5HXHA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with zero na+ and ca2+
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
293
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 116
structure length 293
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxhA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxhA02
5JDFA 5HXCA 5HXSA 5HXEA 5JDNA 5HXHA 5JDLA 5JDMA 5HWXA 5JDGA 5JDHA 5JDQA 5HWYA 5HYAA 3V5UA 5HXRA 3V5SA
chains in the Genus database with same CATH superfamily
4U7YA 4BAYB 2EHOC 2IDOB 3AY5A 5FY0A 2E9XA 4ILUA 2LEHA 2YN6A 1T8BA 2N1GA 3ZC1A 5LJNA 3PUZF 3VJZA 5DJQC 1JNRA 5HEOA 2XQ9A 2E9XB 5CA0E 3ZPOA 3HKBE 3U3IA 2CLYB 3GA8A 3AE6A 2MTCA 3AE3A 5HCJA 3LJCA 1M7KA 2UXBT 2XY8B 2X9WA 3EABA 2WAUA 4P1NA 3MJXA 4ZI3D 2W2UA 3RIUA 3RQUA 4YFSA 2HN1A 4GYRA 2LKHA 1OWAA 5AQTB 3ZMUB 4MBQA 1H7CA 3TLUA 3AE7A 4LFBT 2JQKA 3SFDA 4DIDB 3KFWX 2HH7A 3VR9A 4IDPA 2LHNA 5C8YE 5EK3A 2ACZA 4BA9A 2NW7A 2WB5A 1E7PA 3AE5A 3CIRA 3I1AA 3AEAA 2X68A 2L7NA 4ADZA 3FB2A 1UGOA 2LSYA 2N9DA 1IJ5A 3SRZA 2LM9A 4JYAT 4QXHB 4HEAA 2WZHA 4NXMT 2NW9A 4JV5T 4UR9A 3DTOA 4LF7T 2JQ9A 3KVBA 1IZNB 3N9OA 2QA7A 2VKHA 2BVMA 4H9QC 2KXPB 1UX5A 2XQAA 4GKKT 5FXWA 4EIWA 3C4ZA 4XZCA 2VK9A 3RKGA 2D9DA 2KINB 4X20E 2EHOD 4KBMB 4EB6E 3VHLA 3FZFB 4GK0E 4CN4A 3B5MA 4L0RA 1MIWA 3EUHA 4PAGA 2XQ6A 3VU7H 2X9YA 4NPPA 5L47A 2YDRA 4ZZBA 2V7JA 5AQQB 4TX5A 2BG9E 1D0ZA 3JADA 2YINA 4AKHA 3CWZB 1X79A 3QB5A 2C0SA 3ABVA 2CRBA 4AISA 4HWHA 2XAJB 2LJLA 2DL1A 2BBJA 3SWHA 4AQFA 2XQ7A 1SHZC 5F3JA 3P4QA 4IE5A 3UUBA 2YEVC 2H89A 4CI2B 3CX6B 4HWCA 5HWYA 3CQGB 3ZMZB 3EHZA 3UFEA 3QOFA 4NUUA 4IGUA 2WCAA 5ETWA 4WNKA 1WFDA 2VURA 5KDMC 2AXDS 4JLEA 3A8YC 4EGWA 3OYXA 4DR5T 2CEAA 3OKQA 5GONE 4G63A 4H63H 2QVAA 1OXZA 1HFAA 4CN6A 5BMVE 3LSVA 5L3CB 1QUUA 3RYCE 2CCQA 2OV9A 4HFIA 3RH3A 4CZZB 2EHOA 4IE0A 3ETUA 3RRWA 3AEDA 5KXJA 4MALA 4IHJE 2H7VC 2Y48B 1L0VA 2C5JA 2LSKA 3TLTA 1Z0PA 5FYMA 4IT4A 5ABEA 3JAFA 5HXHA 1NENA 2XM2A 5FXXA 5DABA 2Y8DA 1WR6A 3JCFA 4FI5A 2LSIA 3ONLC 1Z8UA 2A2FX 2G0UA 1D0XA 2OLTA 3ZMSB 2ODUA 2Q9QC 2X0HA 4DR6T 4DV0T 5LYJE 3AECA 4OK0A 2XQ4A 5LMUT 5BR8T 2X9HA 3C50A 4C91A 2A9UA 3M3ZB 3C51A 1B7TA 1UK5A 3H3AA 4JEUB 3Q5DA 4PW8A 5IHYA 3KINB 5F5WA 1QSDA 4OHFA 1S94A 3A7MA 2C5IT 4ZEYA 1U5PA 3HR0A 3EAMA 5HEJA 1YD8G 2WZIA 2SPCA 3MA9A 2CA5A 2HPJA 4H9RC 1X9BA 4HWIB 5LB7B 5LHHB 4NXNT 1LRZA 2UUCT 4J2CA 3FBZA 4LMKA 4QX8B 5AQUB 2E5LT 3RIAA 4X1KE 2DWGA 2MOZA 2V7LA 4DO0A 4X1IE 5L3EB 4DV4T 3K3NA 2YU1A 1W9RA 1KK7A 4KX6A 4JI5T 5AQMB 3AEEA 2Z6EA 4YTPA 2MAWA 4QXBB 2XUEA 1SA0E 3D0TA 1UCUA 4ISSA 1KF6A 2LM2A 5IWAT 4IDQA 4YXDA 1NWMX 2LSGA 4F8HA 4B6XA 5JDMA 1MMGA 4AIUA 3ZJ1A 4TV8E 4EOZB 5J2TE 1KFYA 4F6RC 3LBXA 3UQ7A 4U74A 3AT7A 5FY7A 4IE4A 4UV8B 4AI6A 5F8PA 3QUJA 5HXRA 2BKNA 4H63V 1Y64B 2Q9QD 3CPZA 1HS7A 1CUNA 3LBXB 2JMKA 2ES0A 3VRAA 4DR1T 5T1DA 1MNDA 2BG9C 4TNVA 3PHF1 3CQXC 4GOUA 3I0OA 3L8RA 1BR2A 5AQLB 3PUQA 5J0ZA 3PUYF 4EAHA 4NIQA 4PFPA 1YKEB 5J2UE 2H3RA 2K3WA 2IAKA 3C64A 4BJNA 4HFEA 2PG8A 4P0AA 3HKCE 1T72A 4OYJA 3E0ZA 1XDPA 3SS1A 1MMAA 4EXTA 1BR1A 5L4HA 4PK4A 4LFAT 1W09A 4COFA 2WS3A 5LNKA 1FMVA 4GIWA 4PJJA 2LOSA 4UEMA 3PUVF 3RI5A 3O1IA 3F31A 5AFUL 4IL4A 3T1YT 4E7ZA 4AQGA 2VL8A 4X65T 5LP6E 4QH4A 5JR9A 1HNWT 2IMLA 1SE7A 4OX9T 4KP3C 2JRKA 2WU2A 3X1DA 3PUXF 3P50A 4LMLA 4MFRA 5CFBA 5JRCA 3AVRA 4KUMB 3OPCA 3NRXA 2ZMAA 3O4XE 4HKAA 4LF4T 5JR9B 5L4EA 2LHRA 2V26A 2CXLA 5JH7E 3Q5XA 1ZKEA 3C4XA 5JRCB 2CMRA 3Q2MA 3GN5A 4TNWA 2ZM8A 5JDHA 2YKSA 3R6NA 4A98A 2LE8A 1XDOA 3N2GE 4WBOA 3RLFF 2OA5A 2NTXA 1S35A 2AE9A 1HF8A 4JI8T 5AQKB 3GN5B 5LA6E 2WMOA 3I9WA 2A3DA 4AKGA 3TLVA 3AA1B 1BR0A 4IE6A 3RIFA 1D1BA 4Z8XA 5C3JA 2XASB 5KX5E 1XMOT 5HWXA 3FYQA 3PDYA 2XQ8A 4HFCA 2X0YA 4O4HE 5HAXA 4B3ST 3EI0A 3N9NA 4HFBA 3DP7A 5LGTB 3UU5A 3ZSTA 5EK4A 4TWFA 4U33A 2E8IA 2KT9A 1NEKA 4ZI7E 3BQKA 5E0OA 1T7SA 4H9SE 3ZMTB 4DV2T 3ESLA 2BVLA 3HKEE 1R8IA 5FVLA 2J1DG 4DVDA 3AB3B 2HPLA 2CWOA 1D1CA 3UUMA 4IDOA 2PJQA 2PBIA 5AQOB 2D0TA 2JIWA 1OEDA 1G73A 3UULA 1KNZA 4DMVA 1UURA 4QH5A 4UVCB 4A97A 1I6ZA 3FZKB 3EDVA 1KNPA 4YHJA 2F4VT 5LMNT 1EZ3A 2UUBT 3DYJA 4IREA 4ECGA 2CXDA 1OEDB 3CVRA 3IBPA 5H6QB 2I59A 2LRLA 1UX4A 3P4PA 5ABHA 1WR0A 2IIUA 4WBNE 2QGSA 4L5GA 1ZEEA 3SFEA 2ZM2A 5FY1A 1M62A 1DU2A 2DLRA 4W8PA 4AQYT 3GMIA 4CI1B 3A5XA 2WDRA 3RF1A 3SOLA 4TN7B 2V7IA 1XNRT 4YSZA 2JPFA 4UIGA 4HN9A 2B76A 4DNDA 