5HXHA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with zero na+ and ca2+
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
293
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 116
structure length 293
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxhA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxhA02
5JDLA 5JDGA 5HXCA 5HYAA 5HXRA 5HWYA 5JDNA 3V5SA 3V5UA 5JDMA 5JDQA 5JDHA 5HXHA 5HXEA 5HXSA 5HWXA 5JDFA
chains in the Genus database with same CATH superfamily
2XAJB 2HH7A 3K1SA 4AKGA 2L7NA 2V7MA 3RPUA 1MNEA 3PU8A 3M65A 3LG7A 2QRXA 3ZEFB 5FYMA 2JRKA 3EABA 4IGUA 1KF6A 3LFMA 3UU5A 3HKBE 2E9XC 2JQHA 1HNXT 1X79A 2UUCT 2A72A 5DABA 2WBLA 5FL1A 3N9NA 3ZYMA 4X5TA 3ZMTB 4YHJA 1UGOA 2XSAA 4HFIA 1N36T 4HE8A 2NW8A 4YJ2E 1OEDC 2Y48B 4DV7T 4JI2T 5HEJA 2EHOC 2CCQA 1N34T 4IDOA 3FHNA 4ISSA 2NTXA 2UXDT 3KBUA 4UF0A 4J2CA 4LMJA 2V26A 4DR1T 3PUWF 4GKJT 3QC9A 3PDYA 3RQWA 4EYYR 4MFRA 2G0UA 4ILUA 5H6QB 2H7OA 2V7LA 3GN5B 4CI1B 2WCAA 4ILAA 3O9XA 4HFEA 1KEYA 3WURA 4O2AE 4CN6A 4A97A 2Y6XA 3PJAJ 3P4WA 2CXLA 5CFBA 3LDQB 2VURA 1MMAA 1FMWA 2LSYA 1MMDA 5LBQB 3CQGB 3FZLB 3H3MA 5DJQC 3KBTA 5EK2A 5HXHA 3QUJA 4K0KT 4IDQA 3Q5EA 4U7YA 4KI0F 2BBJA 3O1JA 3P4PA 4I43B 3CK6A 3RF1A 1MIWA 2XTLA 4AKRB 1WCRA 4IT4A 4I4TE 4KHZF 3PUXF 5L3DB 4DR7T 1BR2A 3JCFA 3M1CA 5FZTA 2XAQB 1WYCA 1T98A 2UXNB 3ANWB 3F57A 2ACXA 1SJ8A 2UUAT 5ABFA 4DUYT 4B3RT 4QX7B 5AQQB 4Z91A 4I50E 3BK9A 2KZ7B 3ESLA 3GN5A 4KBMB 3EDUA 5LA6E 1JNRA 1CHUA 3I1AA 5JRCA 3WI3A 4KHPT 3VKHA 1L0VA 5AQNB 3AE9A 3UQ7A 4JI4T 2CE7A 2LKHA 2BKPA 3FZMB 3RQUA 2CHNA 4TNWA 3UU3A 4DV0T 2VKDA 3OJAA 2W2UA 3ZLIA 3RRWA 4YLHA 5HAXA 4UELA 3ABVA 2VVNA 2LSJA 1CUNA 4ECGA 3FBLA 2RA1A 2IW5B 4PK5A 4JEHB 3E22E 4CXXA 4U72A 3ZSSA 2HHHT 2CBJA 5L47A 4U31A 4CI3B 5LG4A 2K3WA 2HN2A 3HKDE 1IJ5A 2M67A 2XQ4A 5JDFA 4OX9T 1U4QA 3TKLB 3ZMZB 4B3TT 3I9WA 3VU7H 1VOMA 3Q2MA 3UTKA 3G06A 4TV8E 4AIUA 5FXVA 3E0ZA 5BMVE 3L39A 1HG5A 3JADA 5KX5E 4L5GA 3ANWA 4DV6T 1YW0A 3N9MA 2XZEA 1SA0E 1HF8A 1FIOA 1KNPA 4DBQA 2ES0A 2KWIB 2QYWA 2V5DA 3CMLA 3N2GE 