5HWZA

Crystal structure of nitrophorin 4 d30n mutant with nitrite
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLNLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Elucidation of the heme active site electronic structure affecting the unprecedented nitrite dismutase activity of the ferrihemebproteins, the nitrophorins.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 50
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5hwzA00
3UEUA 1FELA 3L4RA 4ZHGA 2FS6A 3EYCA 1MX8A 1SY1A 4GETA 4DQ4A 3WJGA 4TQ2A 2QO4A 2LFOA 3FA8A 2DM5A 3IFBA 4TJZA 1E02A 1OPBA 4YKMA 5LJCA 3CBSA 4HPDA 2WQAE 1CJ5A 3NQ3A 2WSJA 5H9LA 5H8TA 2LBVA 3SAOA 1FDQA 1YUPA 1OBUA 3HWEA 3IA8A 3K3LA 4YCEA 4YFQA 3FLLA 3ELZA 4IAXA 1H91A 4OS3A 2L9CA 3AKMA 4OS8A 4ZH6A 1JJXA 3TGAA 1KXOA 3KZAA 4OMWA 1MVGA 4AZPA 3KFGA 4EDEA 1TW4A 1GX8A 2N93A 4M7MA 1LIFA 4I3DA 1PMPA 1JZUA 5HA1A 3G7XA 5D4AA 1U0XA 2HNXA 4LKTA 2FRSA 4NYQA 4ZHFA 4DQ3A 2QO6A 4NLJA 1QY2A 2W2AA 2MM3A 5FAZA 4YDBA 1EPBA 1ML7A 1YIVA 4MVIA 1EW3A 2A2GA 4YBUA 1B0OA 3C78X 3FR2A 4IMNA 1HBPA 1CBIA 1T0VA 2A2UA 1MX7A 1Z24A 1LICA 3BX7A 1NGLA 5DG4A 3GAQA 2AT6X 1YWCA 2CZUA 2A0AA 3PP6A 1X8NA 2NNQA 1DF3A 4QZUA 1I04A 1LIEA 1PBOA 2HLVA 1HQPA 4IB7A 3DTQA 2OFRX 1XKIA 5HZQA 3WJBA 2FT9A 2R74A 2QO5A 2CBRA 2K62A 4TKBA 1LPJA 4ARHA 3CQRA 4D6BA 5LJKA 3EBWA 1QWDA 4PSQA 1KT3A 4A60A 2NNDA 3VG2A 4TLJA 4ZFXA 1B4MA 1GKAA 4ZR2A 3B2JA 4IB8A 1DZPA 2G78A 5B29A 4YCHA 2ACOA 1KQXA 5IO6A 1XCAA 1TOWA 1P6PA 3WBGA 5LKFA 3FELA 2LKKA 3APWA 1MUPA 1SY3A 4GE1A 3C77X 1DV9A 1RBPA 2MO5A 2RD7C 1BRQA 5IO5A 1LKEA 4Y0QA 1ALBA 5F7GA 1BSYA 2YG2A 2CM4A 4BOEA 4GRJA 1LFOA 3BSZE 1U17A 4AZMA 2CZTA 1YP7A 3EM0A 3FW4A 2GTFX 4ZCBA 1SXWA 1BM5A 1TVQA 1JYDA 1O8VA 4IB6A 4NLIA 1E00A 4ZHDA 3ZUOA 1A18A 1GT3A 4A1HA 4YH0A 1IFBA 1A3YA 1IW2A 1ZNHA 3I0AA 3FW5A 4YFRA 1E5PA 3CBCA 4AZNA 4NNTA 2X46A 5CE4A 4LZVA 5HZ8A 3BS2A 1D3SA 1S44A 3FR5A 3APXA 1KZXA 5D47A 1EPAA 1EIIA 1TXLA 1DZMA 1ZNKA 3RSWA 3HWFA 4ORYA 2AT0X 1QFTA 2ASNX 1EALA 3CQNA 5LJHA 1KQWA 1N0SA 2AMMX 1AVGI 1FENA 3FA7A 4ODDA 3WJEA 4ZHCA 4TKHA 2P8GA 2WUTA 3VG5A 3TGBA 2RQ0A 4AZQA 3STMX 2G79A 1RLBE 2JU8A 4YGZA 4N7CA 4XMEA 4GNWA 2JOZA 1NP1A 2AT5X 3NQ9A 4OMXA 4UU2A 1PEEA 1G5WA 1O1UA 2HMBA 2WEXA 4Y0PA 5HA0A 1QG5A 4HPAA 1R0UA 3S26A 4LZUA 4ZH9A 2OVEA 4YKOA 3B2HA 3KQ0A 5D48A 3KFIA 4XMFA 4ORUA 1EIOA 1ERBA 1DZKA 2AT3X 3P6EA 3PH5A 5F6ZA 5HBSA 1ZNGA 4EEJA 4IB9A 1TOUA 4OS0A 2F73A 2R73A 1KOIA 5DPQA 1OPAA 2KT4B 4GH7A 1YWDA 2OFMX 1DFVA 5EPQA 4TNNA 1I06A 1X8UA 1ERXA 4D6AA 1KT5A 3U9PC 5HCCC 1BEBA 3HWDA 3WJDA 1SA8A 5EDBA 4TKJA 3P6DA 3OJYC 2L68A 5BVQA 2KTDA 3NR3A 4ZGUA 3APVA 3FEPA 1GX9A 4WFUA 3STNA 2RCTA 1LF7A 1X8OA 5AQ6A 3NX2A 3Q6LA 5LJDA 1LIDA 2POAA 1NP4A 3FA6A 3APUA 3STKA 1OEJA 5F58A 1D2UA 3PH6A 2E4JA 3ZUIA 1AB0A 5EEDA 3B2LA 1B56A 1O1VA 1VPRA 4IAWA 5HZ9A 2HZQA 1OEEA 2MJIA 1L6MA 3HK1A 4HFOA 1CRBA 5HWZA 1SY0A 3O2YA 2A3FX 3UEVA 2OVDA 4ZJ0A 2CM9A 2NNEA 1CBRA 2IFBA 2HYSA 1KGLA 4YDAA 2K23A 1BSOA 4I3BA 1S7DA 1X89A 2QM9A 4ZHHA 1SXYA 3CMPA 4AYHA 5BVTA 1A57A 1I4UA 1EXSA 1A2DA 2Q39A 3P6HA 3FIQA 1BRPA 5LJBA 3JS1A 4WFVA 4EXZA 4KIIA 5KHPA 2ANSA 1SXXA 2X45A 1QABE 3P6CA 1G85A 4O9SA 1YWBA 4CK4A 1U18A 3NPOA 1HBQA 1X8QA 5H9AA 3AKNA 4XMHA 3T1DA 3B2KA 4I9RA 4IMOA 5H9NA 4AW8A 2L67A 3DSZA 2WWPA 4ES7A 4AZOA 1JYJA 1B8EA 1HMRA 3D95A 4IBAA 2W2BA 5HZ6A 3O19A 5EDCA 2GC9A 1OEKA 3BLGA 2WEWA 5HCEC 2WQ9A 1QY1A 3TZSA 4ORRA 1S2PA 1SY2A 2XKLA 5K06A 3VG3A 4GKCA 4N7DA 1JJJA 4GNYA 1YWAA 4I3CA 1FTPA 3BRNA 3B2IA 1BLRA 3MVFA 3UEWA 4R0BA 2BLGA 5D8JA 1FE3A 1X8PA 3O22A 5LKEA 3MBTA 4M6SA 5D45A 3D96A 1DZJA 4A1YA 3I17A 4YGGA 1ACDA 4K19A 1LIBA 5EZ2A 2OVAA 1QY0A 3TF6A 2L5PA 2AKQA 2FR3A 3D97A 1GM6A 1BBPA 2JU3A 3JSQA 4Y0RA 3PPTA 1IKEA 2A13A 1OBPA 1PM1X 4YGHA 1FEMA 5FFHA 1ADLA 2XSTA 1GXAA 2FS7A 4Y0SA 3FENA 4AZRA 1LNMA 1T8VA 4QYPA 3VG7A 5EEEA 1ZNDA 4XMCA 2W2FA 1KT4A 1YP6A 5KIDA 5HTEA 3KFHA 4BQUA 3BU1A 3P6FA 2Q2MA 1QFVA 5JR8A 1GT4A 4QGVA 1IFCA 1JBHA 3NADA 1QQSA 3CWKA 1KT6A 4ALBA 4UU3A 5BVSA 3CR6A 3BU9A 2ACPX 5IO7A 4ORSA 1JV4A 3NP1A 3NX1A 4HPBA 1ICNA 1GT5A 1ZNEA 1ZNLA 1GGLA 3BDRA 3FMZA 5HCDC 2Q9SA 1AQBA 3U03A 4RUUA 3U0DA 2FTBA 5FENA 1VYFA 3VG6A 4A8ZA 1KZWA 2FR2A 4HPCA 1UZ2X 5L8OA 4I9SA 5L8IA 2OZQA 1BSQA 4ALOA 5HZ5A 1T68X 2LBAA 2AL0X 2JU7A 5LJEA 4MVLA 5HTDA 1GKAB 2GJ5A 2ALLX 3BY0A 3P6GA 2FWVA 3FR4A 3ELXA 5F1EA 4QGWA 4ORWA 2FLJA 1MDCA 2O62A 2RCQA 4NNSA 3UEXA 1G7NA 1HMSA 4QZTA 2AH7X 3WXQA 1EUOA 1IIUA 3F9DA 4WBKA 1DC9A 1VYGA 1HMTA 2JN3A 3FA9A 4XMDA 3EBKA 3WVMA 1EQDA 3PECA 3TGCA 1CBQA 3RZYA 4YFPA 4QAEA 3WJCA 1ZRYA 4ORXA 4QYNA 1UREA 3EMMA 1I05A 3ZQ3A 2NP1A 2AT8X 5B27A 1CBSA 1X71A 3HWGA 4LKPA 5C0NA 1SXUA 4XMGA 1HN2A 2Q4NA 2PY1A 2G7BA 4YMYA 2CBSA 3BX8A 4EFGA 1ICMA 1G74A 2R56A 4MVKA 5HAEA 2Q2PA 3FEKA 5L8NA 1OBQA 2QOSC 4RUNA 3KFFA 1E06A 2HZRA 1BJ7A 2EU7X 1KT7A 2LB6A 2RA6A 1IKJA 3WJFA 3PEDA 4BVMA 4NYRA 1GT1A 3C76X 3QKGA 5H9KA 3VG4A 1AELA 4YBPA 2WR6A 3F8AA 1BWYA 4NP1A 4QGXA 5KICA 5LJGA 5F6BA
chains in the Genus database with same CATH superfamily