3N9PA 4K0KT 4CXYA 1SJ7A 3PUWF 3Q9DA 3AEBA 2MYSA 3RKOA 3OJAA 3QB5K 3ZSSA 2QYWA 3RC8A 5CB4E 4O8SA 5FZTA 5L3DB 4YJ3E 4BGOA 2R6GF 2XSAA 3VKHA 1SUMB 3NZQA 2RA1A 3AE8A 4N78D 4YTNA 1YKHB 3NVOA 4X62T 5FL1A 3MXZA 1AJ3A 3IEEA 5JTGA 3PUSA 3FZMB 3UTKA 1W0BA 3KVAA 4EEBA 3K3OA 4DUZT 2EHOB 4L9IA 2LLYA 4JI2T 1WCRA 5HXCA 3AVSA 3VR8A 2X51A 2VKOA 5ABGA 2IW5B 1IBMT 4GKJT 3J9X1 1E1HB 4LF5T 3AE1A 4JBWF 3ZT5A 2X9XA 4DMWA 3T1HT 4ONRA 2E9XC 4QWNB 2XTLA 2CE7A 2CLYC 5LHGB 1YXRA 4X66T 1J5ET 3BK9A 2KLQA 4ANJA 4CI3B 2N2NA 2WP9A 3LK2B 3PTRB 3FBLA 3N2KE 4AKIA 3IF8B 1J5WA 3OTOT 5ABFA 3P8CD 3N2OA 4AXPA 4WYVA 1NAFA 2FJAA 2XQYA 3ZN0B 4Q25A 2C5KT 4EZHA 4HFDA 5JREA 3L39A 2ZLYA 5ABFB 1N36T 2JMHA 2M6IA 3LK3B 3RIUC 4P0BA 4DR7T 1FIOA 4GYSA 4JI4T 2J47A 3FZHB 4PJLA 5M4YA 4JI1T 1KEYA 3ZYMA 5A1LA 4EYUA 1Y01A 3ONJA 4HE8A 4YSXA 4UF0A 4XAXB 5JDGA 2UXNB 2XQ3A 2PFVA 2VVNA 2YDQA 4I50E 5KMGP 4U31A 4CN1A 5LXTE 4ERRA 1IBKT 5L2LA 2UXCT 3B13A 4UF0B 4AKLA 1MIVA 2UUAT 2MPKA 3MK7C 3ZEFB 2P9BA 2KWIB 4UV9B 1WYBA 5J1GA 3KV5A 5LGNB 2IUBA 2DHRA 2VKDA 2VQET 5EK2A 3KBTA 4ISTA 3BQIA 4KHZF 3AE2A 5L3BB 4EYYR 4WZXA 5JDFA 2BBHA 1HNXT 3AA0B 2CHOA 5HEHA 2I6HA 4ZOLE 3QK6A 5LJMA 2KWHA 3HI2A 1XZYA 5LHIB 3ANWA 2XAGB 4OYKA 3GWHA 1WLXA 1IBLT 3RPUA 4HWDA 2GK9A 3PURA 2WWUA 2CXFA 2IHR1 4KMCA 3UT5E 3PV0F 4KHPT 2ACXA 1T98A 3ANWB 3W15B 4EZ4A 2FUPA 4DBQA 4O2AE 1HCIA 1SJ8A 4UELA 3LDQB 4IDZA 2BKOA 3WSCA 3F2EA 2YK0A 2MBGA 1I94T 2XSBA 2ODVA 1IAPA 4ZHQE 4ILCA 3LFMA 4AQFC 4HFHA 1ZHCA 3T8OA 2XAFB 2DCFA 2W62A 3UU8A 3ZYLA 2CBIA 2BZBA 4F7GB 2WDQA 3LG7A 4I43B 4ZXLA 2B1EA 5FP3A 5CJ5A 3NBXX 4IL9A 4HGAA 5LG3A 3RX6A 2XZEA 1US7B 2H88A 3TLSA 5JDLA 3RC3A 3MKDA 2V6YA 5CGMA 3O9XA 2E2AA 3S4UA 3F57A 4ZZCA 3FXDB 2J62A 3OBVE 2WBLA 4U7IA 3ZT6A 3E22E 2BS4A 2LOPA 2WM9A 3JAEA 2CBJA 2CWYA 4LF9T 5FVKA 4H9NC 2VVSA 3IHRA 2V6YB 1FEWA 4JEHB 2W4XA 2Q9QA 2V7KA 5HXSA 3L09A 4ILBA 2ZM0A 1ZOYA 4IDNA 3JC6C 4O4IE 3WI3A 3AE4A 1XWMA 4V1Av 2X0LB 2DWKA 2Q9QB 4ZS3A 3QC9A 3FHNA 3ZCIA 1N33T 4K0UA 1BR4A 4CXXA 2BS3A 2RPAA 1LVFA 5AQNB 4EEDA 3FXEB 3I0QA 3AAIA 2W00A 4IE7A 4H9OC 3OYZA 3PJAJ 4TWDA 2V5DA 2PTFA 3TKLB 3AEGA 5HXEA 4TZ4C 5FMNA 4DR4T 1ZP0A 3Q5EA 3U78A 5L3GB 3RRCA 2D0UA 5LBQB 2W67A 5AQJB 3AA7B 5JQGE 2WY2A 3L3PA 4I55E 3V5UA 3DJBA 2XPKA 4LFCT 5FXVA 2VB6A 5EZYE 4G2AA 3ZLIA 1D0YA 3CKDA 2W61A 2VASA 2WMNA 4QH1A 1E2AA 4QHOA 4PJNA 5TAOA 4B3MT 3P4SA 4YT0A 1W0AA 2XQ5A 2CPTA 3RGLA 3UU4A 3ZN1B 3ZKRA 3UQ4A 2MTQA 2V7MA 4QKNA 1GQEA 3ZCJA 3J7Yq 5LG4A 3P4RA 2X67A 2XAQB 4PJMA 4YSYA 3C98B 5AQHB 3WAKA 4OFZA 4JI0T 4HFVA 3ONXA 4O4LE 1OEDE 2UXDT 3EVYA 4YTMA 2L8KA 2KVPA 2XJ7A 5AQIB 4I4TE 1VCTA 4DV6T 2DI4A 4ILAA 2QRXA 2XHEB 2IC9A 3NRYA 3KBUA 2BS2A 3RYFE 4E7SA 1D1AA 2NOXA 3RHWA 4XBFB 3JC6D 2BG9A 4HWFA 4CQIA 4CXWA 3TLWA 3R84B 3UFGA 1N32T 2Y6XA 3O1HA 4NUVA 1V9DA 1KNRA 2YU2A 2BG9B 2VQFT 2VWAA 3LK42 2UXXB 3UUXB 4ZI2C 2JQQA 3AEFA 4DUYT 3Q5WA 3N9QA 2WSSV 3ZJ2A 2CM0A 4WW0A 2VKJA 2XAHB 2XM1A 3PF0A 5C2TA 3CK6A 2NP9A 4Z90A 3AA6B 4B3RT 3PE0A 2ZM6T 3BQLA 5FNVE 3CMLA 5DQVA 3V5SA 4DR3T 2V8SV 4X64T 3C4WA 2NW8A 1XNQT 1MMDA 4JI3T 3ZT7A 4JI7T 1HTJF 4DR2T 2YDSA 4U72A 4PNIA 4QXCB 2YOEA 3M1CA 4DV3T 5IYZE 5AQSB 2M6BA 2BDEA 1MMNA 2I0MA 2D2SA 4U2YA 2A72A 3FZLB 3O1JA 5FKYA 2WQYA 2LRKA 3CX7B 2V1DB 3HA4A 4KI0F 4O4JE 2CHNA 5JDQA 4DV7T 3H37A 3VRBA 2FJDA 3AE9A 5JR9C 3ZMVB 3CQCB 5LCYA 3KV4A 3ETVA 1VCSA 3P4WA 2H7OA 2KBBA 3N5LA 2X66A 5H6RB 2BKPA 3KDSE 2WU5A 5AQVB 4M1PA 4JI6T 4LF6T 2W63A 2WDVA 5LBMA 4QX7B 5ADXL 2IC6A 5LOVE 1YQ3A 2L10A 4LMJA 1ZV4X 3MACA 2JJ9A 5IUXA 4PK6A 2LT3A 3QNUA 5AQRB 4TUYE 3RQWA 5AQGB 1IJ6A 4MLKA 5FXZA 3K1SA 4P09A 2RP4A 4O2BE 1HR0T 4ZI2D 3PUGA 1WRDA 4TWHA 4DV5T 1HG5A 2D5UA 2E5VA 5CA1E 5FL0A 3N9LA 2VL0A 4A5XA 4U3CA 3UU3A 3KV6A 3G06A 1U4QA 3K8PC 1MNEA 2NWBA 4FJOA 1JNZA 3NWIA 1UUSA 5AQFB 4MHCA 4EV6A 3UU6A 2LQUA 3WAJA 2FBWA 4YLHA 1WYCA 2W0GA 3PU3A 3PU8A 3P7IA 2WWVA 4HTEA 1FJGT 4U2ZA 4UVBB 3NZPA 5HYAA 2LKGA 2L3LA 4BJMA 1HG2A 3H3MA 4GK5E 2K48A 4DV1T 3UUNA 4A56A 1YW0A 4C90A 4X1YE 4PK5A 2L9QA 3OVUA 3HKDE 2KNDA 2KGXA 5JDNA 1HX1B 2HHHT 3CX8B 1O3XA 1OEDC 3NKZA 4TV9E 2V5CA 3AAEB 2E9XD 1VRBA 4ZI3C 2X0CA 2LSJA 2W66A 4H9PC 1CHUA 3EDUA 4AKRB 1HNZT 4DBRA 4X5TA 2UU9T 3RYIE 3ZYKA 3ZC0A 2DNXA 2M67A 3B57A 3RYHE 4I0UA 5HEUA 3K3QC 5LGUB 5HCMA 2K9AA 1QLBA 1FMWA 4YY3T 2NTYA 4LF8T 5L3FB 3N9MA 2J4GA 1MIYA 3MZKB 4UXNB 4ASKA 2KSRA 1N34T 3KV9A 2K5BB 3HL6A 5JVDE 4JUYA 3WURA 2HN2A 3AAAB 4B3TT 2FJEA 2V6XA 1G8XA 3AXJA 4YHHT 2JQHA 1XMQT 2FJBA 3M65A 4UVAB 3PJAA 1J1JA 3VKGA 1LVKA 5DQWA 3E08A 4IIJE 5AQPB 3PUAA 4PFOA 1VOMA 1YQ4A 2K24A 5HEGA 2NR4A 4YJ2E 2KMFA 1HX8A 3AXJB 4Z91A 4ZS2A 1LKXA 2KZ7B 3I9YA 3IA3A
