5HWWA

Crystal structure of pas1 complexed with 1,2,4-tmb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
GAMALYEFVGLLDAHGNVLEVNQVALEGGGITLEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
molecule tags Transferase
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwwA00
3B33A 5DKLA 4EW7A 4LPZA 4HH2A 3HJIA 4K08A 3RH8B 4EERA 2D01A 1DP9A 4BBUA 2YKFA 1DRMA 3K3CA 4LRYC 3LIEA 3PHYA 4NXFA 2I9VA 4XT2B 3IS2A 3VE3A 1OJ5A 1TS8A 3F1OB 3CWFA 4PKYG 4HHDA 5HWWA 4EEPA 3UB6A 4EETB 5HDCA 3GECA 1XFNA 1LT0A 1OTDA 4HJ3A 2PR5A 3LI9A 2YKHA 3LIBA 2P7JA 4HI4A 3MJQA 3K3DA 5J3WA 4R38A 1LSXA 3UB8A 5KIZA 4H6JB 2KDKA 3BWLA 1D7EA 1LSVA 1N9LA 5HZHA 3MQOA 2INWA 3EWKA 2ZOHA 5A8BA 5TBMB 1DP8A 1V9ZA 3MR0A 2PD8A 3LIDA 2W27A 1G28A 1X0OA 3A0VA 2W0NA 2WKRA 5G4ZA 3EEHA 1LSWA 2VV6A 2WKQA 4L9GA 1WA9A 4EXOA 2GJ3A 5G4YA 4JGQA 3KX0X 3IS2B 2QKPA 1OTBA 1F9IA 3A0RA 4R3AA 4R70A 3H7WB 4WL9A 2V1BA 4RQ9A 4E04A 3MQQA 4KQDA 1KOUA 5HD3A 1DP6A 2OWJA 2CMNA 1N9OA 4HP4A 1NWZA 4M4XA 4KUOA 4DJ2A 1UGUA 1OTIA 4WF0A 3ULFA 3CLOA 4HP9A 3PYPA 4PKYA 1MZUA 2VV8A 4HY8A 4GHIB 3ICYA 4NXEA 3UMEA 3ZQ5A 3H82B 5F69A 2J80A 4F3LA 3F1PA 2H28A 1XJ2A 4MN5A 3UB9A 1TS6A 4MN6A 4HQAA 2ZBBA 2EA9A 3NJAA 2A24A 2PHYA 3E4QA 5J7EA 3CAXA 3IBRA 5HWTA 4LRZE 3NHQA 4I3IA 1S4SA 1TS0A 2PD7A 5F68A 3P7NA 5DJUA 5HSQA 1XJ3A 3UB7A 1T18A 4I38A 1S1YA 2OOLA 1T19A 4JGPA 1V9YA 2PYPA 4WUJA 1OJGA 2OWHA 3LIFA 4KUKA 2L0WA 5DKKA 2KX6A 1GSXA 4WN5A 5F5YA 1S67L 4NXGA 4GS9A 2L4RA 3HJKA 5AVFA 1ODVA 3VOLA 1XFQA 4I39A 1D06A 2L1MA 2QJ7A 3F1NA 3NOPC 5AVEA 2WKPA 2Z6DA 1VB6A 2V0UA 3LI8A 1OTAA 4HOIA 3RTYA 5IU1A 2ZOIA 5J4EA 1Y28A 3MFXA 4GW9A 5HD5A 4EQ1A 2V0WA 2QWSA 2D02A 2K7SA 1JNUA 1OT6A 4EESA 3D72A 1XJ6A 2PYRA 4WLAA 5TBMA 3E4OA 3UMDA 1S4RA 1UWNX 4I3AA 4L9EA 2V1AA 4HH3A 3BY8A 4HJ4A 1T1AA 2VLGA 3G6OA 2R78A 3BY9A 3T50A 3FC7A 4I5SA 5I5LA 4LLOB 2HV1A 3NOTC 4GS9B 1T1BA 5HDSA 2V9AA 2M1CA 3LYXA 3H7WA 3UE6A 4HIAA 5HWVA 2B02A 3F1NB 3H9WA 2VV7A 3SW1A 3E4PA 1UWPX 3GDIA 3C2WA 1EW0A 3MXQA 2JHEA 1TS7A 4B9OA 4YWZA 5EFWA 1OT9A 4HJ6A 4GCZA 1LL8A 5DJTA 4L9FA 4XT2A 4JGOA 4GHIA 2Z6CA 4I3JA 3F1OA 1GSWA 2PDRA 4DJ3A 1P97A 1BYWA 3NOUC 3H82A 2QJ5A 4NXBA 3VE4A 3LICA 4BBTA 1F98A 2JN7A 5IS1A 4LRXC 4JGRA 1S66L 1N9NA 2VEAA 4HNBA 1S1ZA 5HDDA 3LIAA 4BBVA 4F3LB 3F1PB 2PR6A 4H6JA 4R6LA 1T1CA 1XJ4A 3A0SA 5F6AA 3LUQA 2A24B 1P0ZA 1OTEA 2BASA 3FG8A 3C8CA 4EEUA 2QHKA 3OLOA 1GSVA
chains in the Genus database with same CATH superfamily
1GCEA 4DKIA 2A2LA 1D1JA 4Q0IA 1EI5A 3MF0A 4KZ7A 4K08A 2G7UA 3PBNA 1XXMA 1LL9A 1DP9A 2WKIA 1KE0A 2Y8HA 3K3CA 3LY4A 4LRYC 4N1XA 2Y2HA 1A0KA 1NJ4A 3MFDA 3E98A 1OJ5A 1NZUA 3DAVA 2XD1A 3CWFA 1K4FA 4QPRA 5F1FA 1FOFA 5DVAA 1KVMA 3TW8A 4KZ6A 3O88A 1QMEA 1PI5A 4R4RA 1PWDA 3GECA 4HESA 3ZG0A 1XFNA 1LHYA 4QB8A 1YLJA 3MKEA 1VETB 2YKHA 1YLTA 2FFFB 5LBRA 3VP2A 5DFYA 1NYYA 3MQ0A 5J3WA 1KDSA 2H0YA 2EFXA 4KZ5A 4E6WA 2CC1A 1H8ZA 1CI9A 3BWLA 3O5YA 3EGDC 3IQAA 3A3EA 3WWXA 5AQAA 2INWA 3U4LP 5GLDA 1NRFA 3FYZA 2XH9A 3ZG5A 5TBMB 1DP8A 5HFOA 3OPRA 1K0KA 2PD8A 4MEZA 4B4XA 1G28A 3A0VA 3BJNA 4WELA 4DDSA 3KSIA 4S2JA 1LSWA 2VV6A 2WKQA 2GZAA 3BLSA 3MZEA 1WA9A 4IHQA 3R4KA 3UPOA 4EXOA 2Y55A 3GV9A 1DJCA 1Y54A 4ZAMA 1IYQA 2FFYA 2QKPA 3DTMA 1YSQA 4R70A 3VP1A 1KE4A 3HUOA 4MCWA 1PYYA 3UO9A 3MQQA 1TVFA 1E3UA 1KGFA 1KOUA 3HLGA 3PBQA 1MWSA 4S2PA 1BZAA 1KGGA 4UAAA 1NWZA 4C3QA 4X56A 3FKWA 1NYMA 3LGOA 3O87A 1MBLA 1UGUA 1K4EA 4KZ8A 1OTIA 3ULFA 3CLOA 3IWOA 2RCXA 1ESIA 1XGJA 1BULA 5HAQA 3IF6B 1PNEA 4NXEA 2VX8A 3W4QA 4KZBA 5CGXA 4C6YA 4KG5A 2XK1A 4GD6A 2J80A 4F3LA 3GRJA 1XJ2A 4MN5A 1TS6A 4HQAA 2EA9A 3NJAA 4MMNA 4WZ5C 2PHYA 1RCJA 3CAXA 2C6WB 5HWTA 2EFUA 5EOEA 5M19A 4I3IA 1YLZA 4OH0A 2JKRM 2PD7A 5F68A 4P0MA 5DJUA 4CLCD 5F82A 5HSQA 3S4XA 4L0LA 3BM6A 1LI9A 4KZAA 1S1YA 1T19A 3Q07A 2ZC6B 4JGPA 3SH9A 2AVXA 2XA7M 1OJGA 3VFHA 3SH7A 5FQIA 3BFEA 2H5SA 1NLYA 2KX6A 2Z2LB 3ZGAB 1FR6A 4EQIA 4G3VA 3C4PA 1S67L 4E6XA 1FSYA 3K2NA 3PTEA 4WEJA 1XP4A 4Z1WA 1GA0A 3C38A 4DXCA 4NEED 1M40A 1ODVA 5GHYA 3DTIA 4I39A 2BG1A 1BLCA 3UNWA 4PM6A 2WKPA 2Z6DA 3LFVA 3WS1A 4EBLA 3A3FA 3LI8A 4ZBEA 1VETA 4LGWA 1ZTUA 4JXGA 3T4LA 2R9WA 4QU3A 1PZOA 4KQOA 1IELA 5TGFA 2Y2MA 4OPZA 3BECA 4PPRA 4P6BA 1FCOA 4NETA 5FEFA 4YFMA 2EX6A 4A5RA 1H0MA 1W7FA 1YAXA 2EXBA 1DY6A 5TBMA 3E4OA 2WK0A 1S4RA 1K55C 4FCFA 4L9EA 1G6AA 5HPIA 3PAEA 3G6OA 2R78A 3T4OA 3UDFA 3BY9A 3T50A 5CERA 2ZLYA 3Q81A 3S1YA 3FV7A 5C5KA 1L2SA 2JCHA 1BLHA 3QHYA 4JF4A 3BEBA 3DW0A 4BL2A 3LR3A 3NOTC 4GOGA 4JLFA 1T1BA 2WZZA 2V9AA 4HEFA 1F2KA 2ZL1B 3ZHHA 3NI9A 1MWTA 2O0YA 2B02A 1VEUB 3F1NB 3H9WA 1JWPA 1TDGA 3BFGA 2VV7A 3SW1A 4JKTA 3E4PA 2PRFA 5HAIA 4M3KA 3C2WA 1TF1A 2JHEA 5HW3A 2W3DA 4B9OA 3VP0A 1FIKA 1OT9A 3CG5A 1LL8A 4DN0A 4BLMA 4ZJ1A 5EVIC 2Y2LA 1QMFA 2R9XA 3HL9A 3F1OA 4FSFA 4N9LA 4KZ9A 4DJ3A 1P97A 3GR2A 4EBNA 2V8FA 3WRTA 2VA0A 1Q2QA 2V20A 4EU0A 3QP4A 1U60A 4ZDXA 2P9VA 4ZTKA 1P9RA 3PBOA 4CLCC 1ERQA 3IF5A 1F98A 3BQAA 2W1RA 2W3EA 2XROA 4XUXA 2O9BA 4PAUA 2OSUA 4NKPA 1S66L 1N9NA 4HNBA 1XA1A 4EBPA 1HD8A 5EUAA 4H6JA 3T1QB 1E3UD 4FH4A 5F6AA 2A24B 2BASA 1OMEA 