3UEUA 1FELA 1VWJB 3ZW1A 3L4RA 4ZHGA 2FS6A 3EYCA 1MX8A 5B5FA 2MHDA 1SY1A 2IZLB 4BX7A 4GETA 4DQ4A 3WJGA 4TQ2A 2QO4A 1STRB 1VWLB 4DNEA 2LFOA 3FA8A 2DM5A 3IFBA 4TJZA 4U8UM 1Y53X 1STPA 4INNA 2IZJA 1N9YA 1E02A 4O3YA 1OPBA 4YKMA 5LJCA 2BC3A 3CBSA 3N91A 2A5CA 2IZGB 2WQAE 1SREA 3H3IA 4HPDA 1CJ5A 3NQ3A 2CAMA 1LDQA 2WSJA 3SOTA 3PK2A 3CKFA 5H8TA 5H9LA 2LBVA 3SAOA 1FDQA 1YUPA 1OBUA 3HWEA 2PI3O 3IA8A 3K3LA 4YCEA 1VWOB 3ELZA 3FLLA 3PQUA 1H91A 1W5RA 4IAXA 4OS3A 2L9CA 1MM9A 3AKMA 4OS8A 4ZH6A 4GK9A 1JJXA 1EI5A 4NV8A 3EW2A 3TGAA 1KXOA 3KZAA 4OMWA 1MVGA 2RTOB 4AZPA 3KFGA 1E2TA 4QRLA 1TW4A 1GX8A 2N93A 1PTSA 1LIFA 3P24A 4M7MA 2OFBA 4I3DA 1PMPA 2RTHB 3RDSA 1JZUA 1STSB 5F2BA 4YFQA 3VHHA 5HA1A 3G7XA 2JW1A 5D4AA 1FJ1E 4BX5B 1U0XA 2HNXA 4LKTA 4GU8A 2X55A 2FRSA 1LCWA 4NYQA 4IRWA 2BS6A 4DQ3A 2QO6A 1WBIA 4ZHFA 4CV7A 4EDEA 1VWFB 4NLJA 1VWEB 1QY2A 3T6FA 2W2AA 1HQQA 2LA7A 2MM3A 2DJGA 3LTWA 5FAZA 4YDBA 1EPBA 1VYOA 1ML7A 1YIVA 3HPEA 4MVIA 2A8GA 1EW3A 2A2GA 4YBUA 4CPHA 4BX6A 2YMSA 1B0OA 3C78X 1SWSA 3FR2A 1HBPA 2KTSA 1CBIA 1T0VA 2A2UA 1VWBB 2MWHA 4IMNA 1MX7A 1SWQA 1LICA 1Z24A 3BX7A 1NGLA 5DG4A 1SWPA 1SLDB 3GAQA 2AT6X 4CDDA 1YWCA 2CZUA 3GE2A 2A0AA 3PP6A 1X8NA 2IZBA 2NNQA 3ZI8A 1VWGB 4QZUA 1I04A 1LIEA 3V8UA 5IXGA 1PBOA 2HLVA 1HQPA 3OE3A 4IB7A 3DTQA 2OFRX 4OELA 4EKVA 3LHNA 1XKIA 4ML7B 2IZKA 5HZQA 3WJBA 2FT9A 1AVDA 2MF6A 4Y5DA 2R74A 4CPEA 2ZSCA 2FKJA 2OY1O 2QO5A 2I5VO 4O4SA 2CBRA 4GGRA 2K62A 4TKBA 1LPJA 1LUQA 4ARHA 3CQRA 2X56A 4D6BA 2GH7A 1NBXA 1MOYA 5LJKA 3EBWA 1WUBA 4U8UO 1QWDA 3D4RA 1HXZA 4GJSA 1KT3A 4PSQA 2NNDA 1SLGB 4A60A 3VG2A 2IZFB 4TLJA 4ZFXA 1B4MA 1GKAA 4ZR2A 1Y9LA 3B2JA 4IB8A 3RKGA 1DZPA 2G78A 5B29A 1HXLA 1UYNX 3S5VA 1SLEB 4YCHA 2ACOA 1KQXA 4JO6A 1SWAA 2AVIA 3D9WA 4O3ZA 3ZZVA 1XCAA 1TOWA 4CDEA 5IO6A 1P6PA 2KD2A 3SLOA 3WBGA 1JQPA 1VWKB 5LKFA 3FELA 2LKKA 2ZAGA 2RTJA 1MUPA 1SY3A 3APWA 4GE1A 5CSEA 4CPIA 4Z2VA 3C77X 1DV9A 1RBPA 2MO5A 2RD7C 1BRQA 5IO5A 1LKEA 4Y0QA 2VFBA 1ALBA 1RSTB 2I5ZO 2JGSA 4IABA 4L3RA 5F7GA 3T6LA 1BSYA 2YG2A 2CM4A 4BOEA 1RXHA 4GRJA 1LFOA 3BSZE 4MISA 3SLJA 1U17A 1RSUB 2CZTA 4AZMA 1MK5A 1YP7A 3VPJE 3EM0A 4C5PA 3LV4A 4KC7A 3FW4A 2GTFX 4ZCBA 1SXWA 5B2AO 1BM5A 1TVQA 1JYDA 1O8VA 1I9HA 2IZEB 4IB6A 4NLIA 1E00A 1SWBA 3RWXA 1A18A 1SWEA 4GDAA 3ZUOA 4ZHDA 1GT3A 3WYQA 3WZOA 4A1HA 4YH0A 1IFBA 1A3YA 1IW2A 1ZNHA 3I0AA 3FW5A 4YFRA 1E5PA 3CBCA 3AUMO 4CSBA 2RN4A 4AZNA 4NNTA 1VWCB 2X46A 4GJVA 3AEHA 4I95A 4KH8A 4LZVA 4CDCA 5CE4A 3EC5A 4KT5A 3BS2A 1D3SA 1S44A 1SWGA 3APXA 3FR5A 5HZ8A 1KZXA 5D47A 1EPAA 4CDFA 1TXLA 1EIIA 3RDQA 2ZAIA 1DZMA 1DF8A 1ZNKA 3RSWA 5B3MO 4FBVA 2OYBO 3ZWEA 5LJHA 2X8SA 4YVBA 3HWFA 4ORYA 2X8TA 3VU1A 2AT0X 1QFTA 4GZVA 2ASNX 1EALA 3CQNA 4NW4A 1KQWA 1N0SA 2AMMX 1AVGI 1FENA 2X34A 3FA7A 4ODDA 3WJEA 4ZHCA 4TKHA 2QMIA 2P8GA 1VWAB 2WUTA 3VG5A 2RQ0A 2Y3EA 3STMX 4AZQA 3U03A 3ZW1B 3TGBA 2G79A 1RLBE 2JU8A 4YGZA 4I60A 4N7CA 4XMEA 4GNWA 3HTYA 2Y3FA 1SWDA 2JOZA 1NP1A 2AT5X 3NQ9A 4OMXA 4UU2A 3E3CA 1SWJA 1PEEA 4BGFA 4U46A 1G5WA 1O1UA 2HMBA 2WEXA 4Y0PA 5FQ8E 4MEEA 5HA0A 4NV7A 1SRFA 1QG5A 4HPAA 1R0UA 3S26A 1I78A 4LZUA 4ZH9A 2OVEA 1VWHB 2A5BA 2RTLA 4Z2OA 4YKOA 3B2HA 3KQ0A 2OY7A 5D48A 2G8CO 2RTIB 3KFIA 4XMFA 4ORUA 2RTDB 1EIOA 1ERBA 1DZKA 2AT3X 3P6EA 3PH5A 4BCSA 3PDFA 3WZPA 1DF3A 4I6SA 5F6ZA 5HBSA 3T2WA 1ZNGA 3RY2A 4L1NA 1JMXA 1N9MA 1TOUA 2GTLO 2F73A 4IB9A 4OS0A 1SWCA 3UAQA 4EEJA 3WOVA 4BX5A 2R73A 1KOIA 1VWQB 1OPAA 2KT4B 4GH7A 1YWDA 2OFMX 1DFVA 1RAVA 2OL8O 2RTPB 5EPQA 3P02A 1JJUA 1I06A 4TNNA 4U8UN 4Y59A 1X8UA 3HOEA 2RTMA 1ERXA 1SWUA 2IZHB 5IRWA 4D6AA 3NBXX 1KT5A 3RE5A 3SZHA 3U9PC 1BEBA 3X00A 5IRUA 3HWDA 5HCCC 3WJDA 3S60A 1SA8A 5EDBA 1W4TA 4TKJA 3P6DA 3CKGA 2IZIA 3OJYC 2L68A 5BVQA 2KTDA 3MX7A 3NR3A 3WZQA 4ZGUA 3APVA 5BYPA 1SWOA 4O49A 3FEPA 1GX9A 2RTAA 4WFUA 3STNA 2RCTA 4Z6JA 5K67A 1LF7A 1X8OA 2F09A 3NX2A 3Q6LA 5AQ6A 5LJDA 1LIDA 1NP4A 2POAA 3FA6A 4GGZA 3APUA 3STKA 1SWTA 1OEJA 4O4OA 5F58A 1D2UA 2RTBB 3PH6A 5LJGA 4WHIA 2E4JA 3ZUIA 1AB0A 5EEDA 3B2LA 1KFFA 1B56A 1O1VA 4ON1A 1VPRA 4IAWA 5HZ9A 2HZQA 1OEEA 5K68A 2MJIA 1NQNA 1L6MA 3HK1A 4HFOA 1CRBA 1SWFA 2F01A 5FQ7E 1SY0A 2X32A 3WZNA 5HWZA 3O2YA 2A3FX 3UEVA 1Y55X 1N7YA 2OVDA 2RTNB 4U3QA 4B55A 4ZJ0A 2CM9A 3RDOA 2NNEA 2UYWA 1CBRA 2IFBA 4GD9A 1VWNB 3EW1A 2HYSA 3T2XA 1KGLA 4ID2A 4YDAA 5FQ6E 2K23A 1BSOA 3VGWA 2GTLM 1KL4A 2C4IA 4I3BA 3RY1A 2HKDA 1S7DA 1X89A 1PBYA 2QM9A 5B11O 4ZHHA 1SXYA 3WYPA 1SRJA 3CMPA 4AYHA 5BVTA 2QCBA 1N43A 1A57A 1I4UA 1EXSA 1A2DA 2Q39A 4LQZA 3P6HA 3FIQA 1BRPA 3KVNA 5LJBA 2BS5A 3JS1A 2IZAA 4WFVA 4EXZA 4KIIA 5KHPA 2ANSA 1SXXA 2X45A 1QABE 3MM0A 3OD9A 5L3YA 3P6CA 4FBOA 4QQ1A 2OF8A 1G85A 4O9SA 1YWBA 4CK4A 1U18A 3NPOA 1HBQA 1X8QA 5H9AA 3AKNA 5B5GA 4XMHA 3T1DA 5B10O 3B2KA 2X8FA 4I9RA 4IMOA 5H9NA 4AW8A 2L67A 3DSZA 4O3WA 4PJ2A 2BSZA 2BT9A 3ZW0B 2WWPA 2M4LA 1VWPB 4ES7A 2DJFA 4AZOA 1KL5A 1JYJA 1B8EA 1HMRA 1LELA 4JNJA 3D95A 4IBAA 2W2BA 4U9CA 5HZ6A 4O3XB 1NQMA 2JMBA 3O19A 2OY8A 3RE6A 5EDCA 4O4UA 4BX7B 1MEPA 4COTA 1SWLA 4GDZA 5IRAA 3FYFA 2GC9A 1OEKA 3BLGA 1KL3A 3SZIA 2WEWA 5HCEC 2WQ9A 1QY1A 3TZSA 4ORRA 1S2PA 1SY2A 2XKLA 4JGLA 3VG3A 4GKCA 4N7DA 5K06A 4GNYA 1JJJA 1YWAA 4I3CA 1IJ8A 1K24A 1FTPA 4FQBB 3BRNA 3B2IA 1BLRA 2IZCB 5CYBA 3MVFA 2OF9A 3UEWA 4R0BA 3HOLA 2OL7A 2BLGA 3ZW2A 4GUZA 2FHNX 3MG5A 5D8JA 1FE3A 1K3BA 1X8PA 3O22A 5LKEA 3MBTA 4M6SA 4OEMA 4ZGFA 4FGIB 2RTRB 2C1SA 5D45A 2G5LA 3D96A 1DZJA 4A1YA 3I17A 4MVEA 1ACDA 4K19A 4YGGA 3FDCA 1LIBA 5EZ2A 2OVAA 4Z28A 1QY0A 2OL6O 3TF6A 2L5PA 2AKQA 2FR3A 3D97A 1GM6A 1BBPA 2JU3A 3JSQA 3OBLA 4Y0RA 3PPTA 1IKEA 1LCZA 1OBPA 1Y9TA 2A13A 3F6ZB 4HWMA 3S5XA 2BHVA 1PM1X 4YGHA 1FEMA 5FFHA 1ADLA 2XSTA 1AVEA 1GXAA 2FGSA 1NDJA 2FS7A 3FENA 4Y0SA 1LNMA 4AZRA 1T8VA 1LCVA 4QYPA 3VG7A 5EEEA 5CHKA 1ZNDA 1SRIA 2RTEB 2W2FA 4XMCA 1KT4A 1YP6A 5JD2A 5KIDA 5HTEA 3KFHA 4BQUA 3BU1A 4CPHB 1LDOA 3P6FA 2RTGB 1GX3A 2Q2MA 1QFVA 4BJ8A 4BX6B 1VWMB 4EQAC 5C0NA 5JR8A 2RTFB 1GT4A 1VWDB 2FHLA 5AJCA 4BBOA 4QGVA 4QNIA 1IFCA 1JBHA 3NADA 1QQSA 3CWKA 