chains in the Genus database with same CATH topology
2MTQA 2V7MA 4BAYB 2EHOB 2EHOC 4L9IA 4QKNA 3ZCJA 3J7Yq 5LG4A 2X67A 2XAQB 5FY0A 2E9XA 4PJMA 5HXCA 4ILUA 2LEHA 3AVSA 1NWMX 3C98B 2LSGA 2X51A 2VKOA 2N1GA 3WAKA 4OFZA 2IW5B 3ZC1A 4HFVA 3J9X1 4B6XA 5LJNA 5JDMA 1E1HB 1MMGA 3ONXA 4O4LE 3ZJ1A 4TV8E 4EOZB 3VJZA 3EVYA 5J2TE 2X9XA 4DMWA 2L8KA 5DJQC 4F6RC 4I4TE 3LBXA 2DI4A 4ONRA 5CA0E 2E9XC 2E9XB 2IC9A 2XHEB 3KBUA 3NRYA 4QWNB 3ZPOA 2XTLA 4U74A 3HKBE 3AT7A 3RYFE 4E7SA 5FY7A 3U3IA 4IE4A 1D1AA 2CE7A 4UV8B 2CLYC 2CLYB 3GA8A 2NOXA 5LHGB 4AI6A 4XBFB 3JC6D 5F8PA 2MTCA 3BK9A 3QUJA 2KLQA 4CQIA 5HXRA 4H63V 3LJCA 4ANJA 4CXWA 4CI3B 2N2NA 3R84B 4AKHA 3LK2B 1Y64B 3PTRB 3FBLA 2Y6XA 2Q9QD 3CPZA 3N2KE 4AKIA 3IF8B 1HS7A 1CUNA 3LBXB 2JMKA 3O1HA 2X9WA 4NUVA 1V9DA 2ES0A 2WAUA 3MJXA 2YU2A 3P8CD 4ZI3D 5T1DA 1MNDA 3PHF1 2VWAA 3N2OA 3CQXC 4AXPA 3LK42 4GOUA 3I0OA 2UXXB 4YFSA 1NAFA 2XQYA 3UUXB 3ZN0B 4ZI2C 1BR2A 2C5KT 2JQQA 3PUQA 4GYRA 4EZHA 5JREA 1OWAA 2ZLYA 3Q5WA 3ZMUB 4MBQA 1H7CA 4EAHA 4PFPA 1YKEB 2JMHA 5J2UE 2H3RA 2WSSV 3LK3B 3N9QA 4P0BA 3ZJ2A 3C64A 2IAKA 4BJNA 2PG8A 1FIOA 2CM0A 4GYSA 4WW0A 4P0AA 2VKJA 3KFWX 3HKCE 2HH7A 5C8YE 2LHNA 5EK3A 2XAHB 4PJLA 4OYJA 4BA9A 3E0ZA 3PF0A 5M4YA 2NW7A 3ZYMA 5A1LA 2NP9A 4EYUA 3SS1A 1MMAA 4EXTA 1BR1A 3I1AA 4HE8A 4UF0A 4PK4A 4XAXB 5JDGA 2UXNB 2X68A 3AA6B 2PFVA 4ADZA 3FB2A 2LSYA 3PE0A 2N9DA 1IJ5A 4I50E 3SRZA 5KMGP 3BQLA 2LM9A 5FNVE 3CMLA 5DQVA 5LNKA 3V5SA 1FMVA 4QXHB 4GIWA 5LXTE 4PJJA 4ERRA 4HEAA 5L2LA 2LOSA 2NW9A 3C4WA 4UEMA 3B13A 4UF0B 2NW8A 4AKLA 1MMDA 3DTOA 1MIVA 3MK7C 3ZEFB 3O1IA 1HTJF 2P9BA 2KWIB 3KVBA 4U72A 3F31A 1IZNB 5AFUL 3N9OA 2QA7A 2VKHA 2BVMA 4PNIA 1WYBA 4QXCB 4H9QC 4UV9B 5J1GA 3KV5A 2KXPB 5LGNB 1UX5A 4E7ZA 4AQGA 2DHRA 2VKDA 2VL8A 3M1CA 5FXWA 5IYZE 4EIWA 5EK2A 3KBTA 5LP6E 2BDEA 3C4ZA 1MMNA 4ISTA 4XZCA 5JR9A 2VK9A 3BQIA 2D2SA 2A72A 3O1JA 4KP3C 5L3BB 2JRKA 4EYYR 2KINB 4X20E 2EHOD 5JDFA 4KBMB 4MFRA 4EB6E 5JRCA 3VHLA 3AVRA 3CX7B 4GK0E 4KUMB 3AA0B 4L0RA 4ZOLE 1MIWA 3NRXA 2V1DB 3HA4A 3QK6A 4O4JE 5LJMA 3EUHA 2KWHA 3HI2A 2ZMAA 3O4XE 5JDQA 4PAGA 3H37A 4HKAA 3VU7H 2X9YA 5JR9C 5JR9B 5LHIB 3ZMVB 2LHRA 3ANWA 2XAGB 3CQCB 2V26A 5LCYA 4OYKA 3GWHA 2CXLA 3KV4A 5JH7E 3Q5XA 1WLXA 1ZKEA 3ETVA 3C4XA 5JRCB 2CMRA 2H7OA 2V7JA 3N5LA 3Q2MA 4TX5A 3GN5A 1D0ZA 2YINA 2X66A 5H6RB 2ZM8A 3RPUA 3CWZB 2GK9A 3PURA 2WWUA 3KDSE 5JDHA 1X79A 2CXFA 4M1PA 2C0SA 2W63A 4KMCA 3UT5E 5LBMA 3R6NA 2XAJB 4QX7B 2LE8A 5ADXL 2IC6A 2LJLA 3N2GE 2ACXA 4WBOA 1T98A 3ANWB 5LOVE 3W15B 4EZ4A 3SWHA 4AQFA 2OA5A 5F3JA 1SHZC 2NTXA 4DBQA 1ZV4X 4IE5A 4O2AE 1S35A 1HCIA 1HF8A 2YEVC 3MACA 3GN5B 4UELA 4CI2B 3CX6B 5LA6E 4IDZA 2JJ9A 2WMOA 5HWYA 3CQGB 3I9WA 2A3DA 4PK6A 2LT3A 3ZMZB 3WSCA 3UFEA 4AKGA 3AA1B 3F2EA 4NUUA 2YK0A 4IGUA 4TUYE 2MBGA 2ODVA 1IAPA 4ZHQE 5ETWA 1IJ6A 1BR0A 4WNKA 4IE6A 3LFMA 4MLKA 4AQFC 5FXZA 4P09A 1ZHCA 2RP4A 4O2BE 1D1BA 4Z8XA 4ZI2D 3PUGA 1WRDA 2XASB 5KDMC 5KX5E 3T8OA 5HWXA 4JLEA 1HG5A 2D5UA 2XAFB 2DCFA 3PDYA 5CA1E 2W62A 3N9LA 3ZYLA 4O4HE 5HAXA 3N9NA 2BZBA 3DP7A 5LGTB 3LG7A 4I43B 3OYXA 3KV6A 5EK4A 2B1EA 5FP3A 2E8IA 1U4QA 2KT9A 2CEAA 4ZI7E 3K8PC 3OKQA 3NBXX 1MNEA 5GONE 3BQKA 4G63A 4HGAA 2NWBA 4FJOA 5E0OA 3RX6A 4H63H 4H9SE 1OXZA 1US7B 1HFAA 3ZMTB 3ESLA 4MHCA 5BMVE 5JDLA 3RC3A 3MKDA 5L3CB 1QUUA 2BVLA 3RYCE 2CCQA 3HKEE 3O9XA 2LQUA 3WAJA 3S4UA 4YLHA 1WYCA 2W0GA 3PU3A 3RH3A 3F57A 2EHOA 3PU8A 4IE0A 4CZZB 3FXDB 3ETUA 3OBVE 3RRWA 3P7IA 2J1DG 4DVDA 3AB3B 4MALA 4IHJE 2WBLA 3E22E 2H7VC 2LOPA 4HTEA 2Y48B 2HPLA 2WM9A 2C5JA 2LSKA 2CWYA 1Z0PA 5FYMA 2CWOA 1D1CA 4UVBB 3NZPA 5HYAA 4H9NC 3UUMA 3IHRA 5HXHA 2L3LA 1FEWA 4JEHB 2PJQA 4BJMA 2PBIA 2Q9QA 5FXXA 1HG2A 2V7KA 5DABA 5HXSA 4GK5E 2Y8DA 1WR6A 2D0TA 1G73A 3L09A 2K48A 3UULA 4FI5A 2LSIA 1KNZA 3UUNA 4A56A 4DMVA 2ZM0A 2A2FX 1YW0A 4C90A 4X1YE 3JC6C 4UVCB 4O4IE 4PK5A 2G0UA 3WI3A 1D0XA 2L9QA 3EDVA 4YHJA 3HKDE 4V1Av 3ZMSB 2ODUA 2X0LB 1EZ3A 2KNDA 2DWKA 2Q9QB 2Q9QC 5JDNA 4ZS3A 3QC9A 3FHNA 3ZCIA 2CXDA 4ECGA 3CX8B 1O3XA 4TV9E 3AAEB 5LYJE 4K0UA 3CVRA 4OK0A 3IBPA 2E9XD 1VRBA 5H6QB 4ZI3C 2I59A 1BR4A 4CXXA 2LSJA 1UX4A 4H9PC 3EDUA 