4X1MA 1ACFA 3C8CA 1STZA 2J7VA 3OCLA 1ZC2A 3QP8A 3MSHA 3S7OA 4Y5FA 2ZM0A 2ZQDA 2Y2JA 2M7VA 3OCNA 2OLVA 1TD5A 3LCEA 4HH2A 4DE0A 3NC8A 3P01A 2ZJ9A 3C30A 2B18A 2YKFA 5TJJA 1I2WA 1K57A 4BWIA 1G5UA 3VMAA 1MC0A 3IS2A 5AQBA 5EVLA 3Q7VA 3O86A 3VSLA 5HWWA 4KG2A 3CI6A 2ZC7A 4EEPA 2HGVA 4Z9QA 5HDCA 3TJZC 3KO6A 3BFCA 5FAOA 1G68A 3M6BA 3VSKA 2XD5A 2HJ9C 4KENB 1ES2A 3WS5A 3LIBA 3FWLA 2P7JA 5KSHA 4IUKA 3MJQA 4CQHA 1Z6FA 4R38A 1LSXA 1XX2A 3UB8A 4K0WA 5F1GA 5HZHA 3MQOA 1LI0A 2ZOHA 3N4IA 3ZG7B 2Y2NA 3D3OA 5A8BA 4GLQA 1YPRA 2PBYA 3WRZA 3GQZA 1V9ZA 3MS6A 4GNUA 4U0TA 1GA9A 2ZC4B 1SHVA 5G4ZA 1FILA 3PBRA 5FEGA 4GKUA 4P85A 2JE5A 1VEUA 1XA7A 1BTLA 2DMWA 1O7EA 5G4YA 5EPHA 4G3KA 3WS0A 1JTDA 5GHXA 4E3OA 1OTBA 1F9IA 4D2OA 5FI2A 2VGLS 3QNBA 4P6ZS 2W3HA 4PHTA 3KYQA 1J9MA 4KQDA 5L09A 5DF7A 5FL3A 2VGKA 3DWZA 3G32A 1BUEA 4HP4A 5CHMA 4H8RA 3DTKA 4X53A 1K56A 4E3KA 4IVKA 3G35A 3B3XA 3D9YA 4PKYA 1MZUA 2J3WA 2KOIA 5FI7A 2B5RA 4E3LA 5L10A 2WZXA 3UMEA 4WMCA 3O3VA 1EWZA 1MPLA 4HBTA 5MC7A 4GD8A 2Y2PA 4GJ4A 1SDNA 4RX2A 4OOLA 3HLBA 3CZDA 4HBUA 2QYBA 4QD4A 3ZNYA 5L8MA 2ZBBA 3E2KA 2NUTC 3KYZA 2A24A 2XGNA 2XLNA 3C5AA 4N92A 3NHQA 4PMAA 1EROA 3TSGA 3HUNA 1ES4A 2WADA 2C5WB 5FQMA 1PI4A 1RGZA 3UB7A 4FH2A 4LFUA 1T18A 5FQKA 4RA7A 3NBLA 4GDBA 1IKGA 1WYBA 2OWHA 1K54C 3IX3A 2RL3A 4JXVA 2L0WA 5DKKA 4Y3IA 5FDHA 2E8JA 1GSXA 5CEBA 4GS9A 1Z09A 4OQHA 3B42A 4Q8IA 5AVFA 3KYEA 3Q7ZA 3QNCA 2XDMA 3IXDA 2ZD8A 2V0UA 2XEPA 4OPQA 5GLCA 5IU1A 5J4EA 1Y28A 4GW9A 1W63M 5HD5A 1VM1A 4S2NA 3SS4A 4YNRA 1S6RA 1H3QA 2D02A 3VOYA 3NDGA 4FUWA 3MXSA 1JNUA 3G34A 3IXGA 3ZYTA 5JYOA 3CUEA 4OOMA 1IYPA 3OC2A 2KLIA 5DTSA 1L0FA 1UWNX 2O9CA 1I5QA 3BY8A 2VK3A 1HVBA 3BYDA 2EWWA 1PFLA 1E4DA 3VP4A 4I5SA 1SKOB 5I5LA 4NG2A 3N8SA 4E3JA 2HV1A 1MY8A 4Y0UA 4Y17A 4K91A 1PRQA 3BRMA 1GHMA 2M1CA 5HDSA 3TRCA 2P04A 2B95A 3LO7A 2P08A 4BMWA 3MKFA 5EE8A 5F83A 4LENA 3BW6A 4X69A 3HLCA 4OOYA 4IBRA 3VP3A 2H10A 1WE4A 3EQVA 3LR5A 2PU2A 1BLSA 1YSPA 1XKZA 3PR6A 1C3BA 3LR0A 4S2IA 4YWZA 4XUZA 3HLDA 2HP5A 4PM9A 4GCZA 1KDWA 4WBGA 4UA7A 4OQIA 2W1TB 1HZOA 2O99A 4E3NA 3GMWA 1GSWA 2PDRA 3A3DA 3R7WB 1SKFA 2OAP1 2QJ5A 2NUPC 3GVBA 1ALQA 1IEMA 3LICA 1SCWA 2EX2A 2WKHA 1ES3A 5CGSA 2DCFA 5CECA 4RX3A 2J8YA 1YMXA 4S2KA 4MN7A 3OOVA 1S1ZA 3FZCA 4R23A 3NIAA 4DDYA 1ZKJA 2PR6A 2IWBA 2JKTM 1K25A 1T1CA 4EV4A 5E2FA 3RXWA 3S7NA 3SOIA 3FG8A 4BD1A 5EVIB 2WAEA 4DE1A 3UPNA 1L0EA 3LEQA 2EX8A 2J9PA 1K56D 4WEKA 2ACGA 1VQQA 2X71A 4X1LA 3Q1FA 4EW7A 3SS5A 3HJIA 3WS4A 3RH8B 2K2NA 2D01A 2IWCA 4CLCB 3M2KA 5J8XA 4GDNA 4BBUA 4WMCD 3AGEA 1DRMA 2ZMAA 4PM5A 3LIEA 3PHYA 4LV3A 5CTNA 3NECA 4XT2B 1ESUA 2J3TD 4CLCE 4BENA 5FA7A 2Z2MB 3VE3A 3CJMA 1TS8A 3BFDA 2PAVP 4R4SA 1PW8A 4X25A 1H8YA 4ARZB 2ZQAA 5I94A 4HHDA 4ID4A 4LV0A 2HP6A 3ZG8B 4C75A 5IT5A 2WYXA 4U3TA 1LT0A 1OTDA 1JVJA 3DWKA 2ZMFA 3N7WA 5M18A 2XFSA 1K57C 3TG9A 4LV1A 4HI4A 1JWZA 5CX7A 3K3DA 4ZJ3A 2GDNA 4UHUA 5KIZA 5DTTA 3HUMA 2LB5A 4PM7A 3T4TA 1ONGA 1N9LA 3IF6A 3MMHA 2EX9A 1WYCA 4FOFA 1YMSA 2WUQA 5GHZA 2HDUA 1SKOA 2Q0OA 1KGEA 3E2LA 3VV4A 4OPRA 3MZDA 2W27A 2HP9A 2X02A 4IBXA 4S2LA 5AQ7A 2W0NA 2WKRA 4DRTA 2G2WA 3HVFA 2VJWA 2W3GA 4E3IA 3QP6A 2Y2IA 1ZHHB 1ES5A 1YKDA 3UDIA 5A93A 1YLWA 2WGWB 3KX0X 5EM0A 1K55A 4IUHA 4R3AA 4Y2FA 2V8CA 2JBFA 4R3JA 3BLMA 5EVEA 1PWGA 1NRJA 4WL9A 3IBJA 3JVUA 5CHUA 3M6HA 2M7UA 1P9WA 2LB9A 4RQ9A 3T4QA 4E04A 3LR4A 2ZMVA 4NK3A 1DP6A 2OWJA 1DJAA 2QZ6A 4R1GA 2CMNA 4FTXA 4WZ4A 3G30A 2EXAA 3GTCA 3MZFA 3DBAA 3R7WA 4HP9A 1Y4OA 3PYPA 4O8GA 2VV8A 1GHPA 4HY8A 4B93A 4R0QA 3ICYA 3QP2A 3IWQA 4EUVA 2Y4AA 3H82B 5F69A 3JPUA 4O01A 4OLGA 5DF9A 2XR0A 4WYYA 2HPBA 2H28A 2QMIA 2ZQ7A 3UB9A 4MN6A 4DMZA 3V3RA 1I2SA 3E4QA 1M6KA 3IBRA 4X55A 5EVIA 3NULA 4LRZE 2PU4A 1TS0A 2Y79A 4P87A 3OPPA 4Q0HA 1MKMA 2JKRI 5FAPA 2XRNA 2PT7A 5CGWA 4ETXA 2OOLA 1CEFA 1RGYA 3MBZA 5FAQA 3SS3A 4YOFA 1H8MA 1E25A 5GLAA 5FDSA 1V9YA 4Y15A 2PYPA 2J3TC 3LIFA 4KZ4A 4ME4A 2K31A 3UE1A 1L0DA 4K0XA 4UQIS 3V67A 3UN7A 5EOOA 4OP8A 2BLSA 3ITBA 1PWCA 3HJKA 1XGIA 5E2GA 2BTFP 4ARZA 4Y7PA 4UA9A 3L9KA 2ZL1A 4N9KA 1XFQA 4CJNA 5JYPA 2L1MA 3F1NA 3IHBA 3P98A 1FCNA 3T1RA 3VOZA 4MDZA 2X01A 4GZBA 1ONHA 4HOIA 3RTYA 3IXHA 3N8RA 3MFXA 5D3OA 2V0WA 1NXYA 4Y13A 2Q9NA 2DNSA 2JKTI 2K7SA 2FH5A 4B88A 4OQ0A 3SH8A 1L3LA 3M2JA 4X6TA 3V39A 1XJ6A 2PYRA 5E2EA 3QP5A 2Y91A 4WLAA 4YINA 5L2FA 4LCLA 1VHMA 3UMDA 3P09A 1ZG4A 3OZHA 4HH3A 1N4OA 3IH9A 4HJ4A 4S2MA 2HJEA 4JXSA 3C7VA 3NCKA 1ZG6A 3HBRA 4MBFA 4S2NC 2HZ5A 1H5XA 3FC7A 3W4OA 3EEAA 2MJ6A 3EOIA 4LLOB 4DE3A 1OPXA 3CUEC 4S2OA 2WGWA 1FQGA 2GX5A 2H0TA 3FPWA 2ZM2A 4XXRA 1BT5A 1W8QA 4BL3A 4HIAA 5HWVA 3S22A 4OVDA 3LY3A 4ZJ2A 4O7DA 1NLZA 3N8LA 5FI6A 2A49A 3GDIA 1IKIA 1TS7A 4IJGA 5GLBA 4RVAA 3CMZA 1NY0A 4HJ6A 4IEDA 1YM1A 5FQJA 5DJTA 1LLBA 3CPTB 2OAQ1 3V50A 3NY4A 4L9FA 3IH8A 3PXPA 1YLPA 4ZRRA 2OV5A 3D4FA 4QY6A 3IX4A 1BYWA 4G3WA 3NOUC 3BQ8A 3H82A 3ZFZA 3PBSA 2Y2OA 4BJPA 5AQ9A 4DXBA 2JN7A 5IS1A 4LRXC 3ZVTA 1NZOA 4JGRA 1W63Q 5E2HA 2VEAA 3LIAA 1MWUA 3RXXA 5HARA 3F1PB 1FSWA 4R6LA 3KSHA 2VZWA 3C4OA 3S7QA 1IFQA 3A0SA 2ZM8A 2JKGA 3L7HA 1OTEA 3AGFA 4KQRA 