1KT6A 4ALBA 4UU3A 4GGTA 5BVSA 2OVSA 3CR6A 3BU9A 2ACPX 3VE1A 5IO7A 4ORSA 1JV4A 3NP1A 3NQKA 3FIDA 3NX1A 4HPBA 4OKAA 2VDFA 1ICNA 1GT5A 1ZNEA 1ZNLA 1GGLA 3BDRA 3FMZA 5HCDC 2OFAA 1AQBA 2Q9SA 4RUUA 4Z27A 3U0DA 1N4JA 2FTBA 5FENA 1VYFA 2IZDB 3VG6A 4A8ZA 1KZWA 2FR2A 1SWHA 4HPCA 1Y0GA 1UZ2X 5L8OA 4I9SA 3VHMA 5L8IA 1SRGA 2OZQA 1BSQA 2AF5A 4ALOA 5HZ5A 1T68X 2C1QA 4JHQA 2LBAA 2AL0X 5AEOA 1SWRA 2JU7A 5LJEA 2QOMA 4MVLA 2OY5O 5HTDA 1GKAB 2GJ5A 2ALLX 3BY0A 3QQ2A 3P6GA 2RTQB 2FWVA 5DPQA 3FR4A 3ELXA 2VFCA 4QGWA 5F1EA 4ORWA 2FLJA 1MDCA 4O4XA 2O62A 2RCQA 4NNSA 3UEXA 3RBYA 1G7NA 1HMSA 4QZTA 2AH7X 3Q34A 3WXQA 4CPFA 1EUOA 1IIUA 3F9DA 4WBKA 1DC9A 1VYGA 2KW1A 2RTKA 4KCAA 3SLTA 2Z4HA 1HMTA 1SMPI 2JN3A 3FA9A 4XMDA 3EBKA 4Z2PA 3WVMA 1EQDA 3PECA 4MIRA 3TGCA 1OSPO 1CBQA 1SLFB 4YFPA 3RZYA 2Y32A 1NC9A 4QAEA 3WJCA 1ZRYA 4ORXA 4QYNA 1UREA 3EMMA 1I05A 3ZQ3A 5AJBA 1JMZA 2NP1A 2AT8X 5B27A 3RDUA 1CBSA 1X71A 3HWGA 4KC8A 4LKPA 1RXJA 1SXUA 1HN2A 2Q4NA 1Y52X 4XMGA 2PY1A 3RDXA 2G7BA 3VE2A 4YMYA 3RDMA 2CBSA 3BX8A 4EFGA 1ICMA 4DCBA 3VHIA 1G74A 2R56A 4MVKA 5HAEA 1JIWI 2Q2PA 2X4MA 3FEKA 5L8NA 1OBQA 2QOSC 4RUNA 3KFFA 4FBRA 1E06A 1SRHA 2HZRA 1BJ7A 2EU7X 1KT7A 1UYOX 2LB6A 2RA6A 2UZ2A 1RXKA 1HY2A 1IKJA 1W6FA 3WJFA 3PEDA 4BVMA 4NYRA 1GT1A 2Z4IA 1SWNA 3C76X 3PQSA 3QKGA 2FKGA 5H9KA 3VG4A 3JQOA 3ZW0A 1AELA 4YBPA 2WR6A 3F8AA 1BWYA 2WPUA 1VWIB 4NP1A 4QGXA 2RTCB 1VWRB 2GTLN 5KICA 1SWKA 3SZJA 5F6BA
chains in the Genus database with same CATH topology
3UEUA 1FELA 3ZW1A 3L4RA 4ZHGA 2FS6A 3EYCA 1MX8A 2MHDA 1SY1A 4GETA 4DQ4A 3WJGA 4TQ2A 2QO4A 2LFOA 3FA8A 2DM5A 3IFBA 4TJZA 4U8UM 4INNA 1E02A 4O3YA 1OPBA 4YKMA 5LJCA 3N91A 3CBSA 4HPDA 2WQAE 3H3IA 1CJ5A 3NQ3A 2WSJA 3SOTA 5H9LA 5H8TA 2LBVA 3SAOA 1FDQA 1YUPA 1OBUA 3HWEA 3IA8A 3K3LA 4YCEA 4YFQA 3FLLA 3ELZA 3PQUA 4IAXA 1H91A 4OS3A 2L9CA 3AKMA 4OS8A 4ZH6A 1JJXA 4GK9A 1EI5A 3TGAA 1KXOA 3KZAA 4OMWA 1MVGA 4AZPA 3KFGA 4QRLA 4EDEA 1TW4A 1GX8A 2N93A 3P24A 1LIFA 4M7MA 4I3DA 1PMPA 1JZUA 5HA1A 3G7XA 2JW1A 5D4AA 1U0XA 2HNXA 4LKTA 4GU8A 2FRSA 4NYQA 4ZHFA 2BS6A 4DQ3A 2QO6A 4CV7A 4NLJA 1QY2A 2W2AA 2LA7A 2MM3A 5FAZA 4YDBA 1EPBA 1ML7A 1YIVA 4MVIA 1EW3A 2A2GA 4YBUA 2YMSA 1B0OA 3C78X 3FR2A 4IMNA 2MWHA 1HBPA 1CBIA 1T0VA 2A2UA 2KTSA 1MX7A 1Z24A 1LICA 3BX7A 1NGLA 5DG4A 3GAQA 2AT6X 1YWCA 2CZUA 3GE2A 2A0AA 3PP6A 1X8NA 2NNQA 3ZI8A 1DF3A 4QZUA 1I04A 1LIEA 3V8UA 1PBOA 2HLVA 1HQPA 3OE3A 4IB7A 3DTQA 2OFRX 3LHNA 1XKIA 4ML7B 5HZQA 3WJBA 2FT9A 2R74A 2QO5A 4O4SA 2CBRA 2K62A 4TKBA 1LPJA 4ARHA 3CQRA 4D6BA 5LJKA 3EBWA 4U8UO 1QWDA 3D4RA 4PSQA 1KT3A 4A60A 2NNDA 3VG2A 4TLJA 4ZFXA 1B4MA 1GKAA 4ZR2A 1Y9LA 3B2JA 4IB8A 3RKGA 1DZPA 2G78A 5B29A 3S5VA 4YCHA 2ACOA 1KQXA 5IO6A 4O3ZA 3ZZVA 1XCAA 1TOWA 1P6PA 2KD2A 3WBGA 5LKFA 3FELA 2LKKA 2ZAGA 3APWA 1MUPA 1SY3A 4GE1A 3C77X 1DV9A 1RBPA 2MO5A 2RD7C 1BRQA 5IO5A 1LKEA 4Y0QA 1ALBA 4IABA 4L3RA 5F7GA 1BSYA 2YG2A 2CM4A 4BOEA 4GRJA 1LFOA 3BSZE 4MISA 1U17A 4AZMA 2CZTA 3VPJE 1YP7A 3EM0A 3LV4A 4KC7A 3FW4A 2GTFX 4ZCBA 1SXWA 1BM5A 1TVQA 1JYDA 1O8VA 4IB6A 4NLIA 1E00A 3RWXA 3ZUOA 1A18A 4ZHDA 1GT3A 4A1HA 4YH0A 1IFBA 1A3YA 1IW2A 1ZNHA 3I0AA 3FW5A 4YFRA 1E5PA 3CBCA 4CSBA 2RN4A 4AZNA 4NNTA 2X46A 5CE4A 4KH8A 4LZVA 4I95A 5HZ8A 4KT5A 3BS2A 1D3SA 1S44A 3FR5A 3APXA 1KZXA 5D47A 1EPAA 1EIIA 1TXLA 2ZAIA 1DZMA 1ZNKA 3RSWA 3ZWEA 5LJHA 4FBVA 2X8SA 3HWFA 4ORYA 2X8TA 3VU1A 2AT0X 1QFTA 4GZVA 2ASNX 1EALA 3CQNA 4NW4A 1KQWA 1N0SA 2AMMX 1AVGI 1FENA 3FA7A 4ODDA 3WJEA 4ZHCA 4TKHA 2QMIA 2P8GA 2WUTA 3VG5A 3TGBA 2RQ0A 4AZQA 3STMX 3ZW1B 2G79A 1RLBE 2JU8A 4YGZA 4N7CA 4XMEA 4GNWA 3HTYA 2JOZA 1NP1A 2AT5X 3NQ9A 4OMXA 4UU2A 3E3CA 1PEEA 1G5WA 1O1UA 2HMBA 2WEXA 4Y0PA 5FQ8E 5HA0A 1QG5A 4HPAA 1R0UA 3S26A 4LZUA 4ZH9A 2OVEA 4YKOA 3B2HA 3KQ0A 5D48A 3KFIA 4XMFA 4ORUA 1EIOA 1ERBA 1DZKA 2AT3X 3P6EA 3PH5A 4I6SA 5F6ZA 5HBSA 1ZNGA 4L1NA 4EEJA 2GTLO 1TOUA 4IB9A 2F73A 4OS0A 3UAQA 3WOVA 2R73A 1KOIA 5DPQA 1OPAA 2KT4B 4GH7A 1YWDA 2OFMX 1DFVA 5EPQA 3P02A 4TNNA 1I06A 4U8UN 1X8UA 3HOEA 1ERXA 4D6AA 3NBXX 1KT5A 3U9PC 5HCCC 1BEBA 3HWDA 3WJDA 3S60A 1SA8A 5EDBA 4TKJA 3P6DA 3OJYC 2L68A 5BVQA 2KTDA 3MX7A 3NR3A 4ZGUA 3APVA 5BYPA 4O49A 3FEPA 1GX9A 4WFUA 3STNA 2RCTA 1LF7A 1X8OA 2F09A 3NX2A 3Q6LA 5AQ6A 5LJDA 1LIDA 2POAA 1NP4A 3FA6A 3APUA 3STKA 1OEJA 4O4OA 5F58A 1D2UA 3PH6A 5LJGA 4WHIA 2E4JA 3ZUIA 1AB0A 5EEDA 3B2LA 1B56A 1O1VA 4ON1A 1VPRA 4IAWA 5HZ9A 2HZQA 1OEEA 2MJIA 1L6MA 3HK1A 4HFOA 1CRBA 5FQ7E 5HWZA 1SY0A 3O2YA 2A3FX 3UEVA 2OVDA 4U3QA 4ZJ0A 2CM9A 2NNEA 1CBRA 2IFBA 2HYSA 1KGLA 4ID2A 4YDAA 5FQ6E 2K23A 1BSOA 2GTLM 4I3BA 1S7DA 1X89A 2QM9A 4ZHHA 1SXYA 3CMPA 4AYHA 5BVTA 1A57A 1I4UA 1EXSA 1A2DA 2Q39A 4LQZA 3P6HA 3FIQA 1BRPA 5LJBA 2BS5A 3JS1A 4WFVA 4EXZA 4KIIA 5KHPA 2ANSA 1SXXA 2X45A 1QABE 3OD9A 3P6CA 4FBOA 4QQ1A 1G85A 4O9SA 1YWBA 4CK4A 1U18A 3NPOA 1HBQA 1X8QA 5H9AA 3AKNA 4XMHA 3T1DA 3B2KA 2X8FA 4I9RA 4IMOA 5H9NA 4AW8A 2L67A 3DSZA 4O3WA 4PJ2A 2BT9A 3ZW0B 2WWPA 2M4LA 4ES7A 4AZOA 1JYJA 1B8EA 1HMRA 3D95A 4IBAA 2W2BA 4U9CA 5HZ6A 4O3XB 2JMBA 3O19A 5EDCA 4O4UA 4COTA 4GDZA 3FYFA 2GC9A 1OEKA 3BLGA 2WEWA 5HCEC 2WQ9A 1QY1A 3TZSA 4ORRA 1S2PA 1SY2A 2XKLA 4JGLA 3VG3A 4GKCA 4N7DA 5K06A 4GNYA 1JJJA 1YWAA 4I3CA 1FTPA 4FQBB 3BRNA 3B2IA 1BLRA 5CYBA 3MVFA 3UEWA 4R0BA 3HOLA 3ZW2A 2BLGA 5D8JA 1FE3A 1X8PA 3O22A 5LKEA 3MBTA 4M6SA 4ZGFA 4FGIB 5D45A 3D96A 1DZJA 4A1YA 3I17A 4YGGA 1ACDA 4K19A 1LIBA 5EZ2A 2OVAA 1QY0A 3TF6A 2L5PA 2AKQA 2FR3A 3D97A 1GM6A 1BBPA 2JU3A 3JSQA 3OBLA 4Y0RA 3PPTA 1IKEA 1Y9TA 1OBPA 2A13A 3F6ZB 4HWMA 3S5XA 2BHVA 1PM1X 