78 A;  1P9R A;  4JPM A;  4WN5 A;  1LSV A;  1TVF A;  2VGL M;  3LIF A;  4R70 A;  5IU1 A;  4OPY A;  3GQZ A;  4EUZ A;  4C6Y A;  2PBD P;  3MFX A;  3VMA A;  4Y5F A;  3U2A A;  5EOE A;  1K55 C;  1EI5 A;  2QKP A;  4H8R A;  3G35 A;  3E98 A;  2XRN A;  4EBN A;  2XRO A;  2Y2M A;  4ZJ2 A;  4UA6 A;  3NY4 A;  5CTN A;  4KUO A;  4CLC C;  3PBO A;  1OPX A;  4JBF A;  3HJI A;  3IX3 A;  3ITB A;  3LIB A;  4FCF A;  3HLG A;  4Z9Q A;  3T4O A;  2WK0 A;  3M2J A;  4JXV A;  1O07 A;  5FAP A;  2OAQ 1;  2M7V A;  1TEM A;  1YLP A;  2K2N A;  1YLJ A;  3MFD A;  3UB5 P;  4Q0J A;  2WAE A;  1ZC2 A;  4CLC B;  1XGI A;  1RGZ A;  3C30 A;  1UWN X;  3QP8 A;  3EEH A;  1IFQ A;  3GMW A;  4UAA A;  2FFF B;  4RQ9 A;  3SS5 A;  3PTE A;  2BTF P;  1GHI A;  4U0T A;  1XJ4 A;  2W3E A;  1ZG6 A;  2Y2J A;  4QY6 A;  4WEL A;  3ZFZ A;  2Q9M A;  3EEA A;  1OTA A;  5HAI A;  4ZRR A;  4DE1 A;  4S2M A;  5DF9 A;  5D3O A;  1OTE A;  1ONH A;  1ERO A;  2QJ7 A;  4WBG A;  4ETX A;  2A2L A;  3HJK A;  1RGY A;  3RXX A;  3FV7 A;  1RP5 A;  3B3X A;  1KVM A;  4CLC D;  2QMI A;  5FQM A;  5TFQ A;  5HFO A;  5KSC A;  3N4I A;  2WZZ A;  1W7F A;  4EBL A;  1K57 A;  4NEE D;  4JF6 A;  1OME A;  2WAF A;  3IX4 A;  3AGE A;  1RCJ A;  4OLG A;  4R23 A;  3BFF A;  1FR1 A;  3CIT A;  4O7D A;  2WKR A;  2OSU A;  1X0O A;  4NK3 A;  3KSH A;  1FSW A;  1UWP X;  3WS1 A;  1ERQ A;  2P08 A;  3OBF A;  5G4Y A;  5GHX A;  2WGV A;  3CPT A;  1FR6 A;  4GHI A;  3IF5 A;  2CMN A;  4WZ4 A;  2FH5 A;  4KQR A;  5DF8 A;  2NUP C;  2V0U A;  1KE4 A;  3F1P A;  3BEC A;  3BLM A;  2JHE A;  1MXO A;  4DE0 A;  1H5X A;  3WWX A;  2Y4A A;  5CHM A;  4GDB A;  5L07 A;  4OP5 A;  4YFM A;  1U60 A;  3FKW A;  1WYC A;  5DKK A;  4S2P A;  1BZA A;  1P0Z A;  3QNC A;  4GB7 A;  3IXG A;  3CJM A;  4JXW A;  3F1P B;  2PDR A;  4CPK A;  2X01 A;  4E6X A;  1IKG A;  1PI4 A;  2EA9 A;  4O0P A;  1SDE A;  1K54 C;  1E3U D;  3IXB A;  5A90 A;  2H5S A;  3WS2 A;  2GX5 A;  4L9F A;  4WMC D;  4E3K A;  5CGS A;  5F68 A;  4BD1 A;  4WYY A;  3LYX A;  4IJG A;  4NKP A;  1FCM A;  3NDG A;  3T1S A;  4K91 A;  3VFF A;  2J80 A;  5EV0 A;  2Y8H A;  1NY0 A;  3OC2 A;  2VV6 A;  3DTE A;  4EEP A;  2V1Z A;  4S2N A;  5DJT A;  4C3Q A;  3DAV A;  1LL9 A;  1MWT