1CK3A 3FKVA 3IWIA 3TOIA 2ZC5B 5DF8A 1GSVA 3B33A 5DKLA 3ISGA 4II7A 4FD8A 4LPZA 3UE0A 2HDQA 4EERA 4O0PA 2P74A 3QP1A 2PBDP 2Y2KA 2JC7A 1YLYA 1K6SA 5DFXA 2ZQCA 4NXFA 1AWIA 1DJBA 2I9VA 2GNXA 4WM9A 4KZ3A 3RFBA 3F1OB 3Q82A 4PKYG 5A92A 4PM8A 2XQZA 1FCMA 5FQQA 2ZQ8A 3T4SA 4UQIM 3UB6A 4EETB 5EVID 4JF6A 3KSGA 1MWRA 1K54A 3UE3A 3ZDJA 1K6RA 3S7PA 2P9VB 1CI8A 4HJ3A 3HLWA 3U2AA 3OBFA 3IT9A 2PR5A 3LI9A 5K5BA 4Q0JA 1SZVA 3ZNTA 1KVLA 3IHAA 5CEDA 4H6JB 2VGLM 3EGXC 2KDKA 1D7EA 1LSVA 1PZPA 4P6ZM 1ERMA 5A91A 3W8KA 2OLUA 3EWKA 3CITA 3OPHA 5IHVA 2JKFA 3HREA 1F5MA 1AXBA 1O07A 4Y0OA 3MR0A 1Q2PA 3JYIA 3LIDA 1JWVA 3DTEA 1MKIA 3KSFA 1X0OA 3PBTA 3LEZA 2IWDA 1KE3A 5HX9A 2G2UA 5HAPA 3EEHA 2ZQ9A 3UY6A 4L9GA 4B4ZA 4ESPA 4LV2A 3A3IA 4KQQA 3IF6C 2HF6A 2GJ3A 4JGQA 3IS2B 3G4PA 1GHIA 3AGDA 2A3UA 3A0RA 3Q7VB 4UEYA 1CF0A 5AJGA 3H7WB 2V1BA 2XFTA 5EECA 3N6IA 4ETZA 5HD3A 1W79A 4JBFA 4EUZA 3CPTA 4MLLA 1N9OA 3ZG9B 5KSCA 4M4XA 4KUOA 5GL9A 3I7JA 4CPKA 4DJ2A 3UDXA 4DE2A 4WZ5A 4RYEA 4WF0A 3RJUA 3PAGA 4UA6A 2V2FF 2Y2QA 3ZVWA 5CHJA 1G6OA 1YQSA 4D60A 4GHIB 1W8YA 1PW1A 3EQUA 3ZCZA 3ZQ5A 1FR1A 1CEGA 3F1PA 5HPFA 4BD0A 3HLFA 4OP5A 4JF5A 2FZ0A 5J7EA 5KMWA 5CRFA 3VFFA 1S4SA 4DF6A 3G31A 3P7NA 5KZHA 2WGIA 1XJ3A 3HCYA 4I38A 3JVVA 5BOHA 1W5DA 4X68A 1JTGA 4WUJA 4KUKA 3OPLA 5L07A 1L0GA 2QPNA 5M1AA 3V5MA 1IYOA 1YT4A 4WN5A 5F5YA 4NXGA 3HLEA 2L4RA 5EM1A 2HDRA 4JPMA 3VOLA 3T1SA 5CXWA 2HDSA 1D06A 2QJ7A 3NOPC 5CTMA 3E0YA 5AVEA 5FASA 5EV0A 1VB6A 1SDEA 4U0XA 4OQGA 4EWFA 1OTAA 1S0WA 2ZOIA 2DRWA 4EQ1A 2Q9MA 4QY5A 2QWSA 1TEMA 1XPBA 4OONA 1LL5A 1PIOA 2W1TA 4MNRA 1OT6A 4EESA 3SZTA 3D72A 2EWVA 1MXOA 4OKPA 4QJGA 4MBHA 2XF3A 4I3AA 2UV0E 1HTZA 2V1AA 3W2ZA 3UPPA 1T1AA 2VLGA 5TFQA 4MBKA 3G2YA 3T4JA 5G18A 4Y0TA 2VGJA 2W3FA 2E8IA 5HL1A 4E3MA 5FATA 4GS9B 3LYXA 3NDEA 2Y2GA 4OPYA 3H7WA 3UE6A 1CJFA 2O9AA 4LCMA 4JXWA 3WS2A 1HLUP 1RP5A 5DTKA 1UWPX 1CQAA 1EW0A 3MXQA 2XSSA 4GB7A 4QWOA 1IOUA 1K38A 4CLCA 2ZC3B 5EFWA 1J3WA 3IX8A 4N1HA 3MXRA 2Y59A 3V3SA 4R3BA 4XT2A 3TE8A 4IVIA 4JGOA 4GHIA 2Z6CA 3W4PA 4I3JA 1BSGA 1IYSA 5A90A 3FPVA 4KG6A 2WKEA 2I72A 5E43A 3IXBA 3CHWP 4NXBA 2J9OA 2WGVA 3VE4A 3T1XA 3C7UA 5HL6A 4BBTA 4BQMA 5U47A 2V1ZA 2WAFA 4GN2A 4F94A 3ITAA 5HDDA 4OLDA 3T12B 4BBVA 1BLPA 3B47A 4F3LB 2XA7S 3A3JA 3T4KA 2VKSA 2UWXA 1XJ4A 3UB5P 5FSRA 3GSGA 3G2ZA 3LUQA 2IA2A 1P0ZA 1TDLA 4QHCA 5FQ9A 4EEUA 4AFIA 2QHKA 3BFFA 5TR7A 3OLOA 1N9BA
chains in the Genus database with same CATH topology
3B33A 5DKLA 1TD5A 2A2LA 4II7A 4Q0IA 4EW7A 4LPZA 4HH2A 3MF0A 3HJIA 4K08A 2G7UA 3RH8B 3P01A 2K2NA 3PBNA 4EERA 2D01A 3C30A 2B18A 4O0PA 4CLCB 1DP9A 4BBUA 2YKFA 1DRMA 5TJJA 2Y8HA 5DFXA 3K3CA 4BWIA 4LRYC 3LIEA 3PHYA 4NXFA 1MC0A 2I9VA 4XT2B 2GNXA 3IS2A 2J3TD 4CLCE 3E98A 3RFBA 3VE3A 1OJ5A 1TS8A 3F1OB 3CWFA 4PKYG 4QPRA 4ARZB 4HHDA 5HWWA 3CI6A 3T4SA 4EEPA 4UQIM 3TW8A 3UB6A 2HGVA 5HDCA 4EETB 3TJZC 3KO6A 3KSGA 3UE3A 5IT5A 3GECA 3S7PA 1XFNA 1LT0A 1OTDA 2HJ9C 2ZMFA 4HJ3A 3U2AA 3OBFA 2PR5A 3LI9A 2YKHA 5K5BA 3LIBA 4Q0JA 2P7JA 5LBRA 5KSHA 5DFYA 4HI4A 4IUKA 3MQ0A 3MJQA 5CX7A 3K3DA 5J3WA 4CQHA 4R38A 1LSXA 3UB8A 5KIZA 4H6JB 2VGLM 3EGXC 2KDKA 3BWLA 1D7EA 2LB5A 1LSVA 3T4TA 3O5YA 3EGDC 1N9LA 4P6ZM 5HZHA 3MQOA 2INWA 3EWKA 3CITA 3MMHA 2ZOHA 4FOFA 1F5MA 3D3OA 5A8BA 4GLQA 5TBMB 1DP8A 1V9ZA 3MR0A 2PD8A 3LIDA 3VV4A 3KSFA 2W27A 1G28A 1X0OA 3A0VA 3BJNA 3PBTA 2W0NA 2WKRA 5G4ZA 3EEHA 4WELA 3KSIA 2VJWA 1LSWA 2VV6A 3PBRA 2WKQA 2W3GA 2GZAA 4L9GA 1WA9A 4IHQA 3R4KA 4EXOA 1ZHHB 2HF6A 1YKDA 2DMWA 2GJ3A 5G4YA 4JGQA 3KX0X 4G3KA 3IS2B 2QKPA 4IUHA 1OTBA 1F9IA 3A0RA 4R3AA 4Y2FA 4UEYA 1YSQA 4R70A 2VGLS 5AJGA 1NRJA 3H7WB 4WL9A 4P6ZS 2V1BA 3IBJA 2W3HA 4MCWA 3JVUA 4PHTA 2M7UA 1P9WA 2LB9A 4RQ9A 3T4QA 3KYQA 3MQQA 4E04A 3LR4A 2ZMVA 4KQDA 1KOUA 4ETZA 3PBQA 1DP6A 2OWJA 5HD3A 2CMNA 5FL3A 1N9OA 4HP4A 1NWZA 4M4XA 4KUOA 4DJ2A 1UGUA 3DBAA 3R7WA 1OTIA 4WF0A 3ULFA 3CLOA 4HP9A 3PYPA 4PKYA 1MZUA 2J3WA 4O8GA 2VV8A 2KOIA 1G6OA 4HY8A 4GHIB 4B93A 3ICYA 4NXEA 2VX8A 3EQUA 3UMEA 4EUVA 3ZQ5A 5MC7A 3H82B 5F69A 4O01A 4GJ4A 2J80A 4OOLA 5DF9A 4F3LA 3F1PA 2QYBA 5HPFA 2H28A 1XJ2A 5L8MA 4MN5A 3UB9A 1TS6A 4HQAA 2ZBBA 4MN6A 2EA9A 2NUTC 3KYZA 3NJAA 4MMNA 4DMZA 2A24A 2PHYA 2FZ0A 3E4QA 5J7EA 3CAXA 3IBRA 5HWTA 4LRZE 3NHQA 4I3IA 1S4SA 1TS0A 2JKRM 2PD7A 2Y79A 5F68A 3P7NA 5DJUA 4CLCD 5HSQA 4Q0HA 1MKMA 1XJ3A 2JKRI 4L0LA 3HCYA 3UB7A 2XRNA 1T18A 2PT7A 4I38A 1S1YA 4ETXA 2OOLA 1T19A 4YOFA 1H8MA 3JVVA 4JGPA 1V9YA 2XA7M 2J3TC 2PYPA 1OJGA 2OWHA 3LIFA 4WUJA 4KUKA 4ME4A 2K31A 2L0WA 2M7VA 1NLYA 5DKKA 2KX6A 4Y3IA 4G3VA 4UQIS 1GSXA 4WN5A 3V67A 5F5YA 1S67L 3K2NA 4NXGA 4WEJA 4GS9A 4Z1WA 3C38A 2L4RA 3HJKA 3B42A 5AVFA 4NEED 4ARZA 1ODVA 3VOLA 1XFQA 4I39A 1D06A 2L1MA 2QJ7A 3F1NA 3NOPC 3E0YA 5AVEA 2WKPA 2Z6DA 3LFVA 1VB6A 4MDZA 2V0UA 3LI8A 1OTAA 4HOIA 3RTYA 5IU1A 2ZOIA 5J4EA 1ZTUA 1Y28A 3MFXA 4GW9A 3T4LA 1W63M 5HD5A 4EQ1A 4YNRA 2V0WA 4KQOA 2QWSA 2D02A 1H3QA 2JKTI 2K7SA 2FH5A 2W1TA 1JNUA 3ZYTA 3CUEA 1OT6A 4EESA 4OOMA 3D72A 1XJ6A 2EWVA 2PYRA 3OC2A 2KLIA 1YAXA 4WLAA 5TBMA 3E4OA 1VHMA 3UMDA 1S4RA 1UWNX 4I3AA 2O9CA 