4YGHA 1FEMA 5FFHA 1ADLA 2XSTA 1GXAA 2FS7A 4Y0SA 3FENA 4AZRA 1LNMA 1T8VA 4QYPA 3VG7A 5EEEA 1ZNDA 4XMCA 2W2FA 1KT4A 1YP6A 5KIDA 5HTEA 3KFHA 4BQUA 3BU1A 3P6FA 2Q2MA 1QFVA 4EQAC 5JR8A 1GT4A 5AJCA 4QGVA 4QNIA 1IFCA 1JBHA 3NADA 1QQSA 3CWKA 1KT6A 4ALBA 4UU3A 5BVSA 2OVSA 3CR6A 3BU9A 2ACPX 3VE1A 5IO7A 4ORSA 1JV4A 3NP1A 3NQKA 3NX1A 4HPBA 1ICNA 1GT5A 1ZNEA 1ZNLA 1GGLA 3BDRA 3FMZA 5HCDC 2Q9SA 1AQBA 3U03A 4RUUA 3U0DA 2FTBA 5FENA 1VYFA 3VG6A 4A8ZA 1KZWA 2FR2A 4HPCA 1UZ2X 5L8OA 4I9SA 5L8IA 2OZQA 1BSQA 4ALOA 5HZ5A 1T68X 2LBAA 2AL0X 5AEOA 2JU7A 5LJEA 4MVLA 5HTDA 1GKAB 2GJ5A 2ALLX 3BY0A 3P6GA 2FWVA 3FR4A 3ELXA 5F1EA 4QGWA 4ORWA 2FLJA 1MDCA 4O4XA 2O62A 2RCQA 4NNSA 3UEXA 3RBYA 1G7NA 1HMSA 4QZTA 2AH7X 3WXQA 1EUOA 1IIUA 3F9DA 4WBKA 1DC9A 1VYGA 2KW1A 4KCAA 2Z4HA 1HMTA 1SMPI 2JN3A 3FA9A 4XMDA 3EBKA 3WVMA 1EQDA 3PECA 4MIRA 3TGCA 1CBQA 3RZYA 4YFPA 4QAEA 3WJCA 1ZRYA 4ORXA 4QYNA 1UREA 3EMMA 1I05A 3ZQ3A 5AJBA 2NP1A 2AT8X 5B27A 1CBSA 1X71A 3HWGA 4KC8A 4LKPA 1SXUA 4XMGA 1HN2A 2Q4NA 5C0NA 2PY1A 2G7BA 3VE2A 4YMYA 2CBSA 3BX8A 4EFGA 1ICMA 1G74A 2R56A 4MVKA 5HAEA 1JIWI 2Q2PA 3FEKA 5L8NA 1OBQA 2QOSC 4RUNA 3KFFA 4FBRA 1E06A 2HZRA 1BJ7A 2EU7X 1KT7A 2LB6A 2RA6A 1IKJA 3WJFA 3PEDA 4BVMA 4NYRA 1GT1A 2Z4IA 3C76X 3PQSA 3QKGA 5H9KA 3ZW0A 3VG4A 3JQOA 1AELA 4YBPA 2WR6A 3F8AA 1BWYA 4NP1A 4QGXA 5KICA 2GTLN 4MVEA 5F6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEU A;  1FEL A;  3L4R A;  4ZHG A;  2FS6 A;  3EYC A;  1MX8 A;  1SY1 A;  4GET A;  4DQ4 A;  3WJG A;  4TQ2 A;  2QO4 A;  2LFO A;  3FA8 A;  2DM5 A;  3IFB A;  4TJZ A;  1E02 A;  1OPB A;  4YKM A;  5LJC A;  3CBS A;  4HPD A;  2WQA E;  1CJ5 A;  3NQ3 A;  2WSJ A;  5H9L A;  5H8T A;  2LBV A;  3SAO A;  1FDQ A;  1YUP A;  1OBU A;  3HWE A;  3IA8 A;  3K3L A;  4YCE A;  4YFQ A;  3FLL A;  3ELZ A;  4IAX A;  1H91 A;  4OS3 A;  2L9C A;  3AKM A;  4OS8 A;  4ZH6 A;  1JJX A;  3TGA A;  1KXO A;  3KZA A;  4OMW A;  1MVG A;  4AZP A;  3KFG A;  4EDE A;  1TW4 A;  1GX8 A;  2N93 A;  4M7M A;  1LIF A;  4I3D A;  1PMP A;  1JZU A;  5HA1 A;  3G7X A;  5D4A A;  1U0X A;  2HNX A;  4LKT A;  2FRS A;  4NYQ A;  4ZHF A;  4DQ3 A;  2QO6 A;  4NLJ A;  1QY2 A;  2W2A A;  2MM3 A;  5FAZ A;  4YDB A;  1EPB A;  1ML7 A;  1YIV A;  4MVI A;  1EW3 A;  2A2G A;  4YBU A;  1B0O A;  3C78 X;  3FR2 A;  4IMN A;  1HBP A;  1CBI A;  1T0V A;  2A2U A;  1MX7 A;  1Z24 A;  1LIC A;  3BX7 A;  1NGL A;  5DG4 A;  3GAQ A;  2AT6 X;  1YWC A;  2CZU A;  2A0A A;  3PP6 A;  1X8N A;  2NNQ A;  1DF3 A;  4QZU A;  1I04 A;  1LIE A;  1PBO A;  2HLV A;  1HQP A;  4IB7 A;  3DTQ A;  2OFR X;  1XKI A;  5HZQ A;  3WJB A;  2FT9 A;  2R74 A;  2QO5 A;  2CBR A;  2K62 A;  4TKB A;  1LPJ A;  4ARH A;  3CQR A;  4D6B A;  5LJK A;  3EBW A;  1QWD A;  4PSQ A;  1KT3 A;  4A60 A;  2NND A;  3VG2 A;  4TLJ A;  4ZFX A;  1B4M A;  1GKA A;  4ZR2 A;  3B2J A;  4IB8 A;  1DZP A;  2G78 A;  5B29 A;  4YCH A;  2ACO A;  1KQX A;  5IO6 A;  1XCA A;  1TOW A;  1P6P A;  3WBG A;  5LKF A;  3FEL A;  2LKK A;  3APW A;  1MUP A;  1SY3 A;  4GE1 A;  3C77 X;  1DV9 A;  1RBP A;  2MO5 A;  2RD7 C;  1BRQ A;  5IO5 A;  1LKE A;  4Y0Q A;  1ALB A;  5F7G A;  1BSY A;  2YG2 A;  2CM4 A;  4BOE A;  4GRJ A;  1LFO A;  3BSZ E;  1U17 A;  4AZM A;  2CZT A;  1YP7 A;  3EM0 A;  3FW4 A;  2GTF X;  4ZCB A;  1SXW A;  1BM5 A;  1TVQ A;  1JYD A;  1O8V A;  4IB6 A;  4NLI A;  1E00 A;  4ZHD A;  3ZUO A;  1A18 A;  1GT3 A;  4A1H A;  4YH0 A;  1IFB A;  1A3Y A;  1IW2 A;  1ZNH A;  3I0A A;  3FW5 A;  4YFR A;  1E5P A;  3CBC A;  4AZN A;  4NNT A;  2X46 A;  5CE4 A;  4LZV A;  5HZ8 A;  3BS2 A;  1D3S A;  1S44 A;  3FR5 A;  3APX A;  1KZX A;  5D47 A;  1EPA A;  1EII A;  1TXL A;  1DZM A;  1ZNK A;  3RSW A;  3HWF A;  4ORY A;  2AT0 X;  1QFT A;  2ASN X;  1EAL A;  3CQN A;  5LJH A;  1KQW A;  1N0S A;  2AMM X;  1AVG I;  1FEN A;  3FA7 A;  4ODD A;  3WJE A;  4ZHC A;  4TKH A;  2P8G A;  2WUT A;  3VG5 A;  3TGB A;  2RQ0 A;  4AZQ A;  3STM X;  2G79 A;  1RLB E;  2JU8 A;  4YGZ A;  4N7C A;  4XME A;  4GNW A;  2JOZ A;  1NP1 A;  2AT5 X;  3NQ9 A;  4OMX A;  4UU2 A;  1PEE A;  1G5W A;  1O1U A;  2HMB A;  2WEX A;  4Y0P A;  5HA0 A;  1QG5 A;  4HPA A;  1R0U A;  3S26 A;  4LZU A;  4ZH9 A;  2OVE A;  4YKO A;  3B2H A;  3KQ0 A;  5D48 A;  3KFI A;  4XMF A;  4ORU A;  1EIO A;  1ERB A;  1DZK A;  2AT3 X;  3P6E A;  3PH5 A;  5F6Z A;  5HBS A;  1ZNG A;  4EEJ A;  4IB9 A;  1TOU A;  4OS0 A;  2F73 A;  2R73 A;  1KOI A;  5DPQ A;  1OPA A;  2KT4 B;  4GH7 A;  1YWD A;  2OFM X;  1DFV A;  5EPQ A;  4TNN A;  1I06 A;  1X8U A;  1ERX A;  4D6A A;  1KT5 A;  3U9P C;  5HCC C;  1BEB A;  3HWD A;  3WJD A;  1SA8 A;  5EDB A;  4TKJ A;  3P6D A;  3OJY C;  2L68 A;  5BVQ A;  2KTD A;  3NR3 A;  4ZGU A;  3APV A;  3FEP A;  1GX9 A;  4WFU A;  3STN A;  2RCT A;  1LF7 A;  1X8O A;  5AQ6 A;  3NX2 A;  3Q6L A;  5LJD A;  1LID A;  2POA A;  1NP4 A;  3FA6 A;  3APU A;  3STK A;  1OEJ A;  5F58 A;  1D2U A;  3PH6 A;  2E4J A;  3ZUI A;  1AB0 A;  5EED A;  3B2L A;  1B56 A;  1O1V A;  1VPR A;  4IAW A;  5HZ9 A;  2HZQ A;  1OEE A;  2MJI A;  1L6M A;  3HK1 A;  4HFO A;  1CRB A;  5HWZ A;  1SY0 A;  3O2Y A;  2A3F X;  3UEV A;  2OVD A;  4ZJ0 A;  2CM9 A;  2NNE A;  1CBR A;  2IFB A;  2HYS A;  1KGL A;  4YDA A;  2K23 A;  1BSO A;  4I3B A;  1S7D A;  1X89 A;  2QM9 A;  4ZHH A;  1SXY A;  3CMP A;  4AYH A;  5BVT A;  1A57 A;  1I4U A;  1EXS A;  1A2D A;  2Q39 A;  3P6H A;  3FIQ A;  1BRP A;  5LJB A;  3JS1 A;  4WFV A;  4EXZ A;  4KII A;  5KHP A;  2ANS A;  1SXX A;  2X45 A;  1QAB E;  3P6C A;  1G85 A;  4O9S A;  1YWB A;  4CK4 A;  1U18 A;  3NPO A;  