3VJZA 4YTNA 5GONE 2XPKA 3MA9A 2A2FX 3V5UA 4CI2B 3C4ZA 3UU4A 3P8CD 2H88A 1KK7A 2QGSA 4KMCA 1XNRT 3AA0B 4ONRA 4EZ4A 2YN6A 3TLVA 2V7JA 5AQRB 4ZI7E 3N2OA 4IREA 4EZHA 1I94T 5JR9C 4GIWA 3CX6B 3T1YT 3K3QC 4DV4T 1E2AA 5HXCA 4WBNE 4COFA 4AKHA 3AE2A 5FY1A 2L3LA 4YSZA 5JDGA 4DR3T 4NXMT 2W63A 5CA1E 3SWHA 3JC6C 2DL1A 2XHEB 2VL0A 2CLYC 4ZS3A 3L3PA 3RYCE 2WU2A 3AE7A 4U2YA 3ONJA 4AQFA 4QH4A 3VRBA 2PBIA 2W66A 3ZCJA 4U74A 2WWUA 4EIWA 1NEKA 2Q9QD 4LFCT 4ZI2D 2B1EA 1BR4A 3FBZA 4JI0T 4LFAT 4JI8T 1QSDA 2VKHA 2FJEA 2X0LB 5DQVA 1QUUA 1XDPA 3AEAA 3S4UA 2QA7A 3CKDA 2DI4A 4PFPA 5AQPB 5LOVE 5LXTE 2XAHB 1HTJF 3TLUA 5AQTB 4ZI3D 4OYJA 4JEUB 3VR9A 2B76A 2V6XA 2BZBA 3LBXA 4NPPA 5FVKA 2V1DB 3GWHA 4HFDA 4QXHB 1D1BA 2LEHA 4DO0A 3TLSA 2BG9C 3Q5XA 4HFCA 4O4LE 2CBIA 2XUEA 3NVOA 2I6HA 2WU5A 4HWDA 4KX6A 4PJJA 5LYJE 5AQMB 5AQJB 2N2NA 2QVAA 2V8SV 1ZOYA 3HKCE 2D5UA 5TAOA 3NZQA 5ABEA 5EZYE 5FY0A 4EGWA 2C0SA 3EUHA 2NW7A 2ODVA 3O1IA 4GKKT 2VQET 4YXDA 2C5JA 5L4EA 3PF0A 2AXDS 3KDSE 4U2ZA 2X0YA 2CMRA 1VRBA 3FXEB 3C51A 4O4IE 3RI5A 3P4SA 4IE7A 2NP9A 4XZCA 2OA5A 2XQYA 4IE5A 4IE4A 3AEEA 2XAFB 1D1CA 3RH3A 5A1LA 4DR2T 5LCYA 4YJ3E 4DR4T 1D0XA 2WQYA 2W4XA 2X0CA 3IEEA 1OWAA 1WR6A 3PUSA 4X64T 1MNDA 2J1DG 4YT0A 1D1AA 5AQUB 2X51A 3VRAA 1WR0A 4KUMB 4AI6A 4UR9A 4TNVA 3ZPOA 4ANJA 4H9PC 3WAJA 2DCFA 3PURA 4HEAA 1MMNA 3UQ4A 1HR0T 4TWHA 2C5KT 2HPJA 3OTOT 4PJMA 2WSSV 3ETVA 3AAAB 2LKGA 1I6ZA 2YINA 5FNVE 4P0BA 3DJBA 2VQFT 2X68A 4U33A 5FXZA 1IBMT 4QH5A 3ZMUB 4BJMA 4IE0A 4UXNB 3RYIE 2ZM6T 4DV5T 3RIUC 4HWFA 1VCSA 2KBBA 2BKOA 4DMWA 2X9XA 1UUSA 3KV4A 5JQGE 1YQ3A 2E5LT 4LF6T 2H3RA 3AE3A 5JVDE 4AKLA 2GK9A 3B57A 4V1Av 4IIJE 2IMLA 3AE1A 3LJCA 4HFVA 3RKGA 3R6NA 1YKHB 4JI7T 4UV8B 3X1DA 3U3IA 1J1JA 2LRKA 2BVLA 3GA8A 5C2TA 3AY5A 2LLYA 2XM1A 1UK5A 3VHLA 3PU3A 4YTPA 2Q9QC 1MIYA 3AB3B 3SOLA 1WYBA 3CVRA 4JLEA 3N2KE 3RYHE 4H63H 4YTMA 5FY7A 4TV9E 4L0RA 4ERRA 2ACZA 4ZI3C 4ZXLA 2L10A 2DHRA 2CWYA 2XASB 3JAFA 2X0HA 4O8SA 4AQYT 1B7TA 4ZEYA 3AE5A 5JR9B 2LOPA 1D0YA 3QK6A 4H9NC 1HS7A 1W0AA 3P4RA 5L3CB 5AFUL 3RX6A 2V5CA 4XAXB 1ZKEA 