1LVFA 4AKRB 4DBRA 2X9HA 3C50A 4C91A 3RYIE 3ZYKA 3ZC0A 3C51A 2DNXA 1B7TA 3FXEB 3I0QA 2M67A 3AAIA 2W00A 3H3AA 3B57A 4IE7A 4H9OC 3OYZA 3RYHE 4WBNE 4JEUB 2QGSA 4PW8A 5IHYA 4L5GA 1ZEEA 3K3QC 2ZM2A 3KINB 3TKLB 1QSDA 5FY1A 4OHFA 1S94A 2DLRA 5LGUB 5HXEA 2K9AA 3GMIA 4TZ4C 2C5IT 5FMNA 4CI1B 1FMWA 3A5XA 1U5PA 3HR0A 1YD8G 2SPCA 3SOLA 2NTYA 3U78A 5L3GB 3RRCA 4TN7B 3MA9A 5L3FB 3N9MA 2D0UA 5LBQB 1MIYA 2V7IA 3MZKB 2CA5A 2HPJA 2JPFA 4H9RC 4UXNB 4UIGA 4ASKA 4HN9A 4DNDA 3AA7B 3N9PA 5JQGE 3L3PA 4CXYA 3KV9A 4I55E 3Q9DA 5LHHB 1LRZA 2K5BB 2MYSA 4J2CA 3FBZA 4QX8B 3HL6A 5JVDE 3RKOA 3V5UA 4JUYA 3OJAA 4X1KE 2DWGA 3WURA 2MOZA 2V7LA 3AAAB 3RC8A 5CB4E 4O8SA 3DJBA 5L3DB 4YJ3E 4DO0A 4X1IE 4BGOA 5L3EB 1G8XA 3VKHA 5FXVA 2VB6A 5EZYE 3M65A 4G2AA 3K3NA 2YU1A 4UVAB 3ZLIA 1D0YA 3CKDA 3NZQA 2W61A 1KK7A 3VKGA 2RA1A 1LVKA 4N78D 5DQWA 2VASA 1YKHB 2WMNA 3E08A 3MXZA 4IIJE 3PUAA 4PFOA 1VOMA 2Z6EA 2K24A 1AJ3A 4QHOA 4PJNA 3IEEA 5TAOA 4YJ2E 2KMFA 3PUSA 1HX8A 4QXBB 4ZS2A 3UTKA 1LKXA 2XUEA 1SA0E 2KZ7B 3I9YA 3D0TA 1UCUA 3KVAA 3ZN1B 4ISSA 3K3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDF A;  5HXC A;  5HXS A;  5HXE A;  5JDN A;  5HXH A;  5JDL A;  5JDM A;  5HWX A;  5JDG A;  5JDH A;  5JDQ A;  5HWY A;  5HYA A;  3V5U A;  5HXR A;  3V5S A; 
#chains in the Genus database with same CATH topology
 4U7Y A;  4BAY B;  2EHO C;  2IDO B;  3AY5 A;  5FY0 A;  2E9X A;  4ILU A;  2LEH A;  2YN6 A;  1T8B A;  2N1G A;  3ZC1 A;  5LJN A;  3PUZ F;  3VJZ A;  5DJQ C;  1JNR A;  5HEO A;  2XQ9 A;  2E9X B;  5CA0 E;  3ZPO A;  3HKB E;  3U3I A;  2CLY B;  3GA8 A;  3AE6 A;  2MTC A;  3AE3 A;  5HCJ A;  3LJC A;  1M7K A;  2UXB T;  2XY8 B;  2X9W A;  3EAB A;  2WAU A;  4P1N A;  3MJX A;  4ZI3 D;  2W2U A;  3RIU A;  3RQU A;  4YFS A;  2HN1 A;  4GYR A;  2LKH A;  1OWA A;  5AQT B;  3ZMU B;  4MBQ A;  1H7C A;  3TLU A;  3AE7 A;  4LFB T;  2JQK A;  3SFD A;  4DID B;  3KFW X;  2HH7 A;  3VR9 A;  4IDP A;  2LHN A;  5C8Y E;  5EK3 A;  2ACZ A;  4BA9 A;  2NW7 A;  2WB5 A;  1E7P A;  3AE5 A;  3CIR A;  3I1A A;  3AEA A;  2X68 A;  2L7N A;  4ADZ A;  3FB2 A;  1UGO A;  2LSY A;  2N9D A;  1IJ5 A;  3SRZ A;  2LM9 A;  4JYA T;  4QXH B;  4HEA A;  2WZH A;  4NXM T;  2NW9 A;  4JV5 T;  4UR9 A;  3DTO A;  4LF7 T;  2JQ9 A;  3KVB A;  1IZN B;  3N9O A;  2QA7 A;  2VKH A;  2BVM A;  4H9Q C;  2KXP B;  1UX5 A;  2XQA A;  4GKK T;  5FXW A;  4EIW A;  3C4Z A;  4XZC A;  2VK9 A;  3RKG A;  2D9D A;  2KIN B;  4X20 E;  2EHO D;  4KBM B;  4EB6 E;  3VHL A;  3FZF B;  4GK0 E;  4CN4 A;  3B5M A;  4L0R A;  1MIW A;  3EUH A;  4PAG A;  2XQ6 A;  3VU7 H;  2X9Y A;  4NPP A;  5L47 A;  2YDR A;  4ZZB A;  2V7J A;  5AQQ B;  4TX5 A;  2BG9 E;  1D0Z A;  3JAD A;  2YIN A;  4AKH A;  3CWZ B;  1X79 A;  3QB5 A;  2C0S A;  3ABV A;  2CRB A;  4AIS A;  4HWH A;  2XAJ B;  2LJL A;  2DL1 A;  2BBJ A;  3SWH A;  4AQF A;  2XQ7 A;  1SHZ C;  5F3J A;  3P4Q A;  4IE5 A;  3UUB A;  2YEV C;  2H89 A;  4CI2 B;  3CX6 B;  4HWC A;  5HWY A;  3CQG B;  3ZMZ B;  3EHZ A;  3UFE A;  3QOF A;  4NUU A;  4IGU A;  2WCA A;  5ETW A;  4WNK A;  1WFD A;  2VUR A;  5KDM C;  2AXD S;  4JLE A;  3A8Y C;  4EGW A;  3OYX A;  4DR5 T;  2CEA A;  3OKQ A;  5GON E;  4G63 A;  4H63 H;  2QVA A;  1OXZ A;  1HFA A;  4CN6 A;  5BMV E;  3LSV A;  5L3C B;  1QUU A;  3RYC E;  2CCQ A;  2OV9 A;  4HFI A;  3RH3 A;  4CZZ B;  2EHO A;  4IE0 A;  3ETU A;  3RRW A;  3AED A;  5KXJ A;  4MAL A;  4IHJ E;  2H7V C;  2Y48 B;  1L0V A;  2C5J A;  2LSK A;  3TLT A;  1Z0P A;  5FYM A;  4IT4 A;  5ABE A;  3JAF A;  5HXH A;  1NEN A;  2XM2 A;  5FXX A;  5DAB A;  2Y8D A;  1WR6 A;  3JCF A;  4FI5 A;  2LSI A;  3ONL C;  1Z8U A;  2A2F X;  2G0U A;  1D0X A;  2OLT A;  3ZMS B;  2ODU A;  2Q9Q C;  2X0H A;  4DR6 T;  4DV0 T;  5LYJ E;  3AEC A;  4OK0 A;  2XQ4 A;  5LMU T;  5BR8 T;  2X9H A;  3C50 A;  4C91 A;  2A9U A;  3M3Z B;  3C51 A;  1B7T A;  1UK5 A;  3H3A A;  4JEU B;  3Q5D A;  4PW8 A;  5IHY A;  3KIN B;  5F5W A;  1QSD A;  4OHF A;  1S94 A;  3A7M A;  2C5I T;  4ZEY A;  1U5P A;  3HR0 A;  3EAM A;  5HEJ A;  1YD8 G;  2WZI A;  2SPC A;  3MA9 A;  2CA5 A;  2HPJ A;  4H9R C;  1X9B A;  4HWI B;  5LB7 B;  5LHH B;  4NXN T;  1LRZ A;  2UUC T;  4J2C A;  3FBZ A;  4LMK A;  4QX8 B;  5AQU B;  2E5L T;  3RIA A;  4X1K E;  2DWG A;  2MOZ A;  2V7L A;  4DO0 A;  4X1I E;  5L3E B;  4DV4 T;  3K3N A;  2YU1 A;  1W9R A;  1KK7 A;  4KX6 A;  4JI5 T;  5AQM B;  3AEE A;  2Z6E A;  4YTP A;  