4L9EA 2V1AA 4HH3A 3W2ZA 5HPIA 3BY8A 4HJ4A 1T1AA 2VLGA 3G6OA 2HJEA 2R78A 3T4OA 2EWWA 3BY9A 3T50A 3T4JA 3FC7A 3EEAA 2MJ6A 4I5SA 5I5LA 2W3FA 3EOIA 4LLOB 5C5KA 2HV1A 1OPXA 3CUEC 3LR3A 3NOTC 2GX5A 4GS9B 3FPWA 1T1BA 2V9AA 2M1CA 5HDSA 3LYXA 3TRCA 2P04A 3H7WA 3UE6A 4HIAA 5HWVA 2P08A 2O0YA 2B02A 2O9AA 3F1NB 3H9WA 4BMWA 2VV7A 3SW1A 1NLZA 3E4PA 3BW6A 1UWPX 3GDIA 3C2WA 1EW0A 3MXQA 1TF1A 2JHEA 2XSSA 3EQVA 3LR5A 1IOUA 1TS7A 4IJGA 1YSPA 2W3DA 4CLCA 3PR6A 3LR0A 4B9OA 4YWZA 5EFWA 1OT9A 4HJ6A 4GCZA 1LL8A 5DJTA 4DN0A 2OAQ1 2W1TB 4L9FA 4XT2A 3TE8A 4JGOA 4GHIA 2Z6CA 2O99A 4I3JA 3F1OA 4FSFA 3PXPA 3FPVA 4ZRRA 1GSWA 2PDRA 4DJ3A 1P97A 3R7WB 1BYWA 4G3WA 3NOUC 3BQ8A 3H82A 2OAP1 2QJ5A 3PBSA 4NXBA 2NUPC 2VA0A 3VE4A 4EU0A 5HL6A 3LICA 4BJPA 4BBTA 1P9RA 3PBOA 4CLCC 1F98A 3BQAA 2W1RA 2W3EA 2XROA 2JN7A 2O9BA 4LRXC 5IS1A 4PAUA 4JGRA 1W63Q 4NKPA 1S66L 1N9NA 2VEAA 3OOVA 4HNBA 1S1ZA 4MN7A 5HDDA 3LIAA 4BBVA 3B47A 4F3LB 3F1PB 2PR6A 2JKTM 2XA7S 4H6JA 4R6LA 1T1CA 3KSHA 2VKSA 3T4KA 2VZWA 3S7QA 1XJ4A 1IFQA 3A0SA 5F6AA 3LUQA 2A24B 2IA2A 1P0ZA 1OTEA 2BASA 3S7NA 3FG8A 3C8CA 1STZA 4EEUA 3OCLA 4AFIA 4WEKA 2QHKA 3S7OA 4Y5FA 3OLOA 3OCNA 1GSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B33 A;  5DKL A;  4EW7 A;  4LPZ A;  4HH2 A;  3HJI A;  4K08 A;  3RH8 B;  4EER A;  2D01 A;  1DP9 A;  4BBU A;  2YKF A;  1DRM A;  3K3C A;  4LRY C;  3LIE A;  3PHY A;  4NXF A;  2I9V A;  4XT2 B;  3IS2 A;  3VE3 A;  1OJ5 A;  1TS8 A;  3F1O B;  3CWF A;  4PKY G;  4HHD A;  5HWW A;  4EEP A;  3UB6 A;  4EET B;  5HDC A;  3GEC A;  1XFN A;  1LT0 A;  1OTD A;  4HJ3 A;  2PR5 A;  3LI9 A;  2YKH A;  3LIB A;  2P7J A;  4HI4 A;  3MJQ A;  3K3D A;  5J3W A;  4R38 A;  1LSX A;  3UB8 A;  5KIZ A;  4H6J B;  2KDK A;  3BWL A;  1D7E A;  1LSV A;  1N9L A;  5HZH A;  3MQO A;  2INW A;  3EWK A;  2ZOH A;  5A8B A;  5TBM B;  1DP8 A;  1V9Z A;  3MR0 A;  2PD8 A;  3LID A;  2W27 A;  1G28 A;  1X0O A;  3A0V A;  2W0N A;  2WKR A;  5G4Z A;  3EEH A;  1LSW A;  2VV6 A;  2WKQ A;  4L9G A;  1WA9 A;  4EXO A;  2GJ3 A;  5G4Y A;  4JGQ A;  3KX0 X;  3IS2 B;  2QKP A;  1OTB A;  1F9I A;  3A0R A;  4R3A A;  4R70 A;  3H7W B;  4WL9 A;  2V1B A;  4RQ9 A;  4E04 A;  3MQQ A;  4KQD A;  1KOU A;  5HD3 A;  1DP6 A;  2OWJ A;  2CMN A;  1N9O A;  4HP4 A;  1NWZ A;  4M4X A;  4KUO A;  4DJ2 A;  1UGU A;  1OTI A;  4WF0 A;  3ULF A;  3CLO A;  4HP9 A;  3PYP A;  4PKY A;  1MZU A;  2VV8 A;  4HY8 A;  4GHI B;  3ICY A;  4NXE A;  3UME A;  3ZQ5 A;  3H82 B;  5F69 A;  2J80 A;  4F3L A;  3F1P A;  2H28 A;  1XJ2 A;  4MN5 A;  3UB9 A;  1TS6 A;  4MN6 A;  4HQA A;  2ZBB A;  2EA9 A;  3NJA A;  2A24 A;  2PHY A;  3E4Q A;  5J7E A;  3CAX A;  3IBR A;  5HWT A;  4LRZ E;  3NHQ A;  4I3I A;  1S4S A;  1TS0 A;  2PD7 A;  5F68 A;  3P7N A;  5DJU A;  5HSQ A;  1XJ3 A;  3UB7 A;  1T18 A;  4I38 A;  1S1Y A;  2OOL A;  1T19 A;  4JGP A;  1V9Y A;  2PYP A;  4WUJ A;  1OJG A;  2OWH A;  3LIF A;  4KUK A;  2L0W A;  5DKK A;  2KX6 A;  1GSX A;  4WN5 A;  5F5Y A;  1S67 L;  4NXG A;  4GS9 A;  2L4R A;  3HJK A;  5AVF A;  1ODV A;  3VOL A;  1XFQ A;  4I39 A;  1D06 A;  2L1M A;  2QJ7 A;  3F1N A;  3NOP C;  5AVE A;  2WKP A;  2Z6D A;  1VB6 A;  2V0U A;  3LI8 A;  1OTA A;  4HOI A;  3RTY A;  5IU1 A;  2ZOI A;  5J4E A;  1Y28 A;  3MFX A;  4GW9 A;  5HD5 A;  4EQ1 A;  2V0W A;  2QWS A;  2D02 A;  2K7S A;  1JNU A;  1OT6 A;  4EES A;  3D72 A;  1XJ6 A;  2PYR A;  4WLA A;  5TBM A;  3E4O A;  3UMD A;  1S4R A;  1UWN X;  4I3A A;  4L9E A;  2V1A A;  4HH3 A;  3BY8 A;  4HJ4 A;  1T1A A;  2VLG A;  3G6O A;  2R78 A;  3BY9 A;  3T50 A;  3FC7 A;  4I5S A;  5I5L A;  4LLO B;  2HV1 A;  3NOT C;  4GS9 B;  1T1B A;  5HDS A;  2V9A A;  2M1C A;  3LYX A;  3H7W A;  3UE6 A;  4HIA A;  5HWV A;  2B02 A;  3F1N B;  3H9W A;  2VV7 A;  3SW1 A;  3E4P A;  1UWP X;  3GDI A;  3C2W A;  1EW0 A;  3MXQ A;  2JHE A;  1TS7 A;  4B9O A;  4YWZ A;  5EFW A;  1OT9 A;  4HJ6 A;  4GCZ A;  1LL8 A;  5DJT A;  4L9F A;  4XT2 A;  4JGO A;  4GHI A;  2Z6C A;  4I3J A;  3F1O A;  1GSW A;  2PDR A;  4DJ3 A;  1P97 A;  1BYW A;  3NOU C;  3H82 A;  2QJ5 A;  4NXB A;  3VE4 A;  3LIC A;  4BBT A;  1F98 A;  2JN7 A;  5IS1 A;  4LRX C;  4JGR A;  1S66 L;  1N9N A;  2VEA A;  4HNB A;  1S1Z A;  5HDD A;  3LIA A;  4BBV A;  4F3L B;  3F1P B;  2PR6 A;  4H6J A;  4R6L A;  1T1C A;  1XJ4 A;  3A0S A;  5F6A A;  3LUQ A;  2A24 B;  1P0Z A;  1OTE A;  2BAS A;  3FG8 A;  3C8C A;  4EEU A;  2QHK A;  3OLO A;  1GSV A; 
#chains in the Genus database with same CATH topology