4ZZCA 1FMVA 1IAPA 3PUQA 3AVRA 4DMVA 4JI3T 2XSBA 3ZT5A 4BJNA 4EOZB 1KFYA 5HCMA 2CLYB 4MALA 4IDPA 3VR8A 5LGUB 2BVMA 2KGXA 2BS4A 4IL4A 3CQCB 2LSGA 2F4VT 1VCTA 3J7Yq 3TLWA 4DV2T 2DLRA 2K5BB 3UUNA 1QLBA 2OV9A 3N5LA 1LVFA 4G63A 4A5XA 2ZM0A 1V9DA 4QH1A 1Z0PA 3EDVA 4LF8T 3VKGA 2MOZA 5JH7E 3LK2B 4LF5T 3IBPA 3IHRA 1FEWA 2ZLYA 4ADZA 3AAIA 2CPTA 2WMNA 3UULA 1M62A 1KNRA 5HEUA 3K3NA 3N9OA 5L3FB 2YU1A 2XQ8A 2Z6EA 2Y8DA 2YDSA 3JAEA 4WW0A 5CGMA 4P09A 4TZ4C 2WWVA 1NENA 2LSKA 5LHGB 4ZZBA 2VWAA 3O4XE 1E1HB 4C91A 1S35A 2XQ9A 5FXXA 4F6RC 2YK0A 3C4XA 1G73A 1HX1B 4EYUA 5AQKB 1YKEB 5AQLB 5ADXL 4IDNA 4CZZB 4NUUA 5LJNA 3T1HT 4X66T 4PNIA 4UV9B 4X65T 4DNDA 4FI5A 2SPCA 5C3JA 5FP3A 4EV6A 2MTCA 5T1DA 1J5WA 3HKEE 2V6YB 3OKQA 4ZHQE 3UT5E 4LMKA 4XBFB 4U3CA 2WDQA 2K9AA 2MPKA 2CRBA 4OK0A 1IBLT 2N9DA 4WNKA 1N32T 3H3AA 3P4QA 5LMUT 5CB4E 4CXWA 3NKZA 3KINB 3MACA 2N1GA 3FZHB 1Z8UA 1J5ET 4UIGA 4JI6T 3PJAA 4H63V 4X1KE 1KNZA 2XQ7A 4B6XA 5KDMC 2NR4A 3AEFA 3LK3B 3RGLA 4H9QC 3RHWA 5L3EB 2DNXA 2CEAA 3OYZA 2ZMAA 3QB5A 3L09A 4DV1T 1UCUA 2E9XB 1HX8A 3FZFB 3ZJ1A 5HEOA 5IYZE 5JDHA 2L9QA 2D0TA 4LF7T 2CXDA 2LQUA 5AQOB 2FJBA 4O2BE 2KLQA 3SFEA 3HL6A 3RRCA 2L8KA 2WAUA 3RKOA 3QB5K 4Z8XA 3CWZB 1OEDB 1X9BA 2EHOB 3ZJ2A 5JDMA 2EHOD 2WZHA 2LE8A 2YDRA 3ZKRA 5E0OA 3ZSTA 4DVDA 3FB2A 3ONXA 2CWOA 2V6YA 2JMHA 4MLKA 5HEGA 1HNWT 2WDVA 4CXYA 4H9OC 5KXJA 3MK7C 3RIFA 3MXZA 5HXSA 1MIVA 3AECA 3EAMA 3AAEB 3LSVA 4OFZA 3ONLC 3ETUA 2IC6A 2VKOA 3DYJA 3OVUA 1SHZC 3AXJB 3NRXA 5F8PA 2JMKA 1EZ3A 3N9PA 4NIQA 4OYKA 1SE7A 4E7SA 4B3ST 1T72A 2YEVC 2HPLA 5LB7B 4IE6A 1OXZA 4G2AA 2BKNA 4EAHA 3UU8A 2UU9T 4MHCA 4L9IA 2FJAA 1BR1A 4HFHA 4PFOA 2D2SA 3UU6A 2W62A 5JREA 2E9XA 1Y64B 5M4YA 2VASA 5LNKA 5JDQA 2YOEA 1UURA 3LK42 3PV0F 5ABHA 3PUYF 4OHFA 4WZXA 4PK4A 4HFBA 2R6GF 2WDRA 3MKDA 4C90A 2CXFA 5EK3A 1D0ZA 4HWCA 5BR8T 5HCJA 4NUVA 1S94A 2RPAA 3HI2A 4BA9A 1OEDA 1NAFA 2PG8A 3O1HA 5F5WA 2EHOA 3N9LA 2VVSA 3NWIA 4KP3C 3UUBA 3RIAA 1SUMB 3ZT6A 1GQEA 1NWMX 4PAGA 5LHIB 2PTFA 1WFDA 4AQFC 3CQXC 2H7VC 5LMNT 4AKIA 5ETWA 2WM9A 4UF0B 1WRDA 2DWKA 