1HBQ A;  1X8Q A;  5H9A A;  3AKN A;  4XMH A;  3T1D A;  3B2K A;  4I9R A;  4IMO A;  5H9N A;  4AW8 A;  2L67 A;  3DSZ A;  2WWP A;  4ES7 A;  4AZO A;  1JYJ A;  1B8E A;  1HMR A;  3D95 A;  4IBA A;  2W2B A;  5HZ6 A;  3O19 A;  5EDC A;  2GC9 A;  1OEK A;  3BLG A;  2WEW A;  5HCE C;  2WQ9 A;  1QY1 A;  3TZS A;  4ORR A;  1S2P A;  1SY2 A;  2XKL A;  5K06 A;  3VG3 A;  4GKC A;  4N7D A;  1JJJ A;  4GNY A;  1YWA A;  4I3C A;  1FTP A;  3BRN A;  3B2I A;  1BLR A;  3MVF A;  3UEW A;  4R0B A;  2BLG A;  5D8J A;  1FE3 A;  1X8P A;  3O22 A;  5LKE A;  3MBT A;  4M6S A;  5D45 A;  3D96 A;  1DZJ A;  4A1Y A;  3I17 A;  4YGG A;  1ACD A;  4K19 A;  1LIB A;  5EZ2 A;  2OVA A;  1QY0 A;  3TF6 A;  2L5P A;  2AKQ A;  2FR3 A;  3D97 A;  1GM6 A;  1BBP A;  2JU3 A;  3JSQ A;  4Y0R A;  3PPT A;  1IKE A;  2A13 A;  1OBP A;  1PM1 X;  4YGH A;  1FEM A;  5FFH A;  1ADL A;  2XST A;  1GXA A;  2FS7 A;  4Y0S A;  3FEN A;  4AZR A;  1LNM A;  1T8V A;  4QYP A;  3VG7 A;  5EEE A;  1ZND A;  4XMC A;  2W2F A;  1KT4 A;  1YP6 A;  5KID A;  5HTE A;  3KFH A;  4BQU A;  3BU1 A;  3P6F A;  2Q2M A;  1QFV A;  5JR8 A;  1GT4 A;  4QGV A;  1IFC A;  1JBH A;  3NAD A;  1QQS A;  3CWK A;  1KT6 A;  4ALB A;  4UU3 A;  5BVS A;  3CR6 A;  3BU9 A;  2ACP X;  5IO7 A;  4ORS A;  1JV4 A;  3NP1 A;  3NX1 A;  4HPB A;  1ICN A;  1GT5 A;  1ZNE A;  1ZNL A;  1GGL A;  3BDR A;  3FMZ A;  5HCD C;  2Q9S A;  1AQB A;  3U03 A;  4RUU A;  3U0D A;  2FTB A;  5FEN A;  1VYF A;  3VG6 A;  4A8Z A;  1KZW A;  2FR2 A;  4HPC A;  1UZ2 X;  5L8O A;  4I9S A;  5L8I A;  2OZQ A;  1BSQ A;  4ALO A;  5HZ5 A;  1T68 X;  2LBA A;  2AL0 X;  2JU7 A;  5LJE A;  4MVL A;  5HTD A;  1GKA B;  2GJ5 A;  2ALL X;  3BY0 A;  3P6G A;  2FWV A;  3FR4 A;  3ELX A;  5F1E A;  4QGW A;  4ORW A;  2FLJ A;  1MDC A;  2O62 A;  2RCQ A;  4NNS A;  3UEX A;  1G7N A;  1HMS A;  4QZT A;  2AH7 X;  3WXQ A;  1EUO A;  1IIU A;  3F9D A;  4WBK A;  1DC9 A;  1VYG A;  1HMT A;  2JN3 A;  3FA9 A;  4XMD A;  3EBK A;  3WVM A;  1EQD A;  3PEC A;  3TGC A;  1CBQ A;  3RZY A;  4YFP A;  4QAE A;  3WJC A;  1ZRY A;  4ORX A;  4QYN A;  1URE A;  3EMM A;  1I05 A;  3ZQ3 A;  2NP1 A;  2AT8 X;  5B27 A;  1CBS A;  1X71 A;  3HWG A;  4LKP A;  5C0N A;  1SXU A;  4XMG A;  1HN2 A;  2Q4N A;  2PY1 A;  2G7B A;  4YMY A;  2CBS A;  3BX8 A;  4EFG A;  1ICM A;  1G74 A;  2R56 A;  4MVK A;  5HAE A;  2Q2P A;  3FEK A;  5L8N A;  1OBQ A;  2QOS C;  4RUN A;  3KFF A;  1E06 A;  2HZR A;  1BJ7 A;  2EU7 X;  1KT7 A;  2LB6 A;  2RA6 A;  1IKJ A;  3WJF A;  3PED A;  4BVM A;  4NYR A;  1GT1 A;  3C76 X;  3QKG A;  5H9K A;  3VG4 A;  1AEL A;  4YBP A;  2WR6 A;  3F8A A;  1BWY A;  4NP1 A;  4QGX A;  5KIC A;  5LJG A;  5F6B A; 
#chains in the Genus database with same CATH topology
 3UEU A;  1FEL A;  1VWJ B;  3ZW1 A;  3L4R A;  4ZHG A;  2FS6 A;  3EYC A;  1MX8 A;  5B5F A;  2MHD A;  1SY1 A;  2IZL B;  4BX7 A;  4GET A;  4DQ4 A;  3WJG A;  4TQ2 A;  2QO4 A;  1STR B;  1VWL B;  4DNE A;  2LFO A;  3FA8 A;  2DM5 A;  3IFB A;  4TJZ A;  4U8U M;  1Y53 X;  1STP A;  4INN A;  2IZJ A;  1N9Y A;  1E02 A;  4O3Y A;  1OPB A;  4YKM A;  5LJC A;  2BC3 A;  3CBS A;  3N91 A;  2A5C A;  2IZG B;  2WQA E;  1SRE A;  3H3I A;  4HPD A;  1CJ5 A;  3NQ3 A;  2CAM A;  1LDQ A;  2WSJ A;  3SOT A;  3PK2 A;  3CKF A;  5H8T A;  5H9L A;  2LBV A;  3SAO A;  1FDQ A;  1YUP A;  1OBU A;  3HWE A;  2PI3 O;  3IA8 A;  3K3L A;  4YCE A;  1VWO B;  3ELZ A;  3FLL A;  3PQU A;  1H91 A;  1W5R A;  4IAX A;  4OS3 A;  2L9C A;  1MM9 A;  3AKM A;  4OS8 A;  4ZH6 A;  4GK9 A;  1JJX A;  1EI5 A;  4NV8 A;  3EW2 A;  3TGA A;  1KXO A;  3KZA A;  4OMW A;  1MVG A;  2RTO B;  4AZP A;  3KFG A;  1E2T A;  4QRL A;  1TW4 A;  1GX8 A;  2N93 A;  1PTS A;  1LIF A;  3P24 A;  4M7M A;  2OFB A;  4I3D A;  1PMP A;  2RTH B;  3RDS A;  1JZU A;  1STS B;  5F2B A;  4YFQ A;  3VHH A;  5HA1 A;  3G7X A;  2JW1 A;  5D4A A;  1FJ1 E;  4BX5 B;  1U0X A;  2HNX A;  4LKT A;  4GU8 A;  2X55 A;  2FRS A;  1LCW A;  4NYQ A;  4IRW A;  2BS6 A;  4DQ3 A;  2QO6 A;  1WBI A;  4ZHF A;  4CV7 A;  4EDE A;  1VWF B;  4NLJ A;  1VWE B;  1QY2 A;  3T6F A;  2W2A A;  1HQQ A;  2LA7 A;  2MM3 A;  2DJG A;  3LTW A;  5FAZ A;  4YDB A;  1EPB A;  1VYO A;  1ML7 A;  1YIV A;  3HPE A;  4MVI A;  2A8G A;  1EW3 A;  2A2G A;  4YBU A;  4CPH A;  4BX6 A;  2YMS A;  1B0O A;  3C78 X;  1SWS A;  3FR2 A;  1HBP A;  2KTS A;  1CBI A;  1T0V A;  2A2U A;  1VWB B;  2MWH A;  4IMN A;  1MX7 A;  1SWQ A;  1LIC A;  1Z24 A;  3BX7 A;  1NGL A;  5DG4 A;  1SWP A;  1SLD B;  3GAQ A;  2AT6 X;  4CDD A;  1YWC A;  2CZU A;  3GE2 A;  2A0A A;  3PP6 A;  1X8N A;  2IZB A;  2NNQ A;  3ZI8 A;  1VWG B;  4QZU A;  1I04 A;  1LIE A;  3V8U A;  5IXG A;  1PBO A;  2HLV A;  1HQP A;  3OE3 A;  4IB7 A;  3DTQ A;  2OFR X;  4OEL A;  4EKV A;  3LHN A;  1XKI A;  4ML7 B;  2IZK A;  5HZQ A;  3WJB A;  2FT9 A;  1AVD A;  2MF6 A;  4Y5D A;  2R74 A;  4CPE A;  2ZSC A;  2FKJ A;  2OY1 O;  2QO5 A;  2I5V O;  4O4S A;  2CBR A;  4GGR A;  2K62 A;  4TKB A;  1LPJ A;  1LUQ A;  4ARH A;  3CQR A;  2X56 A;  4D6B A;  2GH7 A;  1NBX A;  1MOY A;  5LJK A;  3EBW A;  1WUB A;  4U8U O;  1QWD A;  3D4R A;  1HXZ A;  4GJS A;  1KT3 A;  4PSQ A;  2NND A;  1SLG B;  4A60 A;  3VG2 A;  2IZF B;  4TLJ A;  4ZFX A;  1B4M A;  1GKA A;  4ZR2 A;  1Y9L A;  3B2J A;  4IB8 A;  3RKG A;  1DZP A;  2G78 A;  5B29 A;  1HXL A;  1UYN X;  3S5V A;  1SLE B;  4YCH A;  2ACO A;  1KQX A;  4JO6 A;  1SWA A;  2AVI A;  3D9W A;  4O3Z A;  3ZZV A;  1XCA A;  1TOW A;  4CDE A;  5IO6 A;  1P6P A;  2KD2 A;  3SLO A;  3WBG A;  1JQP A;  1VWK B;  5LKF A;  3FEL A;  2LKK A;  2ZAG A;  2RTJ A;  