 1GCE A;  4DKI A;  2A2L A;  1D1J A;  4Q0I A;  1EI5 A;  3MF0 A;  4KZ7 A;  4K08 A;  2G7U A;  3PBN A;  1XXM A;  1LL9 A;  1DP9 A;  2WKI A;  1KE0 A;  2Y8H A;  3K3C A;  3LY4 A;  4LRY C;  4N1X A;  2Y2H A;  1A0K A;  1NJ4 A;  3MFD A;  3E98 A;  1OJ5 A;  1NZU A;  3DAV A;  2XD1 A;  3CWF A;  1K4F A;  4QPR A;  5F1F A;  1FOF A;  5DVA A;  1KVM A;  3TW8 A;  4KZ6 A;  3O88 A;  1QME A;  1PI5 A;  4R4R A;  1PWD A;  3GEC A;  4HES A;  3ZG0 A;  1XFN A;  1LHY A;  4QB8 A;  1YLJ A;  3MKE A;  1VET B;  2YKH A;  1YLT A;  2FFF B;  5LBR A;  3VP2 A;  5DFY A;  1NYY A;  3MQ0 A;  5J3W A;  1KDS A;  2H0Y A;  2EFX A;  4KZ5 A;  4E6W A;  2CC1 A;  1H8Z A;  1CI9 A;  3BWL A;  3O5Y A;  3EGD C;  3IQA A;  3A3E A;  3WWX A;  5AQA A;  2INW A;  3U4L P;  5GLD A;  1NRF A;  3FYZ A;  2XH9 A;  3ZG5 A;  5TBM B;  1DP8 A;  5HFO A;  3OPR A;  1K0K A;  2PD8 A;  4MEZ A;  4B4X A;  1G28 A;  3A0V A;  3BJN A;  4WEL A;  4DDS A;  3KSI A;  4S2J A;  1LSW A;  2VV6 A;  2WKQ A;  2GZA A;  3BLS A;  3MZE A;  1WA9 A;  4IHQ A;  3R4K A;  3UPO A;  4EXO A;  2Y55 A;  3GV9 A;  1DJC A;  1Y54 A;  4ZAM A;  1IYQ A;  2FFY A;  2QKP A;  3DTM A;  1YSQ A;  4R70 A;  3VP1 A;  1KE4 A;  3HUO A;  4MCW A;  1PYY A;  3UO9 A;  3MQQ A;  1TVF A;  1E3U A;  1KGF A;  1KOU A;  3HLG A;  3PBQ A;  1MWS A;  4S2P A;  1BZA A;  1KGG A;  4UAA A;  1NWZ A;  4C3Q A;  4X56 A;  3FKW A;  1NYM A;  3LGO A;  3O87 A;  1MBL A;  1UGU A;  1K4E A;  4KZ8 A;  1OTI A;  3ULF A;  3CLO A;  3IWO A;  2RCX A;  1ESI A;  1XGJ A;  1BUL A;  5HAQ A;  3IF6 B;  1PNE A;  4NXE A;  2VX8 A;  3W4Q A;  4KZB A;  5CGX A;  4C6Y A;  4KG5 A;  2XK1 A;  4GD6 A;  2J80 A;  4F3L A;  3GRJ A;  1XJ2 A;  4MN5 A;  1TS6 A;  4HQA A;  2EA9 A;  3NJA A;  4MMN A;  4WZ5 C;  2PHY A;  1RCJ A;  3CAX A;  2C6W B;  5HWT A;  2EFU A;  5EOE A;  5M19 A;  4I3I A;  1YLZ A;  4OH0 A;  2JKR M;  2PD7 A;  5F68 A;  4P0M A;  5DJU A;  4CLC D;  5F82 A;  5HSQ A;  3S4X A;  4L0L A;  3BM6 A;  1LI9 A;  4KZA A;  1S1Y A;  1T19 A;  3Q07 A;  2ZC6 B;  4JGP A;  3SH9 A;  2AVX A;  2XA7 M;  1OJG A;  3VFH A;  3SH7 A;  5FQI A;  3BFE A;  2H5S A;  1NLY A;  2KX6 A;  2Z2L B;  3ZGA B;  1FR6 A;  4EQI A;  4G3V A;  3C4P A;  1S67 L;  4E6X A;  1FSY A;  3K2N A;  3PTE A;  4WEJ A;  1XP4 A;  4Z1W A;  1GA0 A;  3C38 A;  4DXC A;  4NEE D;  1M40 A;  1ODV A;  5GHY A;  3DTI A;  4I39 A;  2BG1 A;  1BLC A;  3UNW A;  4PM6 A;  2WKP A;  2Z6D A;  3LFV A;  3WS1 A;  4EBL A;  3A3F A;  3LI8 A;  4ZBE A;  1VET A;  4LGW A;  1ZTU A;  4JXG A;  3T4L A;  2R9W A;  4QU3 A;  1PZO A;  4KQO A;  1IEL A;  5TGF A;  2Y2M A;  4OPZ A;  3BEC A;  4PPR A;  4P6B A;  1FCO A;  4NET A;  5FEF A;  4YFM A;  2EX6 A;  4A5R A;  1H0M A;  1W7F A;  1YAX A;  2EXB A;  1DY6 A;  5TBM A;  3E4O A;  2WK0 A;  1S4R A;  1K55 C;  4FCF A;  4L9E A;  1G6A A;  5HPI A;  3PAE A;  3G6O A;  2R78 A;  3T4O A;  3UDF A;  3BY9 A;  3T50 A;  5CER A;  2ZLY A;  3Q81 A;  3S1Y A;  3FV7 A;  5C5K A;  1L2S A;  2JCH A;  1BLH A;  3QHY A;  4JF4 A;  3BEB A;  3DW0 A;  4BL2 A;  3LR3 A;  3NOT C;  4GOG A;  4JLF A;  1T1B A;  2WZZ A;  2V9A A;  4HEF A;  1F2K A;  2ZL1 B;  3ZHH A;  3NI9 A;  1MWT A;  2O0Y A;  2B02 A;  1VEU B;  3F1N B;  3H9W A;  1JWP A;  1TDG A;  3BFG A;  2VV7 A;  3SW1 A;  4JKT A;  3E4P A;  2PRF A;  5HAI A;  4M3K A;  3C2W A;  1TF1 A;  2JHE A;  5HW3 A;  2W3D A;  4B9O A;  3VP0 A;  1FIK A;  1OT9 A;  3CG5 A;  1LL8 A;  4DN0 A;  4BLM A;  4ZJ1 A;  5EVI C;  2Y2L A;  1QMF A;  2R9X A;  3HL9 A;  3F1O A;  4FSF A;  4N9L A;  4KZ9 A;  4DJ3 A;  1P97 A;  3GR2 A;  4EBN A;  2V8F A;  3WRT A;  2VA0 A;  1Q2Q A;  2V20 A;  4EU0 A;  3QP4 A;  1U60 A;  4ZDX A;  2P9V A;  4ZTK A;  1P9R A;  3PBO A;  4CLC C;  1ERQ A;  3IF5 A;  1F98 A;  3BQA A;  2W1R A;  2W3E A;  2XRO A;  4XUX A;  2O9B A;  4PAU A;  2OSU A;  4NKP A;  1S66 L;  1N9N A;  4HNB A;  1XA1 A;  4EBP A;  1HD8 A;  5EUA A;  4H6J A;  3T1Q B;  1E3U D;  4FH4 A;  5F6A A;  2A24 B;  2BAS A;  1OME A;  4X1M A;  1ACF A;  3C8C A;  1STZ A;  2J7V A;  3OCL A;  1ZC2 A;  3QP8 A;  3MSH A;  3S7O A;  4Y5F A;  2ZM0 A;  2ZQD A;  2Y2J A;  2M7V A;  3OCN A;  2OLV A;  1TD5 A;  3LCE A;  4HH2 A;  4DE0 A;  3NC8 A;  3P01 A;  2ZJ9 A;  3C30 A;  2B18 A;  2YKF A;  5TJJ A;  1I2W A;  1K57 A;  4BWI A;  1G5U A;  3VMA A;  1MC0 A;  3IS2 A;  5AQB A;  5EVL A;  3Q7V A;  3O86 A;  3VSL A;  5HWW A;  4KG2 A;  3CI6 A;  2ZC7 A;  4EEP A;  2HGV A;  4Z9Q A;  5HDC A;  3TJZ C;  3KO6 A;  3BFC A;  5FAO A;  1G68 A;  3M6B A;  3VSK A;  2XD5 A;  2HJ9 C;  4KEN B;  1ES2 A;  3WS5 A;  3LIB A;  3FWL A;  2P7J A;  5KSH A;  4IUK A;  3MJQ A;  4CQH A;  1Z6F A;  4R38 A;  1LSX A;  1XX2 A;  3UB8 A;  4K0W A;  5F1G A;  5HZH A;  3MQO A;  1LI0 A;  2ZOH A;  3N4I A;  3ZG7 B;  2Y2N A;  3D3O A;  5A8B A;  4GLQ A;  1YPR A;  2PBY A;  3WRZ A;  3GQZ A;  1V9Z A;  3MS6 A;  4GNU A;  4U0T A;  1GA9 A;  2ZC4 B;  1SHV A;  5G4Z A;  1FIL A;  3PBR A;  5FEG A;  4GKU A;  4P85 A;  2JE5 A;  1VEU A;  1XA7 A;  1BTL A;  2DMW A;  1O7E A;  5G4Y A;  5EPH A;  4G3K A;  3WS0 A;  1JTD A;  5GHX A;  4E3O A;  1OTB A;  1F9I A;  4D2O A;  5FI2 A;  2VGL S;  3QNB A;  4P6Z S;  2W3H A;  4PHT A;  3KYQ A;  1J9M A;  4KQD A;  5L09 A;  5DF7 A;  5FL3 A;  2VGK A;  3DWZ A;  3G32 A;  1BUE A;  4HP4 A;  5CHM A;  4H8R A;  3DTK A;  4X53 A;  1K56 A;  4E3K A;  4IVK A;  3G35 A;  3B3X A;  3D9Y A;  4PKY A;  1MZU A;  2J3W A;  2KOI A;  5FI7 A;  2B5R A;  4E3L A;  5L10 A;  2WZX A;  3UME A;  4WMC A;  3O3V A;  1EWZ A;  1MPL A;  4HBT A;  5MC7 A;  4GD8 A;  2Y2P A;  4GJ4 A;  1SDN A;  4RX2 A;  4OOL A;  3HLB A;  3CZD A;  4HBU A;  2QYB A;  4QD4 A;  3ZNY A;  5L8M A;  2ZBB A;  3E2K A;  2NUT C;  3KYZ A;  2A24 A;  2XGN A;  2XLN A;  3C5A A;  4N92 A;  3NHQ A;  4PMA A;  1ERO A;  3TSG A;  3HUN A;  1ES4 