2MAW A;  4QXB B;  2XUE A;  1SA0 E;  3D0T A;  1UCU A;  4ISS A;  1KF6 A;  2LM2 A;  5IWA T;  4IDQ A;  4YXD A;  1NWM X;  2LSG A;  4F8H A;  4B6X A;  5JDM A;  1MMG A;  4AIU A;  3ZJ1 A;  4TV8 E;  4EOZ B;  5J2T E;  1KFY A;  4F6R C;  3LBX A;  3UQ7 A;  4U74 A;  3AT7 A;  5FY7 A;  4IE4 A;  4UV8 B;  4AI6 A;  5F8P A;  3QUJ A;  5HXR A;  2BKN A;  4H63 V;  1Y64 B;  2Q9Q D;  3CPZ A;  1HS7 A;  1CUN A;  3LBX B;  2JMK A;  2ES0 A;  3VRA A;  4DR1 T;  5T1D A;  1MND A;  2BG9 C;  4TNV A;  3PHF 1;  3CQX C;  4GOU A;  3I0O A;  3L8R A;  1BR2 A;  5AQL B;  3PUQ A;  5J0Z A;  3PUY F;  4EAH A;  4NIQ A;  4PFP A;  1YKE B;  5J2U E;  2H3R A;  2K3W A;  2IAK A;  3C64 A;  4BJN A;  4HFE A;  2PG8 A;  4P0A A;  3HKC E;  1T72 A;  4OYJ A;  3E0Z A;  1XDP A;  3SS1 A;  1MMA A;  4EXT A;  1BR1 A;  5L4H A;  4PK4 A;  4LFA T;  1W09 A;  4COF A;  2WS3 A;  5LNK A;  1FMV A;  4GIW A;  4PJJ A;  2LOS A;  4UEM A;  3PUV F;  3RI5 A;  3O1I A;  3F31 A;  5AFU L;  4IL4 A;  3T1Y T;  4E7Z A;  4AQG A;  2VL8 A;  4X65 T;  5LP6 E;  4QH4 A;  5JR9 A;  1HNW T;  2IML A;  1SE7 A;  4OX9 T;  4KP3 C;  2JRK A;  2WU2 A;  3X1D A;  3PUX F;  3P50 A;  4LML A;  4MFR A;  5CFB A;  5JRC A;  3AVR A;  4KUM B;  3OPC A;  3NRX A;  2ZMA A;  3O4X E;  4HKA A;  4LF4 T;  5JR9 B;  5L4E A;  2LHR A;  2V26 A;  2CXL A;  5JH7 E;  3Q5X A;  1ZKE A;  3C4X A;  5JRC B;  2CMR A;  3Q2M A;  3GN5 A;  4TNW A;  2ZM8 A;  5JDH A;  2YKS A;  3R6N A;  4A98 A;  2LE8 A;  1XDO A;  3N2G E;  4WBO A;  3RLF F;  2OA5 A;  2NTX A;  1S35 A;  2AE9 A;  1HF8 A;  4JI8 T;  5AQK B;  3GN5 B;  5LA6 E;  2WMO A;  3I9W A;  2A3D A;  4AKG A;  3TLV A;  3AA1 B;  1BR0 A;  4IE6 A;  3RIF A;  1D1B A;  4Z8X A;  5C3J A;  2XAS B;  5KX5 E;  1XMO T;  5HWX A;  3FYQ A;  3PDY A;  2XQ8 A;  4HFC A;  2X0Y A;  4O4H E;  5HAX A;  4B3S T;  3EI0 A;  3N9N A;  4HFB A;  3DP7 A;  5LGT B;  3UU5 A;  3ZST A;  5EK4 A;  4TWF A;  4U33 A;  2E8I A;  2KT9 A;  1NEK A;  4ZI7 E;  3BQK A;  5E0O A;  1T7S A;  4H9S E;  3ZMT B;  4DV2 T;  3ESL A;  2BVL A;  3HKE E;  1R8I A;  5FVL A;  2J1D G;  4DVD A;  3AB3 B;  2HPL A;  2CWO A;  1D1C A;  3UUM A;  4IDO A;  2PJQ A;  2PBI A;  5AQO B;  2D0T A;  2JIW A;  1OED A;  1G73 A;  3UUL A;  1KNZ A;  4DMV A;  1UUR A;  4QH5 A;  4UVC B;  4A97 A;  1I6Z A;  3FZK B;  3EDV A;  1KNP A;  4YHJ A;  2F4V T;  5LMN T;  1EZ3 A;  2UUB T;  3DYJ A;  4IRE A;  4ECG A;  2CXD A;  1OED B;  3CVR A;  3IBP A;  5H6Q B;  2I59 A;  2LRL A;  1UX4 A;  3P4P A;  5ABH A;  1WR0 A;  2IIU A;  4WBN E;  2QGS A;  4L5G A;  1ZEE A;  3SFE A;  2ZM2 A;  5FY1 A;  1M62 A;  1DU2 A;  2DLR A;  4W8P A;  4AQY T;  3GMI A;  4CI1 B;  3A5X A;  2WDR A;  3RF1 A;  3SOL A;  4TN7 B;  2V7I A;  1XNR T;  4YSZ A;  2JPF A;  4UIG A;  4HN9 A;  2B76 A;  4DND A;  3N9P A;  4K0K T;  4CXY A;  1SJ7 A;  3PUW F;  3Q9D A;  3AEB A;  2MYS A;  3RKO A;  3OJA A;  3QB5 K;  3ZSS A;  2QYW A;  3RC8 A;  5CB4 E;  4O8S A;  5FZT A;  5L3D B;  4YJ3 E;  4BGO A;  2R6G F;  2XSA A;  3VKH A;  1SUM B;  3NZQ A;  2RA1 A;  3AE8 A;  4N78 D;  4YTN A;  1YKH B;  3NVO A;  4X62 T;  5FL1 A;  3MXZ A;  1AJ3 A;  3IEE A;  5JTG A;  3PUS A;  3FZM B;  3UTK A;  1W0B A;  3KVA A;  4EEB A;  3K3O A;  4DUZ T;  2EHO B;  4L9I A;  2LLY A;  4JI2 T;  1WCR A;  5HXC A;  3AVS A;  3VR8 A;  2X51 A;  2VKO A;  5ABG A;  2IW5 B;  1IBM T;  4GKJ T;  3J9X 1;  1E1H B;  4LF5 T;  3AE1 A;  4JBW F;  3ZT5 A;  2X9X A;  4DMW A;  3T1H T;  4ONR A;  2E9X C;  4QWN B;  2XTL A;  2CE7 A;  2CLY C;  5LHG B;  1YXR A;  4X66 T;  1J5E T;  3BK9 A;  2KLQ A;  4ANJ A;  4CI3 B;  2N2N A;  2WP9 A;  3LK2 B;  3PTR B;  3FBL A;  3N2K E;  4AKI A;  3IF8 B;  1J5W A;  3OTO T;  5ABF A;  3P8C D;  3N2O A;  4AXP A;  4WYV A;  1NAF A;  2FJA A;  2XQY A;  3ZN0 B;  4Q25 A;  2C5K T;  4EZH A;  4HFD A;  5JRE A;  3L39 A;  2ZLY A;  5ABF B;  1N36 T;  2JMH A;  2M6I A;  3LK3 B;  3RIU C;  4P0B A;  4DR7 T;  1FIO A;  4GYS A;  4JI4 T;  2J47 A;  3FZH B;  4PJL A;  5M4Y A;  4JI1 T;  1KEY A;  3ZYM A;  5A1L A;  4EYU A;  1Y01 A;  3ONJ A;  4HE8 A;  4YSX A;  4UF0 A;  4XAX B;  5JDG A;  2UXN B;  2XQ3 A;  2PFV A;  2VVN A;  2YDQ A;  4I50 E;  5KMG P;  4U31 A;  4CN1 A;  5LXT E;  4ERR A;  1IBK T;  5L2L A;  2UXC T;  3B13 A;  4UF0 B;  4AKL A;  1MIV A;  2UUA T;  2MPK A;  3MK7 C;  3ZEF B;  2P9B A;  2KWI B;  4UV9 B;  1WYB A;  5J1G A;  3KV5 A;  5LGN B;  2IUB A;  2DHR A;  2VKD A;  2VQE T;  5EK2 A;  3KBT A;  4IST A;  