1MUP A;  1SY3 A;  3APW A;  4GE1 A;  5CSE A;  4CPI A;  4Z2V A;  3C77 X;  1DV9 A;  1RBP A;  2MO5 A;  2RD7 C;  1BRQ A;  5IO5 A;  1LKE A;  4Y0Q A;  2VFB A;  1ALB A;  1RST B;  2I5Z O;  2JGS A;  4IAB A;  4L3R A;  5F7G A;  3T6L A;  1BSY A;  2YG2 A;  2CM4 A;  4BOE A;  1RXH A;  4GRJ A;  1LFO A;  3BSZ E;  4MIS A;  3SLJ A;  1U17 A;  1RSU B;  2CZT A;  4AZM A;  1MK5 A;  1YP7 A;  3VPJ E;  3EM0 A;  4C5P A;  3LV4 A;  4KC7 A;  3FW4 A;  2GTF X;  4ZCB A;  1SXW A;  5B2A O;  1BM5 A;  1TVQ A;  1JYD A;  1O8V A;  1I9H A;  2IZE B;  4IB6 A;  4NLI A;  1E00 A;  1SWB A;  3RWX A;  1A18 A;  1SWE A;  4GDA A;  3ZUO A;  4ZHD A;  1GT3 A;  3WYQ A;  3WZO A;  4A1H A;  4YH0 A;  1IFB A;  1A3Y A;  1IW2 A;  1ZNH A;  3I0A A;  3FW5 A;  4YFR A;  1E5P A;  3CBC A;  3AUM O;  4CSB A;  2RN4 A;  4AZN A;  4NNT A;  1VWC B;  2X46 A;  4GJV A;  3AEH A;  4I95 A;  4KH8 A;  4LZV A;  4CDC A;  5CE4 A;  3EC5 A;  4KT5 A;  3BS2 A;  1D3S A;  1S44 A;  1SWG A;  3APX A;  3FR5 A;  5HZ8 A;  1KZX A;  5D47 A;  1EPA A;  4CDF A;  1TXL A;  1EII A;  3RDQ A;  2ZAI A;  1DZM A;  1DF8 A;  1ZNK A;  3RSW A;  5B3M O;  4FBV A;  2OYB O;  3ZWE A;  5LJH A;  2X8S A;  4YVB A;  3HWF A;  4ORY A;  2X8T A;  3VU1 A;  2AT0 X;  1QFT A;  4GZV A;  2ASN X;  1EAL A;  3CQN A;  4NW4 A;  1KQW A;  1N0S A;  2AMM X;  1AVG I;  1FEN A;  2X34 A;  3FA7 A;  4ODD A;  3WJE A;  4ZHC A;  4TKH A;  2QMI A;  2P8G A;  1VWA B;  2WUT A;  3VG5 A;  2RQ0 A;  2Y3E A;  3STM X;  4AZQ A;  3U03 A;  3ZW1 B;  3TGB A;  2G79 A;  1RLB E;  2JU8 A;  4YGZ A;  4I60 A;  4N7C A;  4XME A;  4GNW A;  3HTY A;  2Y3F A;  1SWD A;  2JOZ A;  1NP1 A;  2AT5 X;  3NQ9 A;  4OMX A;  4UU2 A;  3E3C A;  1SWJ A;  1PEE A;  4BGF A;  4U46 A;  1G5W A;  1O1U A;  2HMB A;  2WEX A;  4Y0P A;  5FQ8 E;  4MEE A;  5HA0 A;  4NV7 A;  1SRF A;  1QG5 A;  4HPA A;  1R0U A;  3S26 A;  1I78 A;  4LZU A;  4ZH9 A;  2OVE A;  1VWH B;  2A5B A;  2RTL A;  4Z2O A;  4YKO A;  3B2H A;  3KQ0 A;  2OY7 A;  5D48 A;  2G8C O;  2RTI B;  3KFI A;  4XMF A;  4ORU A;  2RTD B;  1EIO A;  1ERB A;  1DZK A;  2AT3 X;  3P6E A;  3PH5 A;  4BCS A;  3PDF A;  3WZP A;  1DF3 A;  4I6S A;  5F6Z A;  5HBS A;  3T2W A;  1ZNG A;  3RY2 A;  4L1N A;  1JMX A;  1N9M A;  1TOU A;  2GTL O;  2F73 A;  4IB9 A;  4OS0 A;  1SWC A;  3UAQ A;  4EEJ A;  3WOV A;  4BX5 A;  2R73 A;  1KOI A;  1VWQ B;  1OPA A;  2KT4 B;  4GH7 A;  1YWD A;  2OFM X;  1DFV A;  1RAV A;  2OL8 O;  2RTP B;  5EPQ A;  3P02 A;  1JJU A;  1I06 A;  4TNN A;  4U8U N;  4Y59 A;  1X8U A;  3HOE A;  2RTM A;  1ERX A;  1SWU A;  2IZH B;  5IRW A;  4D6A A;  3NBX X;  1KT5 A;  3RE5 A;  3SZH A;  3U9P C;  1BEB A;  3X00 A;  5IRU A;  3HWD A;  5HCC C;  3WJD A;  3S60 A;  1SA8 A;  5EDB A;  1W4T A;  4TKJ A;  3P6D A;  3CKG A;  2IZI A;  3OJY C;  2L68 A;  5BVQ A;  2KTD A;  3MX7 A;  3NR3 A;  3WZQ A;  4ZGU A;  3APV A;  5BYP A;  1SWO A;  4O49 A;  3FEP A;  1GX9 A;  2RTA A;  4WFU A;  3STN A;  2RCT A;  4Z6J A;  5K67 A;  1LF7 A;  1X8O A;  2F09 A;  3NX2 A;  3Q6L A;  5AQ6 A;  5LJD A;  1LID A;  1NP4 A;  2POA A;  3FA6 A;  4GGZ A;  3APU A;  3STK A;  1SWT A;  1OEJ A;  4O4O A;  5F58 A;  1D2U A;  2RTB B;  3PH6 A;  5LJG A;  4WHI A;  2E4J A;  3ZUI A;  1AB0 A;  5EED A;  3B2L A;  1KFF A;  1B56 A;  1O1V A;  4ON1 A;  1VPR A;  4IAW A;  5HZ9 A;  2HZQ A;  1OEE A;  5K68 A;  2MJI A;  1NQN A;  1L6M A;  3HK1 A;  4HFO A;  1CRB A;  1SWF A;  2F01 A;  5FQ7 E;  1SY0 A;  2X32 A;  3WZN A;  5HWZ A;  3O2Y A;  2A3F X;  3UEV A;  1Y55 X;  1N7Y A;  2OVD A;  2RTN B;  4U3Q A;  4B55 A;  4ZJ0 A;  2CM9 A;  3RDO A;  2NNE A;  2UYW A;  1CBR A;  2IFB A;  4GD9 A;  1VWN B;  3EW1 A;  2HYS A;  3T2X A;  1KGL A;  4ID2 A;  4YDA A;  5FQ6 E;  2K23 A;  1BSO A;  3VGW A;  2GTL M;  1KL4 A;  2C4I A;  4I3B A;  3RY1 A;  2HKD A;  1S7D A;  1X89 A;  1PBY A;  2QM9 A;  5B11 O;  4ZHH A;  1SXY A;  3WYP A;  1SRJ A;  3CMP A;  4AYH A;  5BVT A;  2QCB A;  1N43 A;  1A57 A;  1I4U A;  1EXS A;  1A2D A;  2Q39 A;  4LQZ A;  3P6H A;  3FIQ A;  1BRP A;  3KVN A;  5LJB A;  2BS5 A;  3JS1 A;  2IZA A;  4WFV A;  4EXZ A;  4KII A;  5KHP A;  2ANS A;  1SXX A;  2X45 A;  1QAB E;  3MM0 A;  3OD9 A;  5L3Y A;  3P6C A;  4FBO A;  4QQ1 A;  2OF8 A;  1G85 A;  4O9S A;  1YWB A;  4CK4 A;  1U18 A;  3NPO A;  1HBQ A;  1X8Q A;  5H9A A;  3AKN A;  5B5G A;  4XMH A;  3T1D A;  5B10 O;  3B2K A;  2X8F A;  4I9R A;  4IMO A;  5H9N A;  4AW8 A;  2L67 A;  3DSZ A;  4O3W A;  4PJ2 A;  2BSZ A;  2BT9 A;  3ZW0 B;  2WWP A;  2M4L A;  1VWP B;  4ES7 A;  2DJF A;  4AZO A;  1KL5 A;  1JYJ A;  1B8E A;  1HMR A;  1LEL A;  4JNJ A;  3D95 A;  4IBA A;  2W2B A;  4U9C A;  5HZ6 A;  4O3X B;  1NQM A;  2JMB A;  3O19 A;  2OY8 A;  3RE6 A;  5EDC A;  4O4U A;  4BX7 B;  1MEP A;  4COT A;  1SWL A;  4GDZ A;  5IRA A;  3FYF A;  2GC9 A;  1OEK A;  3BLG A;  1KL3 A;  3SZI A;  2WEW A;  5HCE C;  2WQ9 A;  1QY1 A;  3TZS A;  4ORR A;  1S2P A;  1SY2 A;  2XKL A;  4JGL A;  3VG3 A;  4GKC A;  4N7D A;  5K06 A;  4GNY A;  1JJJ A;  1YWA A;  4I3C A;  1IJ8 A;  1K24 A;  1FTP A;  4FQB B;  3BRN A;  3B2I A;  1BLR A;  2IZC B;  5CYB A;  3MVF A;  2OF9 A;  3UEW A;  4R0B A;  3HOL A;  2OL7 A;  2BLG A;  3ZW2 A;  4GUZ A;  2FHN X;  3MG5 A;  5D8J A;  1FE3 A;  1K3B A;  1X8P A;  3O22 A;  5LKE A;  3MBT A;  4M6S A;  4OEM A;  4ZGF A;  4FGI B;  2RTR B;  2C1S A;  5D45 A;  2G5L A;  3D96 A;  1DZJ A;  4A1Y A;  3I17 A;  4MVE A;  1ACD A;  4K19 A;  4YGG A;  3FDC A;  1LIB A;  5EZ2 A;  2OVA A;  4Z28 A;  1QY0 A;  2OL6 O;  3TF6 A;  2L5P A;  2AKQ A;  2FR3 A;  3D97 A;  1GM6 A;  1BBP A;  2JU3 A;  3JSQ A;  3OBL A;  4Y0R