A;  3PBT A;  1ONG A;  4FD8 A;  4HBU A;  1ES5 A;  1CF0 A;  4IUH A;  2I9V A;  2JCH A;  1ESU A;  2DNS A;  3DW0 A;  4PKY G;  2Q0O A;  3T1X A;  4UHU A;  2Z2M B;  4RA7 A;  2JKG A;  3LR5 A;  3PBS A;  2VEA A;  2EX2 A;  1Q2Q A;  2O0Y A;  4N92 A;  2XLN A;  2C6W B;  2V8F A;  2UWX A;  5KSH A;  1IYS A;  1GSX A;  3N8L A;  4I3A A;  2WKI A;  2DCF A;  3NHQ A;  4GD8 A;  2PAV P;  5FEF A;  5C5K A;  2EWW A;  4JF4 A;  3A3F A;  4F3L B;  3C7U A;  1O7E A;  5FI7 A;  3ZHH A;  1WA9 A;  5TBM A;  2VV7 A;  1KDS A;  3A0S A;  3IHB A;  4HIA A;  4OLD A;  1VHM A;  2QHK A;  2WKP A;  2Y2H A;  1TDL A;  4MCW A;  3UB6 A;  3VE3 A;  3IWO A;  5KZH A;  4HJ4 A;  4WM9 A;  2HJ9 C;  3QHY A;  1HVB A;  4OQ0 A;  1D7E A;  4DJ3 A;  1YAX A;  3O87 A;  5U47 A;  1GSW A;  5FAT A;  1JTD A;  4WUJ A;  4WZ5 A;  1MWU A;  3H9W A;  5TBM B;  2PU2 A;  3B33 A;  4GZB A;  5EFW A;  4XXR A;  1BLS A;  2WKH A;  3RTY A;  3V3R A;  3R4K A;  5J3W A;  4HY8 A;  3MR0 A;  1A0K A;  2ACG A;  1XFQ A;  2QPN A;  5M1A A;  3IWI A;  4BBV A;  3O3V A;  2P9V B;  2ZLY A;  3HL9 A;  1BUL A;  5I5L A;  4FTX A;  3LY3 A;  1ODV A;  5F83 A;  3DTI A;  2JC7 A;  3PBN A;  3KSF A;  4JXS A;  3VOL A;  1W63 Q;  3BY8 A;  4P6B A;  4KG2 A;  2B02 A;  3UE0 A;  3L7H A;  3MXR A;  1UGU A;  2OWJ A;  3E4Q A;  2HJE A;  2XH9 A;  2HDU A;  2V1B A;  5HDS A;  3IXH A;  4UEY A;  1L3L A;  3LIE A;  4FH4 A;  1KGF A;  1V9Z A;  1EWZ A;  2A3U A;  1QME A;  1XA7 A;  5E2E A;  4PM6 A;  3GTC A;  5GL9 A;  1LT0 A;  4S2O A;  4BJP A;  3S1Y A;  5GHY A;  4OOY A;  5KIZ A;  1TDG A;  2R9X A;  2GJ3 A;  3IQA A;  4ZBE A;  4GCZ A;  3UME A;  4GS9 B;  1FQG A;  3C4P A;  2ZC6 B;  4IVK A;  1FIK A;  4FH2 A;  2E8I A;  4ID4 A;  2PR6 A;  5HWT A;  4HH2 A;  1QMF A;  3BFE A;  1SZV A;  3SS4 A;  2YKF A;  3C4O A;  4E3I A;  3BQA A;  3R7W B;  4LV3 A;  2W3D A;  3C8C A;  3UNW A;  3BY9 A;  5EVI A;  4L9G A;  5FDH A;  4L9E A;  3Q7Z A;  3W4Q A;  4X56 A;  2G2U A;  1VQQ A;  2ZQ7 A;  3ISG A;  1NZO A;  5DVA A;  1AWI A;  3T1R A;  2J7V A;  1CK3 A;  5HZH A;  2IWD A;  2ZQ9 A;  4NXB A;  3TG9 A;  2ZOI A;  1IOU A;  1S4R A;  5HW3 A;  2OLU A;  3VP1 A;  1K25 A;  1XP4 A;  5CXW A;  4MLL A;  3H82 B;  5CHJ A;  4ZJ3 A;  1KE0 A;  1J3W A;  2HP5 A;  