A;  2WAD A;  2C5W B;  5FQM A;  1PI4 A;  1RGZ A;  3UB7 A;  4FH2 A;  4LFU A;  1T18 A;  5FQK A;  4RA7 A;  3NBL A;  4GDB A;  1IKG A;  1WYB A;  2OWH A;  1K54 C;  3IX3 A;  2RL3 A;  4JXV A;  2L0W A;  5DKK A;  4Y3I A;  5FDH A;  2E8J A;  1GSX A;  5CEB A;  4GS9 A;  1Z09 A;  4OQH A;  3B42 A;  4Q8I A;  5AVF A;  3KYE A;  3Q7Z A;  3QNC A;  2XDM A;  3IXD A;  2ZD8 A;  2V0U A;  2XEP A;  4OPQ A;  5GLC A;  5IU1 A;  5J4E A;  1Y28 A;  4GW9 A;  1W63 M;  5HD5 A;  1VM1 A;  4S2N A;  3SS4 A;  4YNR A;  1S6R A;  1H3Q A;  2D02 A;  3VOY A;  3NDG A;  4FUW A;  3MXS A;  1JNU A;  3G34 A;  3IXG A;  3ZYT A;  5JYO A;  3CUE A;  4OOM A;  1IYP A;  3OC2 A;  2KLI A;  5DTS A;  1L0F A;  1UWN X;  2O9C A;  1I5Q A;  3BY8 A;  2VK3 A;  1HVB A;  3BYD A;  2EWW A;  1PFL A;  1E4D A;  3VP4 A;  4I5S A;  1SKO B;  5I5L A;  4NG2 A;  3N8S A;  4E3J A;  2HV1 A;  1MY8 A;  4Y0U A;  4Y17 A;  4K91 A;  1PRQ A;  3BRM A;  1GHM A;  2M1C A;  5HDS A;  3TRC A;  2P04 A;  2B95 A;  3LO7 A;  2P08 A;  4BMW A;  3MKF A;  5EE8 A;  5F83 A;  4LEN A;  3BW6 A;  4X69 A;  3HLC A;  4OOY A;  4IBR A;  3VP3 A;  2H10 A;  1WE4 A;  3EQV A;  3LR5 A;  2PU2 A;  1BLS A;  1YSP A;  1XKZ A;  3PR6 A;  1C3B A;  3LR0 A;  4S2I A;  4YWZ A;  4XUZ A;  3HLD A;  2HP5 A;  4PM9 A;  4GCZ A;  1KDW A;  4WBG A;  4UA7 A;  4OQI A;  2W1T B;  1HZO A;  2O99 A;  4E3N A;  3GMW A;  1GSW A;  2PDR A;  3A3D A;  3R7W B;  1SKF A;  2OAP 1;  2QJ5 A;  2NUP C;  3GVB A;  1ALQ A;  1IEM A;  3LIC A;  1SCW A;  2EX2 A;  2WKH A;  1ES3 A;  5CGS A;  2DCF A;  5CEC A;  4RX3 A;  2J8Y A;  1YMX A;  4S2K A;  4MN7 A;  3OOV A;  1S1Z A;  3FZC A;  4R23 A;  3NIA A;  4DDY A;  1ZKJ A;  2PR6 A;  2IWB A;  2JKT M;  1K25 A;  1T1C A;  4EV4 A;  5E2F A;  3RXW A;  3S7N A;  3SOI A;  3FG8 A;  4BD1 A;  5EVI B;  2WAE A;  4DE1 A;  3UPN A;  1L0E A;  3LEQ A;  2EX8 A;  2J9P A;  1K56 D;  4WEK A;  2ACG A;  1VQQ A;  2X71 A;  4X1L A;  3Q1F A;  4EW7 A;  3SS5 A;  3HJI A;  3WS4 A;  3RH8 B;  2K2N A;  2D01 A;  2IWC A;  4CLC B;  3M2K A;  5J8X A;  4GDN A;  4BBU A;  4WMC D;  3AGE A;  1DRM A;  2ZMA A;  4PM5 A;  3LIE A;  3PHY A;  4LV3 A;  5CTN A;  3NEC A;  4XT2 B;  1ESU A;  2J3T D;  4CLC E;  4BEN A;  5FA7 A;  2Z2M B;  3VE3 A;  3CJM A;  1TS8 A;  3BFD A;  2PAV P;  4R4S A;  1PW8 A;  4X25 A;  1H8Y A;  4ARZ B;  2ZQA A;  5I94 A;  4HHD A;  4ID4 A;  4LV0 A;  2HP6 A;  3ZG8 B;  4C75 A;  5IT5 A;  2WYX A;  4U3T A;  1LT0 A;  1OTD A;  1JVJ A;  3DWK A;  2ZMF A;  3N7W A;  5M18 A;  2XFS A;  1K57 C;  3TG9 A;  4LV1 A;  4HI4 A;  1JWZ A;  5CX7 A;  3K3D A;  4ZJ3 A;  2GDN A;  4UHU A;  5KIZ A;  5DTT A;  3HUM A;  2LB5 A;  4PM7 A;  3T4T A;  1ONG A;  1N9L A;  3IF6 A;  3MMH A;  2EX9 A;  1WYC A;  4FOF A;  1YMS A;  2WUQ A;  5GHZ A;  2HDU A;  1SKO A;  2Q0O A;  1KGE A;  3E2L A;  3VV4 A;  4OPR A;  3MZD A;  2W27 A;  2HP9 A;  2X02 A;  4IBX A;  4S2L A;  5AQ7 A;  2W0N A;  2WKR A;  4DRT A;  2G2W A;  3HVF A;  2VJW A;  2W3G A;  4E3I A;  3QP6 A;  2Y2I A;  1ZHH B;  1ES5 A;  1YKD A;  3UDI A;  5A93 A;  1YLW A;  2WGW B;  3KX0 X;  5EM0 A;  1K55 A;  4IUH A;  4R3A A;  4Y2F A;  2V8C A;  2JBF A;  4R3J A;  3BLM A;  5EVE A;  1PWG A;  1NRJ A;  4WL9 A;  3IBJ A;  3JVU A;  5CHU A;  3M6H A;  2M7U A;  1P9W A;  2LB9 A;  4RQ9 A;  3T4Q A;  4E04 A;  3LR4 A;  2ZMV A;  4NK3 A;  1DP6 A;  2OWJ A;  1DJA A;  2QZ6 A;  4R1G A;  2CMN A;  4FTX A;  4WZ4 A;  3G30 A;  2EXA A;  3GTC A;  3MZF A;  3DBA A;  3R7W A;  4HP9 A;  1Y4O A;  3PYP A;  4O8G A;  2VV8 A;  1GHP A;  4HY8 A;  4B93 A;  4R0Q A;  3ICY A;  3QP2 A;  3IWQ A;  4EUV A;  2Y4A A;  3H82 B;  5F69 A;  3JPU A;  4O01 A;  4OLG A;  5DF9 A;  2XR0 A;  4WYY A;  2HPB A;  2H28 A;  2QMI A;  2ZQ7 A;  3UB9 A;  4MN6 A;  4DMZ A;  3V3R A;  1I2S A;  3E4Q A;  1M6K A;  3IBR A;  4X55 A;  5EVI A;  3NUL A;  4LRZ E;  2PU4 A;  1TS0 A;  2Y79 A;  4P87 A;  3OPP A;  4Q0H A;  1MKM A;  2JKR I;  5FAP A;  2XRN A;  2PT7 A;  5CGW A;  4ETX A;  2OOL A;  1CEF A;  1RGY A;  3MBZ A;  5FAQ A;  3SS3 A;  4YOF A;  1H8M A;  1E25 A;  5GLA A;  5FDS A;  1V9Y A;  4Y15 A;  2PYP A;  2J3T C;  3LIF A;  4KZ4 A;  4ME4 A;  2K31 A;  3UE1 A;  1L0D A;  4K0X A;  4UQI S;  3V67 A;  3UN7 A;  5EOO A;  4OP8 A;  2BLS A;  3ITB A;  1PWC A;  3HJK A;  1XGI A;  5E2G A;  2BTF P;  4ARZ A;  4Y7P A;  4UA9 A;  3L9K A;  2ZL1 A;  4N9K A;  1XFQ A;  4CJN A;  5JYP A;  2L1M A;  3F1N A;  3IHB A;  3P98 A;  1FCN A;  3T1R A;  3VOZ A;  4MDZ A;  2X01 A;  4GZB A;  1ONH A;  4HOI A;  3RTY A;  3IXH A;  3N8R A;  3MFX A;  5D3O A;  2V0W A;  1NXY A;  4Y13 A;  2Q9N A;  2DNS A;  2JKT I;  2K7S A;  2FH5 A;  4B88 A;  4OQ0 A;  3SH8 A;  1L3L A;  3M2J A;  4X6T A;  3V39 A;  1XJ6 A;  2PYR A;  5E2E A;  3QP5 A;  2Y91 A;  4WLA A;  4YIN A;  5L2F A;  4LCL A;  1VHM A;  3UMD A;  3P09 A;  1ZG4 A;  3OZH A;  4HH3 A;  1N4O A;  3IH9 A;  4HJ4 A;  4S2M A;  2HJE A;  4JXS A;  3C7V A;  3NCK A;  1ZG6 A;  3HBR A;  4MBF A;  4S2N C;  2HZ5 A;  1H5X A;  3FC7 A;  3W4O A;  3EEA A;  2MJ6 A;  3EOI A;  4LLO B;  4DE3 A;  1OPX A;  3CUE C;  4S2O A;  2WGW A;  1FQG A;  2GX5 A;  2H0T A;  3FPW A;  2ZM2 A;  4XXR A;  1BT5 A;  1W8Q