A;  3PPT A;  1IKE A;  1LCZ A;  1OBP A;  1Y9T A;  2A13 A;  3F6Z B;  4HWM A;  3S5X A;  2BHV A;  1PM1 X;  4YGH A;  1FEM A;  5FFH A;  1ADL A;  2XST A;  1AVE A;  1GXA A;  2FGS A;  1NDJ A;  2FS7 A;  3FEN A;  4Y0S A;  1LNM A;  4AZR A;  1T8V A;  1LCV A;  4QYP A;  3VG7 A;  5EEE A;  5CHK A;  1ZND A;  1SRI A;  2RTE B;  2W2F A;  4XMC A;  1KT4 A;  1YP6 A;  5JD2 A;  5KID A;  5HTE A;  3KFH A;  4BQU A;  3BU1 A;  4CPH B;  1LDO A;  3P6F A;  2RTG B;  1GX3 A;  2Q2M A;  1QFV A;  4BJ8 A;  4BX6 B;  1VWM B;  4EQA C;  5C0N A;  5JR8 A;  2RTF B;  1GT4 A;  1VWD B;  2FHL A;  5AJC A;  4BBO A;  4QGV A;  4QNI A;  1IFC A;  1JBH A;  3NAD A;  1QQS A;  3CWK A;  1KT6 A;  4ALB A;  4UU3 A;  4GGT A;  5BVS A;  2OVS A;  3CR6 A;  3BU9 A;  2ACP X;  3VE1 A;  5IO7 A;  4ORS A;  1JV4 A;  3NP1 A;  3NQK A;  3FID A;  3NX1 A;  4HPB A;  4OKA A;  2VDF A;  1ICN A;  1GT5 A;  1ZNE A;  1ZNL A;  1GGL A;  3BDR A;  3FMZ A;  5HCD C;  2OFA A;  1AQB A;  2Q9S A;  4RUU A;  4Z27 A;  3U0D A;  1N4J A;  2FTB A;  5FEN A;  1VYF A;  2IZD B;  3VG6 A;  4A8Z A;  1KZW A;  2FR2 A;  1SWH A;  4HPC A;  1Y0G A;  1UZ2 X;  5L8O A;  4I9S A;  3VHM A;  5L8I A;  1SRG A;  2OZQ A;  1BSQ A;  2AF5 A;  4ALO A;  5HZ5 A;  1T68 X;  2C1Q A;  4JHQ A;  2LBA A;  2AL0 X;  5AEO A;  1SWR A;  2JU7 A;  5LJE A;  2QOM A;  4MVL A;  2OY5 O;  5HTD A;  1GKA B;  2GJ5 A;  2ALL X;  3BY0 A;  3QQ2 A;  3P6G A;  2RTQ B;  2FWV A;  5DPQ A;  3FR4 A;  3ELX A;  2VFC A;  4QGW A;  5F1E A;  4ORW A;  2FLJ A;  1MDC A;  4O4X A;  2O62 A;  2RCQ A;  4NNS A;  3UEX A;  3RBY A;  1G7N A;  1HMS A;  4QZT A;  2AH7 X;  3Q34 A;  3WXQ A;  4CPF A;  1EUO A;  1IIU A;  3F9D A;  4WBK A;  1DC9 A;  1VYG A;  2KW1 A;  2RTK A;  4KCA A;  3SLT A;  2Z4H A;  1HMT A;  1SMP I;  2JN3 A;  3FA9 A;  4XMD A;  3EBK A;  4Z2P A;  3WVM A;  1EQD A;  3PEC A;  4MIR A;  3TGC A;  1OSP O;  1CBQ A;  1SLF B;  4YFP A;  3RZY A;  2Y32 A;  1NC9 A;  4QAE A;  3WJC A;  1ZRY A;  4ORX A;  4QYN A;  1URE A;  3EMM A;  1I05 A;  3ZQ3 A;  5AJB A;  1JMZ A;  2NP1 A;  2AT8 X;  5B27 A;  3RDU A;  1CBS A;  1X71 A;  3HWG A;  4KC8 A;  4LKP A;  1RXJ A;  1SXU A;  1HN2 A;  2Q4N A;  1Y52 X;  4XMG A;  2PY1 A;  3RDX A;  2G7B A;  3VE2 A;  4YMY A;  3RDM A;  2CBS A;  3BX8 A;  4EFG A;  1ICM A;  4DCB A;  3VHI A;  1G74 A;  2R56 A;  4MVK A;  5HAE A;  1JIW I;  2Q2P A;  2X4M A;  3FEK A;  5L8N A;  1OBQ A;  2QOS C;  4RUN A;  3KFF A;  4FBR A;  1E06 A;  1SRH A;  2HZR A;  1BJ7 A;  2EU7 X;  1KT7 A;  1UYO X;  2LB6 A;  2RA6 A;  2UZ2 A;  1RXK A;  1HY2 A;  1IKJ A;  1W6F A;  3WJF A;  3PED A;  4BVM A;  4NYR A;  1GT1 A;  2Z4I A;  1SWN A;  3C76 X;  3PQS A;  3QKG A;  2FKG A;  5H9K A;  3VG4 A;  3JQO A;  3ZW0 A;  1AEL A;  4YBP A;  2WR6 A;  3F8A A;  1BWY A;  2WPU A;  1VWI B;  4NP1 A;  4QGX A;  2RTC B;  1VWR B;  2GTL N;  5KIC A;  1SWK A;  3SZJ A;  5F6B A; 
#chains in the Genus database with same CATH homology
 3UEU A;  1FEL A;  3ZW1 A;  3L4R A;  4ZHG A;  2FS6 A;  3EYC A;  1MX8 A;  2MHD A;  1SY1 A;  4GET A;  4DQ4 A;  3WJG A;  4TQ2 A;  2QO4 A;  2LFO A;  3FA8 A;  2DM5 A;  3IFB A;  4TJZ A;  4U8U M;  4INN A;  1E02 A;  4O3Y A;  1OPB A;  4YKM A;  5LJC A;  3N91 A;  3CBS A;  4HPD A;  2WQA E;  3H3I A;  1CJ5 A;  3NQ3 A;  2WSJ A;  3SOT A;  5H9L A;  5H8T A;  2LBV A;  3SAO A;  1FDQ A;  1YUP A;  1OBU A;  3HWE A;  3IA8 A;  3K3L A;  4YCE A;  4YFQ A;  3FLL A;  3ELZ A;  3PQU A;  4IAX A;  1H91 A;  4OS3 A;  2L9C A;  3AKM A;  4OS8 A;  4ZH6 A;  1JJX A;  4GK9 A;  1EI5 A;  3TGA A;  1KXO A;  3KZA A;  4OMW A;  1MVG A;  4AZP A;  3KFG A;  4QRL A;  4EDE A;  1TW4 A;  1GX8 A;  2N93 A;  3P24 A;  1LIF A;  4M7M A;  4I3D A;  1PMP A;  1JZU A;  5HA1 A;  3G7X A;  2JW1 A;  5D4A A;  1U0X A;  2HNX A;  4LKT A;  4GU8 A;  2FRS A;  4NYQ A;  4ZHF A;  2BS6 A;  4DQ3 A;  2QO6 A;  4CV7 A;  4NLJ A;  1QY2 A;  2W2A A;  2LA7 A;  2MM3 A;  5FAZ A;  4YDB A;  1EPB A;  1ML7 A;  1YIV A;  4MVI A;  1EW3 A;  2A2G A;  4YBU A;  2YMS A;  1B0O A;  3C78 X;  3FR2 A;  4IMN A;  2MWH A;  1HBP A;  1CBI A;  1T0V A;  2A2U A;  2KTS A;  1MX7 A;  1Z24 A;  1LIC A;  3BX7 A;  1NGL A;  5DG4 A;  3GAQ A;  2AT6 X;  1YWC A;  2CZU A;  3GE2 A;  2A0A A;  3PP6 A;  1X8N A;  2NNQ A;  3ZI8 A;  1DF3 A;  4QZU A;  1I04 A;  1LIE A;  3V8U A;  1PBO A;  2HLV A;  1HQP A;  3OE3 A;  4IB7 A;  3DTQ A;  2OFR X;  3LHN A;  1XKI A;  4ML7 B;  5HZQ A;  3WJB A;  2FT9 A;  2R74 A;  2QO5 A;  4O4S A;  2CBR A;  2K62 A;  4TKB A;  1LPJ A;  4ARH A;  3CQR A;  4D6B A;  5LJK A;  3EBW A;  4U8U O;  1QWD A;  3D4R A;  4PSQ A;  1KT3 A;  4A60 A;  2NND A;  3VG2 A;  4TLJ A;  4ZFX A;  1B4M A;  1GKA A;  4ZR2 A;  1Y9L A;  3B2J A;  4IB8 A;  3RKG A;  1DZP A;  2G78 A;  5B29 A;  3S5V A;  4YCH A;  2ACO A;  1KQX A;  5IO6 A;  4O3Z A;  3ZZV A;  1XCA A;  1TOW A;  1P6P A;  2KD2 A;  3WBG A;  5LKF A;  3FEL A;  2LKK A;  2ZAG A;  3APW A;  1MUP A;  1SY3 A;  4GE1 A;  3C77 X;  1DV9 A;  1RBP A;  2MO5 A;  2RD7 C;  1BRQ A;  5IO5 A;  1LKE A;  4Y0Q A;  1ALB A;  4IAB A;  4L3R A;  5F7G A;  1BSY A;  2YG2 A;  2CM4 A;  4BOE A;  4GRJ A;  1LFO A;  3BSZ E;  4MIS A;  1U17 A;  4AZM A;  2CZT A;  3VPJ E;  1YP7 A;  3EM0 A;  3LV4 A;  4KC7 A;  3FW4 A;  2GTF X;  4ZCB A;  1SXW A;  1BM5 A;  1TVQ A;  1JYD A;  1O8V A;  4IB6 A;  4NLI A;  1E00 A;  3RWX A;  3ZUO A;  1A18 A;  4ZHD A;  1GT3 A;  4A1H A;  4YH0 A;  1IFB A;  1A3Y A;  1IW2 A;  1ZNH A;  3I0A A;  3FW5 A;  4YFR A;  1E5P A;  3CBC A;  4CSB A;  2RN4 A;  4AZN A;  4NNT A;  2X46 A;  5CE4 A;  4KH8 A;  4LZV A;  4I95 A;  5HZ8 A;  4KT5 A;  3BS2 A;  1D3S A;  1S44 