2PBY A;  4DF6 A;  5CGX A;  3NOU C;  1GSV A;  4BL3 A;  3CMZ A;  2Y2O A;  1CEG A;  2JKR M;  1IYQ A;  2V9A A;  4JF5 A;  5FQI A;  3KYZ A;  4Y17 A;  5FEG A;  1G6A A;  1STZ A;  3A3E A;  1VM1 A;  1FCO A;  4IBX A;  3LR3 A;  3SH9 A;  5FAO A;  4EES A;  3LIA A;  3MMH A;  3MXQ A;  3LCE A;  5L8M A;  3D72 A;  1PNE A;  4ETZ A;  3HBR A;  3LEZ A;  4CLC E;  1LHY A;  5EUA A;  5F69 A;  3T12 B;  3VSK A;  4Z1W A;  1HLU P;  1W8Y A;  4FOF A;  4E3O A;  2P7J A;  2Q9N A;  1MKI A;  1K55 A;  3PHY A;  1DP6 A;  3Q1F A;  4Q0I A;  1XJ2 A;  1YLZ A;  4ZTK A;  4CLC A;  4E04 A;  1MZU A;  5IS1 A;  1K4E A;  1S6R A;  2V2F F;  2JKT M;  4S2L A;  3HLF A;  4LFU A;  1PRQ A;  4PAU A;  2ZC7 A;  2M1C A;  1ERM A;  2ZC5 B;  3JPU A;  1XX2 A;  4ZJ1 A;  3MBZ A;  4ME4 A;  1H8M A;  1XFN A;  3AGF A;  2Z6D A;  5EOO A;  3PBR A;  3GVB A;  4LCM A;  4NXF A;  2WKQ A;  2HF6 A;  4XUZ A; 
#chains in the Genus database with same CATH homology
 2LB9 A;  4Q0H A;  4R6L A;  3UB7 A;  3LID A;  3LUQ A;  2GX5 A;  3EOI A;  1OTB A;  4L9F A;  2J3T D;  5LBR A;  5F68 A;  1G6O A;  5DFY A;  5CX7 A;  4JGO A;  2PT7 A;  1T1A A;  2IA2 A;  3LYX A;  2HV1 A;  4IJG A;  4NKP A;  1ZHH B;  3P7N A;  1OT9 A;  3KYQ A;  3MQ0 A;  2J80 A;  2Y8H A;  1NLY A;  2QWS A;  3OC2 A;  2VV6 A;  2XSS A;  4EEP A;  3LI9 A;  2A24 B;  5DJT A;  2MJ6 A;  2JKT I;  2W3G A;  2KDK A;  3FC7 A;  3PBT A;  1ZTU A;  1MKM A;  2B18 A;  5HDC A;  5HWW A;  3B42 A;  4IUH A;  2I9V A;  4GW9 A;  4PKY G;  1F5M A;  4HI4 A;  1YSQ A;  1OJ5 A;  3IBJ A;  4FSF A;  2W1R A;  5AVF A;  4LRX C;  3LR5 A;  3PXP A;  3PBS A;  5DJU A;  1KOU A;  1LL8 A;  4HP9 A;  5HSQ A;  2VEA A;  3TE8 A;  4Y2F A;  4OOM A;  4DN0 A;  2O0Y A;  2KOI A;  3CLO A;  3CUE C;  4IHQ A;  4UQI S;  4B93 A;  4CQH A;  4HP4 A;  4Y3I A;  5KSH A;  1NWZ A;  1GSX A;  5DKL A;  4I3A A;  3NOP C;  5DFX A;  3UB9 A;  3NHQ A;  4MN7 A;  5AJG A;  1F98 A;  2ZMV A;  2GZA A;  3K3D A;  4GLQ A;  5C5K A;  2EWW A;  2O9B A;  3BWL A;  3G6O A;  4JGR A;  2BAS A;  1DP8 A;  4BBU A;  1P9W A;  4HOI A;  4F3L B;  4YNR A;  3T4L A;  2VV8 A;  4HHD A;  5F5Y A;  3IBR A;  4WL9 A;  3UMD A;  1WA9 A;  3LIC A;  2GNX A;  2PD7 A;  5TBM A;  3MJQ A;  4I38 A;  4L0L A;  4EXO A;  4UQI