A;  4BL3 A;  4HIA A;  5HWV A;  3S22 A;  4OVD A;  3LY3 A;  4ZJ2 A;  4O7D A;  1NLZ A;  3N8L A;  5FI6 A;  2A49 A;  3GDI A;  1IKI A;  1TS7 A;  4IJG A;  5GLB A;  4RVA A;  3CMZ A;  1NY0 A;  4HJ6 A;  4IED A;  1YM1 A;  5FQJ A;  5DJT A;  1LLB A;  3CPT B;  2OAQ 1;  3V50 A;  3NY4 A;  4L9F A;  3IH8 A;  3PXP A;  1YLP A;  4ZRR A;  2OV5 A;  3D4F A;  4QY6 A;  3IX4 A;  1BYW A;  4G3W A;  3NOU C;  3BQ8 A;  3H82 A;  3ZFZ A;  3PBS A;  2Y2O A;  4BJP A;  5AQ9 A;  4DXB A;  2JN7 A;  5IS1 A;  4LRX C;  3ZVT A;  1NZO A;  4JGR A;  1W63 Q;  5E2H A;  2VEA A;  3LIA A;  1MWU A;  3RXX A;  5HAR A;  3F1P B;  1FSW A;  4R6L A;  3KSH A;  2VZW A;  3C4O A;  3S7Q A;  1IFQ A;  3A0S A;  2ZM8 A;  2JKG A;  3L7H A;  1OTE A;  3AGF A;  4KQR A;  1CK3 A;  3FKV A;  3IWI A;  3TOI A;  2ZC5 B;  5DF8 A;  1GSV A;  3B33 A;  5DKL A;  3ISG A;  4II7 A;  4FD8 A;  4LPZ A;  3UE0 A;  2HDQ A;  4EER A;  4O0P A;  2P74 A;  3QP1 A;  2PBD P;  2Y2K A;  2JC7 A;  1YLY A;  1K6S A;  5DFX A;  2ZQC A;  4NXF A;  1AWI A;  1DJB A;  2I9V A;  2GNX A;  4WM9 A;  4KZ3 A;  3RFB A;  3F1O B;  3Q82 A;  4PKY G;  5A92 A;  4PM8 A;  2XQZ A;  1FCM A;  5FQQ A;  2ZQ8 A;  3T4S A;  4UQI M;  3UB6 A;  4EET B;  5EVI D;  4JF6 A;  3KSG A;  1MWR A;  1K54 A;  3UE3 A;  3ZDJ A;  1K6R A;  3S7P A;  2P9V B;  1CI8 A;  4HJ3 A;  3HLW A;  3U2A A;  3OBF A;  3IT9 A;  2PR5 A;  3LI9 A;  5K5B A;  4Q0J A;  1SZV A;  3ZNT A;  1KVL A;  3IHA A;  5CED A;  4H6J B;  2VGL M;  3EGX C;  2KDK A;  1D7E A;  1LSV A;  1PZP A;  4P6Z M;  1ERM A;  5A91 A;  3W8K A;  2OLU A;  3EWK A;  3CIT A;  3OPH A;  5IHV A;  2JKF A;  3HRE A;  1F5M A;  1AXB A;  1O07 A;  4Y0O A;  3MR0 A;  1Q2P A;  3JYI A;  3LID A;  1JWV A;  3DTE A;  1MKI A;  3KSF A;  1X0O A;  3PBT A;  3LEZ A;  2IWD A;  1KE3 A;  5HX9 A;  2G2U A;  5HAP A;  3EEH A;  2ZQ9 A;  3UY6 A;  4L9G A;  4B4Z A;  4ESP A;  4LV2 A;  3A3I A;  4KQQ A;  3IF6 C;  2HF6 A;  2GJ3 A;  4JGQ A;  3IS2 B;  3G4P A;  1GHI A;  3AGD A;  2A3U A;  3A0R A;  3Q7V B;  4UEY A;  1CF0 A;  5AJG A;  3H7W B;  2V1B A;  2XFT A;  5EEC A;  3N6I A;  4ETZ A;  5HD3 A;  1W79 A;  4JBF A;  4EUZ A;  3CPT A;  4MLL A;  1N9O A;  3ZG9 B;  5KSC A;  4M4X A;  4KUO A;  5GL9 A;  3I7J A;  4CPK A;  4DJ2 A;  3UDX A;  4DE2 A;  4WZ5 A;  4RYE A;  4WF0 A;  3RJU A;  3PAG A;  4UA6 A;  2V2F F;  2Y2Q A;  3ZVW A;  5CHJ A;  1G6O A;  1YQS A;  4D60 A;  4GHI B;  1W8Y A;  1PW1 A;  3EQU A;  3ZCZ A;  3ZQ5 A;  1FR1 A;  1CEG A;  3F1P A;  5HPF A;  4BD0 A;  3HLF A;  4OP5 A;  4JF5 A;  2FZ0 A;  5J7E A;  5KMW A;  5CRF A;  3VFF A;  1S4S A;  4DF6 A;  3G31 A;  3P7N A;  5KZH A;  2WGI A;  1XJ3 A;  3HCY A;  4I38 A;  3JVV A;  5BOH A;  1W5D A;  4X68 A;  1JTG A;  4WUJ A;  4KUK A;  3OPL A;  5L07 A;  1L0G A;  2QPN A;  5M1A A;  3V5M A;  1IYO A;  1YT4 A;  4WN5 A;  5F5Y A;  4NXG A;  3HLE A;  2L4R A;  5EM1 A;  2HDR A;  4JPM A;  3VOL A;  3T1S A;  5CXW A;  2HDS A;  1D06 A;  2QJ7 A;  3NOP C;  5CTM A;  3E0Y A;  5AVE A;  5FAS A;  5EV0 A;  1VB6 A;  1SDE A;  4U0X A;  4OQG A;  4EWF A;  1OTA A;  1S0W A;  2ZOI A;  2DRW A;  4EQ1 A;  2Q9M A;  4QY5 A;  2QWS A;  1TEM A;  1XPB A;  4OON A;  1LL5 A;  1PIO A;  2W1T A;  4MNR A;  1OT6 A;  4EES A;  3SZT A;  3D72 A;  2EWV A;  1MXO A;  4OKP A;  4QJG A;  4MBH A;  2XF3 A;  4I3A A;  2UV0 E;  1HTZ A;  2V1A A;  3W2Z A;  3UPP A;  1T1A A;  2VLG A;  5TFQ A;  4MBK A;  3G2Y A;  3T4J A;  5G18 A;  4Y0T A;  2VGJ A;  2W3F A;  2E8I A;  5HL1 A;  4E3M A;  5FAT A;  4GS9 B;  3LYX A;  3NDE A;  2Y2G A;  4OPY A;  3H7W A;  3UE6 A;  1CJF A;  2O9A A;  4LCM A;  4JXW A;  3WS2 A;  1HLU P;  1RP5 A;  5DTK A;  1UWP X;  1CQA A;  1EW0 A;  3MXQ A;  2XSS A;  4GB7 A;  4QWO A;  1IOU A;  1K38 A;  4CLC A;  2ZC3 B;  5EFW A;  1J3W A;  3IX8 A;  4N1H A;  3MXR A;  2Y59 A;  3V3S A;  4R3B A;  4XT2 A;  3TE8 A;  4IVI A;  4JGO A;  4GHI A;  2Z6C A;  3W4P A;  4I3J A;  1BSG A;  1IYS A;  5A90 A;  3FPV A;  4KG6 A;  2WKE A;  2I72 A;  5E43 A;  3IXB A;  3CHW P;  4NXB A;  2J9O A;  2WGV A;  3VE4 A;  3T1X A;  3C7U A;  5HL6 A;  4BBT A;  4BQM A;  5U47 A;  2V1Z A;  2WAF A;  4GN2 A;  4F94 A;  3ITA A;  5HDD A;  4OLD A;  3T12 B;  4BBV A;  1BLP A;  3B47 A;  4F3L B;  2XA7 S;  3A3J A;  3T4K A;  2VKS A;  2UWX A;  1XJ4 A;  3UB5 P;  5FSR A;  3GSG A;  3G2Z A;  3LUQ A;  2IA2 A;  1P0Z A;  1TDL A;  4QHC A;  5FQ9 A;  4EEU A;  4AFI A;  2QHK A;  3BFF A;  5TR7 A;  3OLO A;  1N9B A; 
#chains in the Genus database with same CATH homology