3BQI A;  4KHZ F;  3AE2 A;  5L3B B;  4EYY R;  4WZX A;  5JDF A;  2BBH A;  1HNX T;  3AA0 B;  2CHO A;  5HEH A;  2I6H A;  4ZOL E;  3QK6 A;  5LJM A;  2KWH A;  3HI2 A;  1XZY A;  5LHI B;  3ANW A;  2XAG B;  4OYK A;  3GWH A;  1WLX A;  1IBL T;  3RPU A;  4HWD A;  2GK9 A;  3PUR A;  2WWU A;  2CXF A;  2IHR 1;  4KMC A;  3UT5 E;  3PV0 F;  4KHP T;  2ACX A;  1T98 A;  3ANW B;  3W15 B;  4EZ4 A;  2FUP A;  4DBQ A;  4O2A E;  1HCI A;  1SJ8 A;  4UEL A;  3LDQ B;  4IDZ A;  2BKO A;  3WSC A;  3F2E A;  2YK0 A;  2MBG A;  1I94 T;  2XSB A;  2ODV A;  1IAP A;  4ZHQ E;  4ILC A;  3LFM A;  4AQF C;  4HFH A;  1ZHC A;  3T8O A;  2XAF B;  2DCF A;  2W62 A;  3UU8 A;  3ZYL A;  2CBI A;  2BZB A;  4F7G B;  2WDQ A;  3LG7 A;  4I43 B;  4ZXL A;  2B1E A;  5FP3 A;  5CJ5 A;  3NBX X;  4IL9 A;  4HGA A;  5LG3 A;  3RX6 A;  2XZE A;  1US7 B;  2H88 A;  3TLS A;  5JDL A;  3RC3 A;  3MKD A;  2V6Y A;  5CGM A;  3O9X A;  2E2A A;  3S4U A;  3F57 A;  4ZZC A;  3FXD B;  2J62 A;  3OBV E;  2WBL A;  4U7I A;  3ZT6 A;  3E22 E;  2BS4 A;  2LOP A;  2WM9 A;  3JAE A;  2CBJ A;  2CWY A;  4LF9 T;  5FVK A;  4H9N C;  2VVS A;  3IHR A;  2V6Y B;  1FEW A;  4JEH B;  2W4X A;  2Q9Q A;  2V7K A;  5HXS A;  3L09 A;  4ILB A;  2ZM0 A;  1ZOY A;  4IDN A;  3JC6 C;  4O4I E;  3WI3 A;  3AE4 A;  1XWM A;  4V1A v;  2X0L B;  2DWK A;  2Q9Q B;  4ZS3 A;  3QC9 A;  3FHN A;  3ZCI A;  1N33 T;  4K0U A;  1BR4 A;  4CXX A;  2BS3 A;  2RPA A;  1LVF A;  5AQN B;  4EED A;  3FXE B;  3I0Q A;  3AAI A;  2W00 A;  4IE7 A;  4H9O C;  3OYZ A;  3PJA J;  4TWD A;  2V5D A;  2PTF A;  3TKL B;  3AEG A;  5HXE A;  4TZ4 C;  5FMN A;  4DR4 T;  1ZP0 A;  3Q5E A;  3U78 A;  5L3G B;  3RRC A;  2D0U A;  5LBQ B;  2W67 A;  5AQJ B;  3AA7 B;  5JQG E;  2WY2 A;  3L3P A;  4I55 E;  3V5U A;  3DJB A;  2XPK A;  4LFC T;  5FXV A;  2VB6 A;  5EZY E;  4G2A A;  3ZLI A;  1D0Y A;  3CKD A;  2W61 A;  2VAS A;  2WMN A;  4QH1 A;  1E2A A;  4QHO A;  4PJN A;  5TAO A;  4B3M T;  3P4S A;  4YT0 A;  1W0A A;  2XQ5 A;  2CPT A;  3RGL A;  3UU4 A;  3ZN1 B;  3ZKR A;  3UQ4 A;  2MTQ A;  2V7M A;  4QKN A;  1GQE A;  3ZCJ A;  3J7Y q;  5LG4 A;  3P4R A;  2X67 A;  2XAQ B;  4PJM A;  4YSY A;  3C98 B;  5AQH B;  3WAK A;  4OFZ A;  4JI0 T;  4HFV A;  3ONX A;  4O4L E;  1OED E;  2UXD T;  3EVY A;  4YTM A;  2L8K A;  2KVP A;  2XJ7 A;  5AQI B;  4I4T E;  1VCT A;  4DV6 T;  2DI4 A;  4ILA A;  2QRX A;  2XHE B;  2IC9 A;  3NRY A;  3KBU A;  2BS2 A;  3RYF E;  4E7S A;  1D1A A;  2NOX A;  3RHW A;  4XBF B;  3JC6 D;  2BG9 A;  4HWF A;  4CQI A;  4CXW A;  3TLW A;  3R84 B;  3UFG A;  1N32 T;  2Y6X A;  3O1H A;  4NUV A;  1V9D A;  1KNR A;  2YU2 A;  2BG9 B;  2VQF T;  2VWA A;  3LK4 2;  2UXX B;  3UUX B;  4ZI2 C;  2JQQ A;  3AEF A;  4DUY T;  3Q5W A;  3N9Q A;  2WSS V;  3ZJ2 A;  2CM0 A;  4WW0 A;  2VKJ A;  2XAH B;  2XM1 A;  3PF0 A;  5C2T A;  3CK6 A;  2NP9 A;  4Z90 A;  3AA6 B;  4B3R T;  3PE0 A;  2ZM6 T;  3BQL A;  5FNV E;  3CML A;  5DQV A;  3V5S A;  4DR3 T;  2V8S V;  4X64 T;  3C4W A;  2NW8 A;  1XNQ T;  1MMD A;  4JI3 T;  3ZT7 A;  4JI7 T;  1HTJ F;  4DR2 T;  2YDS A;  4U72 A;  4PNI A;  4QXC B;  2YOE A;  3M1C A;  4DV3 T;  5IYZ E;  5AQS B;  2M6B A;  2BDE A;  1MMN A;  2I0M A;  2D2S A;  4U2Y A;  2A72 A;  3FZL B;  3O1J A;  5FKY A;  2WQY A;  2LRK A;  3CX7 B;  2V1D B;  3HA4 A;  4KI0 F;  4O4J E;  2CHN A;  5JDQ A;  4DV7 T;  3H37 A;  3VRB A;  2FJD A;  3AE9 A;  5JR9 C;  3ZMV B;  3CQC B;  5LCY A;  3KV4 A;  3ETV A;  1VCS A;  3P4W A;  2H7O A;  2KBB A;  3N5L A;  2X66 A;  5H6R B;  2BKP A;  3KDS E;  2WU5 A;  5AQV B;  4M1P A;  4JI6 T;  4LF6 T;  2W63 A;  2WDV A;  5LBM A;  4QX7 B;  5ADX L;  2IC6 A;  5LOV E;  1YQ3 A;  2L10 A;  4LMJ A;  1ZV4 X;  3MAC A;  2JJ9 A;  5IUX A;  4PK6 A;  2LT3 A;  3QNU A;  5AQR B;  4TUY E;  3RQW A;  5AQG B;  1IJ6 A;  4MLK A;  5FXZ A;  3K1S A;  4P09 A;  2RP4 A;  4O2B E;  1HR0 T;  4ZI2 D;  3PUG A;  1WRD A;  4TWH A;  4DV5 T;  1HG5 A;  2D5U A;  2E5V A;  5CA1 E;  5FL0 A;  3N9L A;  2VL0 A;  4A5X A;  4U3C A;  3UU3 A;  3KV6 A;  3G06 A;  1U4Q A;  3K8P C;  1MNE A;  2NWB A;  4FJO A;  1JNZ A;  3NWI A;  1UUS A;  5AQF B;  4MHC A;  4EV6 A;  3UU6 A;  2LQU A;  3WAJ A;  2FBW A;  4YLH A;  1WYC A;  2W0G A;  3PU3 A;  3PU8 A;  3P7I A;  2WWV A;  4HTE A;  1FJG T;  4U2Z A;  4UVB B;  3NZP A;  5HYA A;  2LKG A;  2L3L A;  4BJM A;  1HG2 A;  3H3M A;  4GK5 E;  2K48 A;  4DV1 T;  3UUN A;  4A56 A;  1YW0 A;  4C90 A;  4X1Y E;  