M;  3NJA A;  2VV7 A;  1DP9 A;  3E0Y A;  2JN7 A;  3A0S A;  4HIA A;  3EQU A;  1S66 L;  5FL3 A;  3V67 A;  5HD5 A;  1VHM A;  2PYP A;  2QHK A;  2WKP A;  4WF0 A;  1MC0 A;  3PR6 A;  3ULF A;  4MCW A;  4I3J A;  3UB6 A;  3VE3 A;  1OTI A;  2VA0 A;  4HJ4 A;  3KO6 A;  4JGP A;  2HJ9 C;  4EQ1 A;  3LR0 A;  1D7E A;  4DJ3 A;  1YAX A;  2L0W A;  3TW8 A;  2J3W A;  3BQ8 A;  1GSW A;  4WUJ A;  4BBT A;  4B9O A;  3H9W A;  1T1B A;  1Y28 A;  4YOF A;  5TBM B;  1G28 A;  3NOT C;  2A24 A;  2L1M A;  4EU0 A;  3B33 A;  3F1N A;  5EFW A;  1S4S A;  3RTY A;  3R4K A;  3UE6 A;  5J3W A;  4HY8 A;  3LI8 A;  5G4Z A;  3MR0 A;  1XFQ A;  4O8G A;  3EGX C;  2L4R A;  4BBV A;  2O99 A;  2INW A;  1YSP A;  4HJ6 A;  4MN6 A;  5J7E A;  4M4X A;  2ZMF A;  4MN5 A;  3IS2 B;  5I5L A;  4DMZ A;  1NLZ A;  1ODV A;  4LPZ A;  3CAX A;  3PBN A;  3CI6 A;  4LRY C;  3KSI A;  3OCN A;  3KSF A;  1TF1 A;  3C2W A;  3F1N B;  3SW1 A;  2V1A A;  2W27 A;  3VOL A;  3RFB A;  2M7U A;  1W63 Q;  3BY8 A;  3S7N A;  1TS7 A;  4EW7 A;  2O9C A;  3F1O B;  2B02 A;  3BW6 A;  3K3C A;  1OJG A;  4MMN A;  2PYR A;  1T19 A;  2VZW A;  4I5S A;  1XJ6 A;  3E4O A;  4PHT A;  3T4J A;  4EET B;  3T4K A;  3K2N A;  3OLO A;  2V0W A;  1UGU A;  2OWJ A;  3E4Q A;  3OCL A;  1OTD A;  2HJE A;  4AFI A;  2KLI A;  3CWF A;  3A0V A;  2VGL S;  4KQD A;  2V1B A;  5HDS A;  5TJJ A;  4XT2 A;  5A8B A;  4HJ3 A;  4ARZ B;  2Y79 A;  2D02 A;  4PKY A;  4BWI A;  3VV4 A;  4R3A A;  1P97 A;  4UEY A;  4F3L A;  3LIE A;  2DMW A;  2LB5 A;  2OWH A;  1V9Z A;  2O9A A;  3CUE A;  2HGV A;  3ZYT A;  2EWV A;  3KX0 X;  3MQO A;  3LFV A;  3S7P A;  4EEU A;  1LT0 A;  3B47 A;  3FG8 A;  4BJP A;  2D01 A;  5KIZ A;  3TJZ C;  2GJ3 A;  3HCY A;  2R78 A;  1P9R A;  4H6J B;  1EW0 A;  4GCZ A;  4KUK A;  4WN5 A;  1LSV A;  3UB8 A;  3ZQ5 A;  2VGL M;  3LIF A;  4R70 A;  4XT2 B;  3UME A;  4GS9 B;  2ZBB A;  4WLA A;  5IU1 A;  2QJ5 A;  4IUK A;  3MFX A;  2PR6 A;  3FPV A;  5HWT A;  4Y5F A;  1OT6 A;  3U2A A;  1TD5 A;  4HH2 A;  3PBQ A;  2PHY A;  1N9O A;  2QKP A;  2YKF A;  5J4E A;  3E98 A;  2XRN A;  3BQA A;  3R7W B;  2YKH A;  4NXG A;  2OOL A;  4QPR A;  2K31 A;  2XRO A;  2W3D A;  3C8C A;  4WEK A;  5AVE A;  3BY9 A;  3D3O A;  4KUO A;  4CLC C;  