A;  3FR5 A;  3APX A;  1KZX A;  5D47 A;  1EPA A;  1EII A;  1TXL A;  2ZAI A;  1DZM A;  1ZNK A;  3RSW A;  3ZWE A;  5LJH A;  4FBV A;  2X8S A;  3HWF A;  4ORY A;  2X8T A;  3VU1 A;  2AT0 X;  1QFT A;  4GZV A;  2ASN X;  1EAL A;  3CQN A;  4NW4 A;  1KQW A;  1N0S A;  2AMM X;  1AVG I;  1FEN A;  3FA7 A;  4ODD A;  3WJE A;  4ZHC A;  4TKH A;  2QMI A;  2P8G A;  2WUT A;  3VG5 A;  3TGB A;  2RQ0 A;  4AZQ A;  3STM X;  3ZW1 B;  2G79 A;  1RLB E;  2JU8 A;  4YGZ A;  4N7C A;  4XME A;  4GNW A;  3HTY A;  2JOZ A;  1NP1 A;  2AT5 X;  3NQ9 A;  4OMX A;  4UU2 A;  3E3C A;  1PEE A;  1G5W A;  1O1U A;  2HMB A;  2WEX A;  4Y0P A;  5FQ8 E;  5HA0 A;  1QG5 A;  4HPA A;  1R0U A;  3S26 A;  4LZU A;  4ZH9 A;  2OVE A;  4YKO A;  3B2H A;  3KQ0 A;  5D48 A;  3KFI A;  4XMF A;  4ORU A;  1EIO A;  1ERB A;  1DZK A;  2AT3 X;  3P6E A;  3PH5 A;  4I6S A;  5F6Z A;  5HBS A;  1ZNG A;  4L1N A;  4EEJ A;  2GTL O;  1TOU A;  4IB9 A;  2F73 A;  4OS0 A;  3UAQ A;  3WOV A;  2R73 A;  1KOI A;  5DPQ A;  1OPA A;  2KT4 B;  4GH7 A;  1YWD A;  2OFM X;  1DFV A;  5EPQ A;  3P02 A;  4TNN A;  1I06 A;  4U8U N;  1X8U A;  3HOE A;  1ERX A;  4D6A A;  3NBX X;  1KT5 A;  3U9P C;  5HCC C;  1BEB A;  3HWD A;  3WJD A;  3S60 A;  1SA8 A;  5EDB A;  4TKJ A;  3P6D A;  3OJY C;  2L68 A;  5BVQ A;  2KTD A;  3MX7 A;  3NR3 A;  4ZGU A;  3APV A;  5BYP A;  4O49 A;  3FEP A;  1GX9 A;  4WFU A;  3STN A;  2RCT A;  1LF7 A;  1X8O A;  2F09 A;  3NX2 A;  3Q6L A;  5AQ6 A;  5LJD A;  1LID A;  2POA A;  1NP4 A;  3FA6 A;  3APU A;  3STK A;  1OEJ A;  4O4O A;  5F58 A;  1D2U A;  3PH6 A;  5LJG A;  4WHI A;  2E4J A;  3ZUI A;  1AB0 A;  5EED A;  3B2L A;  1B56 A;  1O1V A;  4ON1 A;  1VPR A;  4IAW A;  5HZ9 A;  2HZQ A;  1OEE A;  2MJI A;  1L6M A;  3HK1 A;  4HFO A;  1CRB A;  5FQ7 E;  5HWZ A;  1SY0 A;  3O2Y A;  2A3F X;  3UEV A;  2OVD A;  4U3Q A;  4ZJ0 A;  2CM9 A;  2NNE A;  1CBR A;  2IFB A;  2HYS A;  1KGL A;  4ID2 A;  4YDA A;  5FQ6 E;  2K23 A;  1BSO A;  2GTL M;  4I3B A;  1S7D A;  1X89 A;  2QM9 A;  4ZHH A;  1SXY A;  3CMP A;  4AYH A;  5BVT A;  1A57 A;  1I4U A;  1EXS A;  1A2D A;  2Q39 A;  4LQZ A;  3P6H A;  3FIQ A;  1BRP A;  5LJB A;  2BS5 A;  3JS1 A;  4WFV A;  4EXZ A;  4KII A;  5KHP A;  2ANS A;  1SXX A;  2X45 A;  1QAB E;  3OD9 A;  3P6C A;  4FBO A;  4QQ1 A;  1G85 A;  4O9S A;  1YWB A;  4CK4 A;  1U18 A;  3NPO A;  1HBQ A;  1X8Q A;  5H9A A;  3AKN A;  4XMH A;  3T1D A;  3B2K A;  2X8F A;  4I9R A;  4IMO A;  5H9N A;  4AW8 A;  2L67 A;  3DSZ A;  4O3W A;  4PJ2 A;  2BT9 A;  3ZW0 B;  2WWP A;  2M4L A;  4ES7 A;  4AZO A;  1JYJ A;  1B8E A;  1HMR A;  3D95 A;  4IBA A;  2W2B A;  4U9C A;  5HZ6 A;  4O3X B;  2JMB A;  3O19 A;  5EDC A;  4O4U A;  4COT A;  4GDZ A;  3FYF A;  2GC9 A;  1OEK A;  3BLG A;  2WEW A;  5HCE C;  2WQ9 A;  1QY1 A;  3TZS A;  4ORR A;  1S2P A;  1SY2 A;  2XKL A;  4JGL A;  3VG3 A;  4GKC A;  4N7D A;  5K06 A;  4GNY A;  1JJJ A;  1YWA A;  4I3C A;  1FTP A;  4FQB B;  3BRN A;  3B2I A;  1BLR A;  5CYB A;  3MVF A;  3UEW A;  4R0B A;  3HOL A;  3ZW2 A;  2BLG A;  5D8J A;  1FE3 A;  1X8P A;  3O22 A;  5LKE A;  3MBT A;  4M6S A;  4ZGF A;  4FGI B;  5D45 A;  3D96 A;  1DZJ A;  4A1Y A;  3I17 A;  4YGG A;  1ACD A;  4K19 A;  1LIB A;  5EZ2 A;  2OVA A;  1QY0 A;  3TF6 A;  2L5P A;  2AKQ A;  2FR3 A;  3D97 A;  1GM6 A;  1BBP A;  2JU3 A;  3JSQ A;  3OBL A;  4Y0R A;  3PPT A;  1IKE A;  1Y9T A;  1OBP A;  2A13 A;  3F6Z B;  4HWM A;  3S5X A;  2BHV A;  1PM1 X;  4YGH A;  1FEM A;  5FFH A;  1ADL A;  2XST A;  1GXA A;  2FS7 A;  4Y0S A;  3FEN A;  4AZR A;  1LNM A;  1T8V A;  4QYP A;  3VG7 A;  5EEE A;  1ZND A;  4XMC A;  2W2F A;  1KT4 A;  1YP6 A;  5KID A;  5HTE A;  3KFH A;  4BQU A;  3BU1 A;  3P6F A;  2Q2M A;  1QFV A;  4EQA C;  5JR8 A;  1GT4 A;  5AJC A;  4QGV A;  4QNI A;  1IFC A;  1JBH A;  3NAD A;  1QQS A;  3CWK A;  1KT6 A;  4ALB A;  4UU3 A;  5BVS A;  2OVS A;  3CR6 A;  3BU9 A;  2ACP X;  3VE1 A;  5IO7 A;  4ORS A;  1JV4 A;  3NP1 A;  3NQK A;  3NX1 A;  4HPB A;  1ICN A;  1GT5 A;  1ZNE A;  1ZNL A;  1GGL A;  3BDR A;  3FMZ A;  5HCD C;  2Q9S A;  1AQB A;  3U03 A;  4RUU A;  3U0D A;  2FTB A;  5FEN A;  1VYF A;  3VG6 A;  4A8Z A;  1KZW A;  2FR2 A;  4HPC A;  1UZ2 X;  5L8O A;  4I9S A;  5L8I A;  2OZQ A;  1BSQ A;  4ALO A;  5HZ5 A;  1T68 X;  2LBA A;  2AL0 X;  5AEO A;  2JU7 A;  5LJE A;  4MVL A;  5HTD A;  1GKA B;  2GJ5 A;  2ALL X;  3BY0 A;  3P6G A;  2FWV A;  3FR4 A;  3ELX A;  5F1E A;  4QGW A;  4ORW A;  2FLJ A;  1MDC A;  4O4X A;  2O62 A;  2RCQ A;  4NNS A;  3UEX A;  3RBY A;  1G7N A;  1HMS A;  4QZT A;  2AH7 X;  3WXQ A;  1EUO A;  1IIU A;  3F9D A;  4WBK A;  1DC9 A;  1VYG A;  2KW1 A;  4KCA A;  2Z4H A;  1HMT A;  1SMP I;  2JN3 A;  3FA9 A;  4XMD A;  3EBK A;  3WVM A;  1EQD A;  3PEC A;  4MIR A;  3TGC A;  1CBQ A;  3RZY A;  4YFP A;  4QAE A;  3WJC A;  1ZRY A;  4ORX A;  4QYN A;  1URE A;  3EMM A;  1I05 A;  3ZQ3 A;  5AJB A;  2NP1 A;  2AT8 X;  5B27 A;  1CBS A;  1X71 A;  3HWG A;  4KC8 A;  4LKP A;  1SXU A;  4XMG A;  1HN2 A;  2Q4N A;  5C0N A;  2PY1 A;  2G7B A;  3VE2 A;  4YMY A;  2CBS A;  3BX8 A;  4EFG A;  1ICM A;  1G74 A;  2R56 A;  4MVK A;  5HAE A;  1JIW I;  2Q2P A;  3FEK A;  5L8N A;  1OBQ A;  2QOS C;  4RUN A;  3KFF A;  4FBR A;  1E06 A;  2HZR A;  1BJ7 A;  2EU7 X;  1KT7 A;  2LB6 A;  2RA6 A;  1IKJ A;  3WJF A;  3PED A;  4BVM A;  4NYR A;  1GT1 A;  2Z4I A;  3C76 X;  3PQS A;  3QKG A;  5H9K A;  3ZW0 A;  3VG4 A;  3JQO A;  1AEL A;  4YBP A;  2WR6 A;  3F8A A;  1BWY A;  4NP1 A;  4QGX A;  5KIC A;  2GTL N;  4MVE A;  5F6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...