 3B33 A;  5DKL A;  1TD5 A;  2A2L A;  4II7 A;  4Q0I A;  4EW7 A;  4LPZ A;  4HH2 A;  3MF0 A;  3HJI A;  4K08 A;  2G7U A;  3RH8 B;  3P01 A;  2K2N A;  3PBN A;  4EER A;  2D01 A;  3C30 A;  2B18 A;  4O0P A;  4CLC B;  1DP9 A;  4BBU A;  2YKF A;  1DRM A;  5TJJ A;  2Y8H A;  5DFX A;  3K3C A;  4BWI A;  4LRY C;  3LIE A;  3PHY A;  4NXF A;  1MC0 A;  2I9V A;  4XT2 B;  2GNX A;  3IS2 A;  2J3T D;  4CLC E;  3E98 A;  3RFB A;  3VE3 A;  1OJ5 A;  1TS8 A;  3F1O B;  3CWF A;  4PKY G;  4QPR A;  4ARZ B;  4HHD A;  5HWW A;  3CI6 A;  3T4S A;  4EEP A;  4UQI M;  3TW8 A;  3UB6 A;  2HGV A;  5HDC A;  4EET B;  3TJZ C;  3KO6 A;  3KSG A;  3UE3 A;  5IT5 A;  3GEC A;  3S7P A;  1XFN A;  1LT0 A;  1OTD A;  2HJ9 C;  2ZMF A;  4HJ3 A;  3U2A A;  3OBF A;  2PR5 A;  3LI9 A;  2YKH A;  5K5B A;  3LIB A;  4Q0J A;  2P7J A;  5LBR A;  5KSH A;  5DFY A;  4HI4 A;  4IUK A;  3MQ0 A;  3MJQ A;  5CX7 A;  3K3D A;  5J3W A;  4CQH A;  4R38 A;  1LSX A;  3UB8 A;  5KIZ A;  4H6J B;  2VGL M;  3EGX C;  2KDK A;  3BWL A;  1D7E A;  2LB5 A;  1LSV A;  3T4T A;  3O5Y A;  3EGD C;  1N9L A;  4P6Z M;  5HZH A;  3MQO A;  2INW A;  3EWK A;  3CIT A;  3MMH A;  2ZOH A;  4FOF A;  1F5M A;  3D3O A;  5A8B A;  4GLQ A;  5TBM B;  1DP8 A;  1V9Z A;  3MR0 A;  2PD8 A;  3LID A;  3VV4 A;  3KSF A;  2W27 A;  1G28 A;  1X0O A;  3A0V A;  3BJN A;  3PBT A;  2W0N A;  2WKR A;  5G4Z A;  3EEH A;  4WEL A;  3KSI A;  2VJW A;  1LSW A;  2VV6 A;  3PBR A;  2WKQ A;  2W3G A;  2GZA A;  4L9G A;  1WA9 A;  4IHQ A;  3R4K A;  4EXO A;  1ZHH B;  2HF6 A;  1YKD A;  2DMW A;  2GJ3 A;  5G4Y A;  4JGQ A;  3KX0 X;  4G3K A;  3IS2 B;  2QKP A;  4IUH A;  1OTB A;  1F9I A;  3A0R A;  4R3A A;  4Y2F A;  4UEY A;  1YSQ A;  4R70 A;  2VGL S;  5AJG A;  1NRJ A;  3H7W B;  4WL9 A;  4P6Z S;  2V1B A;  3IBJ A;  2W3H A;  4MCW A;  3JVU A;  4PHT A;  2M7U A;  1P9W A;  2LB9 A;  4RQ9 A;  3T4Q A;  3KYQ A;  3MQQ A;  4E04 A;  3LR4 A;  2ZMV A;  4KQD A;  1KOU A;  4ETZ A;  3PBQ A;  1DP6 A;  2OWJ A;  5HD3 A;  2CMN A;  5FL3 A;  1N9O A;  4HP4 A;  1NWZ A;  4M4X A;  4KUO A;  4DJ2 A;  1UGU A;  3DBA A;  3R7W A;  1OTI A;  4WF0 A;  3ULF A;  3CLO A;  4HP9 A;  3PYP A;  4PKY A;  1MZU A;  2J3W A;  4O8G A;  2VV8 A;  2KOI A;  1G6O A;  4HY8 A;  4GHI B;  4B93 A;  3ICY A;  4NXE A;  2VX8 A;  3EQU A;  3UME A;  4EUV A;  3ZQ5 A;  5MC7 A;  3H82 B;  5F69 A;  4O01 A;  4GJ4 A;  2J80 A;  4OOL A;  5DF9 A;  4F3L A;  3F1P A;  2QYB A;  5HPF A;  2H28 A;  1XJ2 A;  5L8M A;  4MN5 A;  3UB9 A;  1TS6 A;  4HQA A;  2ZBB A;  4MN6 A;  2EA9 A;  2NUT C;  3KYZ A;  3NJA A;  4MMN A;  4DMZ A;  2A24 A;  2PHY A;  2FZ0 A;  3E4Q A;  5J7E A;  3CAX A;  3IBR A;  5HWT A;  4LRZ E;  3NHQ A;  4I3I A;  1S4S A;  1TS0 A;  2JKR M;  2PD7 A;  2Y79 A;  5F68 A;  3P7N A;  5DJU A;  4CLC D;  5HSQ A;  4Q0H A;  1MKM A;  1XJ3 A;  2JKR I;  4L0L A;  3HCY A;  3UB7 A;  2XRN A;  1T18 A;  2PT7 A;  4I38 A;  1S1Y A;  4ETX A;  2OOL A;  1T19 A;  4YOF A;  1H8M A;  3JVV A;  4JGP A;  1V9Y A;  2XA7 M;  2J3T C;  2PYP A;  1OJG A;  2OWH A;  3LIF A;  4WUJ A;  4KUK A;  4ME4 A;  2K31 A;  2L0W A;  2M7V A;  1NLY A;  5DKK A;  2KX6 A;  4Y3I A;  4G3V A;  4UQI S;  1GSX A;  4WN5 A;  3V67 A;  5F5Y A;  1S67 L;  3K2N A;  4NXG A;  4WEJ A;  4GS9 A;  4Z1W A;  3C38 A;  2L4R A;  3HJK A;  3B42 A;  5AVF A;  4NEE D;  4ARZ A;  1ODV A;  3VOL A;  1XFQ A;  4I39 A;  1D06 A;  2L1M A;  2QJ7 A;  3F1N A;  3NOP C;  3E0Y A;  5AVE A;  2WKP A;  2Z6D A;  3LFV A;  1VB6 A;  4MDZ A;  2V0U A;  3LI8 A;  1OTA A;  4HOI A;  3RTY A;  5IU1 A;  2ZOI A;  5J4E A;  1ZTU A;  1Y28 A;  3MFX A;  4GW9 A;  3T4L A;  1W63 M;  5HD5 A;  4EQ1 A;  4YNR A;  2V0W A;  4KQO A;  2QWS A;  2D02 A;  1H3Q A;  2JKT I;  2K7S A;  2FH5 A;  2W1T A;  1JNU A;  3ZYT A;  3CUE A;  1OT6 A;  4EES A;  4OOM A;  3D72 A;  1XJ6 A;  2EWV A;  2PYR A;  3OC2 A;  2KLI A;  1YAX A;  4WLA A;  5TBM A;  3E4O A;  1VHM A;  3UMD A;  1S4R A;  1UWN X;  4I3A A;  2O9C A;  4L9E A;  2V1A A;  4HH3 A;  3W2Z A;  5HPI A;  3BY8 A;  4HJ4 A;  1T1A A;  2VLG A;  3G6O A;  2HJE A;  2R78 A;  3T4O A;  2EWW A;  3BY9 A;  3T50 A;  3T4J A;  3FC7 A;  3EEA A;  2MJ6 A;  4I5S A;  5I5L A;  2W3F A;  3EOI A;  4LLO B;  5C5K A;  2HV1 A;  1OPX A;  3CUE C;  3LR3 A;  3NOT C;  2GX5 A;  4GS9 B;  3FPW A;  1T1B A;  2V9A A;  2M1C A;  5HDS A;  3LYX A;  3TRC A;  2P04 A;  3H7W A;  3UE6 A;  4HIA A;  5HWV A;  2P08 A;  2O0Y A;  2B02 A;  2O9A A;  3F1N B;  3H9W A;  4BMW A;  2VV7 A;  3SW1 A;  1NLZ A;  3E4P A;  3BW6 A;  1UWP X;  3GDI A;  3C2W A;  1EW0 A;  3MXQ A;  1TF1 A;  2JHE A;  2XSS A;  3EQV A;  3LR5 A;  1IOU A;  1TS7 A;  4IJG A;  1YSP A;  2W3D A;  4CLC A;  3PR6 A;  3LR0 A;  4B9O A;  4YWZ A;  5EFW A;  1OT9 A;  4HJ6 A;  4GCZ A;  1LL8 A;  5DJT A;  4DN0 A;  2OAQ 1;  2W1T B;  4L9F A;  4XT2 A;  3TE8 A;  4JGO A;  4GHI A;  2Z6C A;  2O99 A;  4I3J A;  3F1O A;  4FSF A;  3PXP A;  3FPV A;  4ZRR A;  1GSW A;  2PDR A;  4DJ3 A;  1P97 A;  3R7W B;  1BYW A;  4G3W A;  3NOU C;  3BQ8 A;  3H82 A;  2OAP 1;  2QJ5 A;  3PBS A;  4NXB A;  2NUP C;  2VA0 A;  3VE4 A;  4EU0 A;  5HL6 A;  3LIC A;  4BJP A;  4BBT A;  1P9R A;  3PBO A;  4CLC C;  1F98 A;  3BQA A;  2W1R A;  2W3E A;  2XRO A;  2JN7 A;  2O9B A;  4LRX C;  5IS1 A;  4PAU A;  4JGR A;  1W63 Q;  4NKP A;  1S66 L;  1N9N A;  2VEA A;  3OOV A;  4HNB A;  1S1Z A;  4MN7 A;  5HDD A;  3LIA A;  4BBV A;  3B47 A;  4F3L B;  3F1P B;  2PR6 A;  2JKT M;  2XA7 S;  4H6J A;  4R6L A;  1T1C A;  3KSH A;  2VKS A;  3T4K A;  2VZW A;  3S7Q A;  1XJ4 A;  1IFQ A;  3A0S A;  5F6A A;  3LUQ A;  2A24 B;  2IA2 A;  1P0Z A;  1OTE A;  2BAS A;  3S7N A;  3FG8 A;  3C8C A;  1STZ A;  4EEU A;  3OCL A;  4AFI A;  4WEK A;  2QHK A;  3S7O A;  4Y5F A;  3OLO A;  3OCN A;  1GSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...