3PBO A;  4L9G A;  1OPX A;  4I39 A;  3HJI A;  2W0N A;  4L9E A;  2OAP 1;  3LIB A;  4DJ2 A;  1D06 A;  1H3Q A;  4MDZ A;  3T4O A;  4HQA A;  5F6A A;  3EQV A;  3IS2 A;  1T1C A;  4GJ4 A;  4G3V A;  1LSW A;  2OAQ 1;  2P04 A;  2H28 A;  2M7V A;  1TS6 A;  1TS0 A;  4GHI B;  2K2N A;  4O01 A;  3H7W B;  3EGD C;  3EWK A;  5HZH A;  4LRZ E;  4NXB A;  3F1O A;  4Q0J A;  3UE3 A;  3C38 A;  4CLC B;  2ZOI A;  4OOL A;  1IOU A;  1S4R A;  1N9L A;  5K5B A;  3C30 A;  1UWN X;  3EEH A;  1LSX A;  1IFQ A;  4ARZ A;  4RQ9 A;  2VJW A;  3FPW A;  1S67 L;  3H82 B;  1BYW A;  1XJ4 A;  2W3E A;  3KSG A;  3A0R A;  3T50 A;  5HPF A;  4WEL A;  5IT5 A;  3EEA A;  1OTA A;  3BJN A;  4G3W A;  4ZRR A;  1W63 M;  3NOU C;  3W2Z A;  4I3I A;  1GSV A;  1V9Y A;  2JKR M;  3DBA A;  2V9A A;  5DF9 A;  1OTE A;  4H6J A;  5HL6 A;  3T4T A;  3KYZ A;  4EUV A;  2QJ7 A;  4ETX A;  1STZ A;  2A2L A;  2W3H A;  4GS9 A;  3HJK A;  4JGQ A;  3MQQ A;  2VX8 A;  5HD3 A;  3PYP A;  3GEC A;  4LLO B;  3LR3 A;  2VLG A;  4EES A;  3LIA A;  4CLC D;  3MMH A;  3MXQ A;  2PR5 A;  5L8M A;  3D72 A;  2FZ0 A;  3S7Q A;  2XA7 S;  4ETZ A;  1JNU A;  3ICY A;  3S7O A;  4NEE D;  4EER A;  4CLC E;  3P01 A;  3E4P A;  4HH3 A;  3R7W A;  4K08 A;  5F69 A;  2J3T C;  1NRJ A;  2KX6 A;  3CIT A;  2WKR A;  2K7S A;  1X0O A;  4Z1W A;  5HDD A;  4YWZ A;  2Z6C A;  3KSH A;  3OOV A;  1UWP X;  4FOF A;  2P08 A;  3OBF A;  2W3F A;  5HPI A;  2P7J A;  5G4Y A;  1S1Z A;  2XA7 M;  3PHY A;  4GHI A;  2CMN A;  3MF0 A;  1DP6 A;  1TS8 A;  4KQO A;  4Q0I A;  2W1T A;  3H7W A;  2FH5 A;  1XJ2 A;  2NUT C;  4HNB A;  2NUP C;  3LR4 A;  2V0U A;  4WEJ A;  3RH8 B;  3F1P A;  4R38 A;  2VKS A;  3T4S A;  2JHE A;  2PD8 A;  4CLC A;  4E04 A;  4P6Z S;  2JKR I;  1MZU A;  1S1Y A;  1YKD A;  5IS1 A;  1T18 A;  1DRM A;  1N9N A;  2JKT M;  5MC7 A;  2ZOH A;  5HWV A;  2QYB A;  4G3K A;  3GDI A;  3TRC A;  4PAU A;  2M1C A;  4BMW A;  5DKK A;  3H82 A;  3VE4 A;  1P0Z A;  1F9I A;  2G7U A;  3T4Q A;  4NXE A;  3JVU A;  2W1T B;  4II7 A;  4ME4 A;  1H8M A;  1XFN A;  3F1P B;  2PDR A;  2Z6D A;  3PBR A;  3JVV A;  1XJ3 A;  1VB6 A;  2EA9 A;  4NXF A;  4O0P A;  4P6Z M;  3O5Y A;  2WKQ A;  2HF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...