4PK5 A;  2L9Q A;  3OVU A;  3HKD E;  2KND A;  2KGX A;  5JDN A;  1HX1 B;  2HHH T;  3CX8 B;  1O3X A;  1OED C;  3NKZ A;  4TV9 E;  2V5C A;  3AAE B;  2E9X D;  1VRB A;  4ZI3 C;  2X0C A;  2LSJ A;  2W66 A;  4H9P C;  1CHU A;  3EDU A;  4AKR B;  1HNZ T;  4DBR A;  4X5T A;  2UU9 T;  3RYI E;  3ZYK A;  3ZC0 A;  2DNX A;  2M67 A;  3B57 A;  3RYH E;  4I0U A;  5HEU A;  3K3Q C;  5LGU B;  5HCM A;  2K9A A;  1QLB A;  1FMW A;  4YY3 T;  2NTY A;  4LF8 T;  5L3F B;  3N9M A;  2J4G A;  1MIY A;  3MZK B;  4UXN B;  4ASK A;  2KSR A;  1N34 T;  3KV9 A;  2K5B B;  3HL6 A;  5JVD E;  4JUY A;  3WUR A;  2HN2 A;  3AAA B;  4B3T T;  2FJE A;  2V6X A;  1G8X A;  3AXJ A;  4YHH T;  2JQH A;  1XMQ T;  2FJB A;  3M65 A;  4UVA B;  3PJA A;  1J1J A;  3VKG A;  1LVK A;  5DQW A;  3E08 A;  4IIJ E;  5AQP B;  3PUA A;  4PFO A;  1VOM A;  1YQ4 A;  2K24 A;  5HEG A;  2NR4 A;  4YJ2 E;  2KMF A;  1HX8 A;  3AXJ B;  4Z91 A;  4ZS2 A;  1LKX A;  2KZ7 B;  3I9Y A;  3IA3 A; 
#chains in the Genus database with same CATH homology
 2MTQ A;  2V7M A;  4BAY B;  2EHO B;  2EHO C;  4L9I A;  4QKN A;  3ZCJ A;  3J7Y q;  5LG4 A;  2X67 A;  2XAQ B;  5FY0 A;  2E9X A;  4PJM A;  5HXC A;  4ILU A;  2LEH A;  3AVS A;  1NWM X;  3C98 B;  2LSG A;  2X51 A;  2VKO A;  2N1G A;  3WAK A;  4OFZ A;  2IW5 B;  3ZC1 A;  4HFV A;  3J9X 1;  4B6X A;  5LJN A;  5JDM A;  1E1H B;  1MMG A;  3ONX A;  4O4L E;  3ZJ1 A;  4TV8 E;  4EOZ B;  3VJZ A;  3EVY A;  5J2T E;  2X9X A;  4DMW A;  2L8K A;  5DJQ C;  4F6R C;  4I4T E;  3LBX A;  2DI4 A;  4ONR A;  5CA0 E;  2E9X C;  2E9X B;  2IC9 A;  2XHE B;  3KBU A;  3NRY A;  4QWN B;  3ZPO A;  2XTL A;  4U74 A;  3HKB E;  3AT7 A;  3RYF E;  4E7S A;  5FY7 A;  3U3I A;  4IE4 A;  1D1A A;  2CE7 A;  4UV8 B;  2CLY C;  2CLY B;  3GA8 A;  2NOX A;  5LHG B;  4AI6 A;  4XBF B;  3JC6 D;  5F8P A;  2MTC A;  3BK9 A;  3QUJ A;  2KLQ A;  4CQI A;  5HXR A;  4H63 V;  3LJC A;  4ANJ A;  4CXW A;  4CI3 B;  2N2N A;  3R84 B;  4AKH A;  3LK2 B;  1Y64 B;  3PTR B;  3FBL A;  2Y6X A;  2Q9Q D;  3CPZ A;  3N2K E;  4AKI A;  3IF8 B;  1HS7 A;  1CUN A;  3LBX B;  2JMK A;  3O1H A;  2X9W A;  4NUV A;  1V9D A;  2ES0 A;  2WAU A;  3MJX A;  2YU2 A;  3P8C D;  4ZI3 D;  5T1D A;  1MND A;  3PHF 1;  2VWA A;  3N2O A;  3CQX C;  4AXP A;  3LK4 2;  4GOU A;  3I0O A;  2UXX B;  4YFS A;  1NAF A;  2XQY A;  3UUX B;  3ZN0 B;  4ZI2 C;  1BR2 A;  2C5K T;  2JQQ A;  3PUQ A;  4GYR A;  4EZH A;  5JRE A;  1OWA A;  2ZLY A;  3Q5W A;  3ZMU B;  4MBQ A;  1H7C A;  4EAH A;  4PFP A;  1YKE B;  2JMH A;  5J2U E;  2H3R A;  2WSS V;  3LK3 B;  3N9Q A;  4P0B A;  3ZJ2 A;  3C64 A;  2IAK A;  4BJN A;  2PG8 A;  1FIO A;  2CM0 A;  4GYS A;  4WW0 A;  4P0A A;  2VKJ A;  3KFW X;  3HKC E;  2HH7 A;  5C8Y E;  2LHN A;  5EK3 A;  2XAH B;  4PJL A;  4OYJ A;  4BA9 A;  3E0Z A;  3PF0 A;  5M4Y A;  2NW7 A;  3ZYM A;  5A1L A;  2NP9 A;  4EYU A;  3SS1 A;  1MMA A;  4EXT A;  1BR1 A;  3I1A A;  4HE8 A;  4UF0 A;  4PK4 A;  4XAX B;  5JDG A;  2UXN B;  2X68 A;  3AA6 B;  2PFV A;  4ADZ A;  3FB2 A;  2LSY A;  3PE0 A;  2N9D A;  1IJ5 A;  4I50 E;  3SRZ A;  5KMG P;  3BQL A;  2LM9 A;  5FNV E;  3CML A;  5DQV A;  5LNK A;  3V5S A;  1FMV A;  4QXH B;  4GIW A;  5LXT E;  4PJJ A;  4ERR A;  4HEA A;  5L2L A;  2LOS A;  2NW9 A;  3C4W A;  4UEM A;  3B13 A;  4UF0 B;  2NW8 A;  4AKL A;  1MMD A;  3DTO A;  1MIV A;  3MK7 C;  3ZEF B;  3O1I A;  1HTJ F;  2P9B A;  2KWI B;  3KVB A;  4U72 A;  3F31 A;  1IZN B;  5AFU L;  3N9O A;  2QA7 A;  2VKH A;  2BVM A;  4PNI A;  1WYB A;  4QXC B;  4H9Q C;  4UV9 B;  5J1G A;  3KV5 A;  2KXP B;  5LGN B;  1UX5 A;  4E7Z A;  4AQG A;  2DHR A;  2VKD A;  2VL8 A;  3M1C A;  5FXW A;  5IYZ E;  4EIW A;  5EK2 A;  3KBT A;  5LP6 E;  2BDE A;  3C4Z A;  1MMN A;  4IST A;  4XZC A;  5JR9 A;  2VK9 A;  3BQI A;  2D2S A;  2A72 A;  3O1J A;  4KP3 C;  5L3B B;  2JRK A;  4EYY R;  2KIN B;  4X20 E;  2EHO D;  5JDF A;  4KBM B;  4MFR A;  4EB6 E;  5JRC A;  3VHL A;  3AVR A;  3CX7 B;  4GK0 E;  4KUM B;  3AA0 B;  4L0R A;  4ZOL E;  1MIW A;  3NRX A;  2V1D B;  3HA4 A;  3QK6 A;  4O4J E;  5LJM A;  3EUH A;  2KWH A;  3HI2 A;  2ZMA A;  3O4X E;  5JDQ A;  4PAG A;  3H37 A;  4HKA A;  3VU7 H;  2X9Y A;  5JR9 C;  5JR9 B;  5LHI B;  3ZMV B;  2LHR A;  3ANW A;  2XAG B;  3CQC B;  2V26 A;  5LCY A;  4OYK A;  3GWH A;  2CXL A;  3KV4 A;  5JH7 E;  3Q5X A;  1WLX A;  1ZKE A;  3ETV A;  3C4X A;  5JRC B;  2CMR A;  2H7O A;  2V7J A;  3N5L A;  3Q2M A;  4TX5 A;  3GN5 A;  1D0Z A;  2YIN A;  2X66 A;  5H6R B;  2ZM8 A;  3RPU A;  3CWZ B;  2GK9 A;  3PUR A;  2WWU A;  3KDS E;  5JDH A;  1X79 A;  2CXF A;  4M1P A;  2C0S A;  2W63 A;  4KMC A;  3UT5 E;  5LBM A;  3R6N A;  2XAJ B;  4QX7 B;  2LE8 A;  5ADX L;  2IC6 A;  2LJL A;  3N2G E;  2ACX A;  4WBO A;  1T98 A;  3ANW B;  5LOV E;  3W15 B;  4EZ4 A;  3SWH A;  4AQF A;  2OA5 A;  5F3J A;  1SHZ C;  2NTX A;  4DBQ A;  1ZV4 X;  4IE5 A;  4O2A E;  1S35 A;  1HCI A;  1HF8 A;  2YEV C;  3MAC A;  3GN5 B;  4UEL A;  4CI2 B;  3CX6 B;  5LA6 E;  4IDZ A;  2JJ9 A;  2WMO A;  5HWY A;  3CQG B;  3I9W A;  2A3D A;  4PK6 A;  2LT3 A;  3ZMZ B;  3WSC A;  3UFE A;  4AKG A;  3AA1 B;  3F2E A;  4NUU A;  2YK0 A;  4IGU A;  4TUY E;  2MBG A;  2ODV A;  1IAP A;  4ZHQ E;  5ETW A;  1IJ6 A;  1BR0 A;  4WNK A;  4IE6 A;  3LFM A;  4MLK A;  4AQF C;  5FXZ A;  4P09 A;  1ZHC A;  2RP4 A;  4O2B E;  1D1B A;  4Z8X A;  4ZI2 D;  3PUG A;  1WRD A;  2XAS B;  5KDM C;  5KX5 E;  3T8O A;  5HWX A;  4JLE A;  1HG5 A;  2D5U A;  2XAF B;  2DCF A;  3PDY A;  5CA1 E;  2W62 A;  3N9L A;  3ZYL A;  4O4H E;  5HAX A;  3N9N A;  2BZB A;  3DP7 A;  5LGT B;  3LG7 A;  4I43 B;  3OYX A;  3KV6 A;  5EK4 A;  2B1E A;  5FP3 A;  2E8I A;  1U4Q A;  2KT9 A;  2CEA A;  4ZI7 E;  3K8P C;  3OKQ A;  3NBX X;  1MNE A;  5GON E;  3BQK A;  4G63 A;  4HGA A;  2NWB A;  4FJO A;  5E0O A;  3RX6 A;  4H63 H;  4H9S E;  1OXZ A;  1US7 B;  1HFA A;  3ZMT B;  3ESL A;  4MHC A;  5BMV E;  5JDL A;  3RC3 A;  3MKD A;  5L3C B;  1QUU A;  2BVL A;  3RYC E;  2CCQ A;  3HKE E;  3O9X A;  2LQU A;  3WAJ A;  3S4U A;  4YLH A;  1WYC A;  2W0G A;  3PU3 A;  3RH3 A;  3F57 A;  2EHO A;  3PU8 A;  4IE0 A;  4CZZ B;  3FXD B;  3ETU A;  3OBV E;  3RRW A;  3P7I A;  2J1D G;  4DVD A;  3AB3 B;  4MAL A;  4IHJ E;  2WBL A;  3E22 E;  2H7V C;  2LOP A;  4HTE A;  2Y48 B;  2HPL A;  2WM9 A;  2C5J A;  2LSK A;  2CWY A;  1Z0P A;  5FYM A;  2CWO A;  1D1C A;  4UVB B;  3NZP A;  5HYA A;  4H9N C;  3UUM A;  3IHR A;  5HXH A;  2L3L A;  1FEW A;  4JEH B;  2PJQ A;  4BJM A;  2PBI A;  2Q9Q A;  5FXX A;  1HG2 A;  2V7K A;  5DAB A;  5HXS A;  4GK5 E;  2Y8D A;  1WR6 A;  2D0T A;  1G73 A;  3L09 A;  2K48 A;  3UUL A;  4FI5 A;  2LSI A;  1KNZ A;  3UUN A;  4A56 A;  4DMV A;  2ZM0 A;  2A2F X;  1YW0 A;  4C90 A;  4X1Y E;  3JC6 C;  4UVC B;  4O4I E;  4PK5 A;  2G0U A;  3WI3 A;  1D0X A;  2L9Q A;  3EDV A;  4YHJ A;  3HKD E;  4V1A v;  3ZMS B;  2ODU A;  2X0L B;  1EZ3 A;  2KND A;  2DWK A;  2Q9Q B;  2Q9Q C;  5JDN A;  4ZS3 A;  3QC9 A;  3FHN A;  3ZCI A;  2CXD A;  4ECG A;  3CX8 B;  1O3X A;  4TV9 E;  3AAE B;  5LYJ E;  4K0U A;  3CVR A;  4OK0 A;  3IBP A;  2E9X D;  1VRB A;  5H6Q B;  4ZI3 C;  2I59 A;  1BR4 A;  4CXX A;  2LSJ A;  1UX4 A;  4H9P C;  3EDU A;  1LVF A;  4AKR B;  4DBR A;  2X9H A;  3C50 A;  4C91 A;  3RYI E;  3ZYK A;  3ZC0 A;  3C51 A;  2DNX A;  1B7T A;  3FXE B;  3I0Q A;  2M67 A;  3AAI A;  2W00 A;  3H3A A;  3B57 A;  4IE7 A;  4H9O C;  3OYZ A;  3RYH E;  4WBN E;  4JEU B;  2QGS A;  4PW8 A;  5IHY A;  4L5G A;  1ZEE A;  3K3Q C;  2ZM2 A;  3KIN B;  3TKL B;  1QSD A;  5FY1 A;  4OHF A;  1S94 A;  2DLR A;  5LGU B;  5HXE A;  2K9A A;  3GMI A;  4TZ4 C;  2C5I T;  5FMN A;  4CI1 B;  1FMW A;  3A5X A;  1U5P A;  3HR0 A;  1YD8 G;  2SPC A;  3SOL A;  2NTY A;  3U78 A;  5L3G B;  3RRC A;  4TN7 B;  3MA9 A;  5L3F B;  3N9M A;  2D0U A;  5LBQ B;  1MIY A;  2V7I A;  3MZK B;  2CA5 A;  2HPJ A;  2JPF A;  4H9R C;  4UXN B;  4UIG A;  4ASK A;  4HN9 A;  4DND A;  3AA7 B;  3N9P A;  5JQG E;  3L3P A;  4CXY A;  3KV9 A;  4I55 E;  3Q9D A;  5LHH B;  1LRZ A;  2K5B B;  2MYS A;  4J2C A;  3FBZ A;  4QX8 B;  3HL6 A;  5JVD E;  3RKO A;  3V5U A;  4JUY A;  3OJA A;  4X1K E;  2DWG A;  3WUR A;  2MOZ A;  2V7L A;  3AAA B;  3RC8 A;  5CB4 E;  4O8S A;  3DJB A;  5L3D B;  4YJ3 E;  4DO0 A;  4X1I E;  4BGO A;  5L3E B;  1G8X A;  3VKH A;  5FXV A;  2VB6 A;  5EZY E;  3M65 A;  4G2A A;  3K3N A;  2YU1 A;  4UVA B;  3ZLI A;  1D0Y A;  3CKD A;  3NZQ A;  2W61 A;  1KK7 A;  3VKG A;  2RA1 A;  1LVK A;  4N78 D;  5DQW A;  2VAS A;  1YKH B;  2WMN A;  3E08 A;  3MXZ A;  4IIJ E;  3PUA A;  4PFO A;  1VOM A;  2Z6E A;  2K24 A;  1AJ3 A;  4QHO A;  4PJN A;  3IEE A;  5TAO A;  4YJ2 E;  2KMF A;  3PUS A;  1HX8 A;  4QXB B;  4ZS2 A;  3UTK A;  1LKX A;  2XUE A;  1SA0 E;  2KZ7 B;  3I9Y A;  3D0T A;  1UCU A;  3KVA A;  3ZN1 B;  4ISS A;  3K3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...