3CX8B 4ZOLE 3F31A 4UVBB 3I9YA 2NOXA 2D9DA 4I0UA 4HWIB 2J62A 5L3BB 4M1PA 4TWDA 3R84B 3ZMVB 2KVPA 4BGOA 4ILCA 5ABGA 2AE9A 2W0GA 2KT9A 4GYRA 4EB6E 3Q5WA 3PE0A 4DV3T 1XWMA 1IJ6A 2LRLA 3K3OA 3ZT7A 4BAYB 3D0TA 1W09A 4UVAB 3PHF1 3Q9DA 3ZYLA 2JQQA 3ZC1A 3W15B 1XDOA 4GYSA 2XJ7A 2JPFA 3I0OA 5LHHB 2MYSA 4LF9T 1UX4A 3AT7A 3KV9A 2IIUA 3KVBA 3RC8A 3AE8A 3WSCA 5IUXA 2JIWA 2X9HA 3P7IA 2JJ9A 1IBKT 4HTEA 2ZM2A 2LHNA 1AJ3A 5LJMA 2A9UA 3FXDB 5JTGA 1OEDE 1LRZA 3FZKB 4DBRA 2LT3A 4HKAA 3ZCIA 4A98A 5ABFB 4ZI2C 5CA0E 4GK0E 3U78A 1ZEEA 4TN7B 5L4HA 3A8YC 4JUYA 5JDLA 2M6BA 4CN1A 2I59A 3SRZA 4I55E 4IL9A 3P50A 5JRCB 2E2AA 3KFWX 4QHOA 2P9BA 2E5VA 1R8IA 4PJNA 2X9WA 5IWAT 3RYFE 4EEBA 3M3ZB 4W8PA 4LFBT 2XQ5A 3RLFF 1FJGT 2X67A 2MAWA 3WAKA 5FMNA 2YDQA 2FUPA 5LG3A 1HFAA 5FXWA 2CHOA 3NBXX 5FKYA 3KV6A 3PUAA 2VL8A 4EEDA 3HR0A 4YHHT 3AE6A 3JC6D 4P1NA 5EK4A 2M6IA 2J47A 3UUXB 3AA7B 3CX7B 4JYAT 2BS2A 4YSYA 4X1IE 2MTQA 5L3GB 2K48A 5LGTB 3K8PC 5IHYA 2D0UA 2VKJA 1MMGA 3PUGA 3E08A 1ZHCA 4UEMA 4AISA 2J4GA 3AEGA 1W0BA 2KINB 4UVCB 4O4JE 3L8RA 3ZYKA 4JI1T 2KNDA 5HYAA 5AQFB 5LGNB 3SS1A 4X20E 3C50A 3AVSA 2I0MA 1U5PA 4MBQA 5HWYA 5FVLA 1XMOT 5AQIB 5KMGP 3BQIA 4PJLA 5AQGB 5J2TE 2X66A 2XQ3A 2BG9B 2PJQA 3MJXA 3QNUA 5C8YE 5JR9A 3ZN0B 3OBVE 3GMIA 3SFDA 1HG2A 3CPZA 4IDZA 4N78D 2CM0A 5J0ZA 3B13A 3EI0A 2LM2A 3ZN1B 4AQGA 2UXXB 4QX8B 5LBMA 2IDOB 2WP9A 4DUZT 2CA5A 4HGAA 5JDNA 1US7B 4HWHA 4TWFA 3MZKB 3C64A 4F8HA 4ISTA 2E8IA 4ZS2A 4QXCB 3NRYA 2LHRA 2JQ9A 1YD8G 5AQSB 1BR0A 2XQAA 4WBOA 2NTYA 3OYXA 3AE4A 4QXBB 4LMLA 3J9X1 1LKXA 4CQIA 2BDEA 3BQLA 2XY8B 4JI5T 2NWBA 1UX5A 1SJ7A 4H9SE 4WYVA 2NW9A 1IZNB 3QOFA 2UUBT 2A3DA 3IA3A 4Q25A 2KWHA 2XQ6A 2BG9A 3PUZF 4LF4T 4E7ZA 2KXPB 3LBXB 2FJDA 4O4HE 5AQHB 4B3MT 2FBWA 3KV5A 4QKNA 3OPCA 5CJ5A 2KMFA 2E9XD 1LVKA 1O3XA 3KVAA 3BQKA 3C4WA 1HNZT 3AA1B 4QWNB 2WB5A 3T8OA 4EXTA 3A5XA 3AA6B 5L2LA 1XMQT 1G8XA 2LSIA 2DWGA 3C98B 2MBGA 2V7KA 3EVYA 3FYQA 1XZYA 1T7SA 2C5IT 2IC9A 5J1GA 5HXRA 4YSXA 3A7MA 4JV5T 4GK5E 4TX5A 1WLXA 3DTOA 2V7IA 4X1YE 4TUYE 2ZM8A 3N9QA 2BBHA 4PW8A 2BS3A 2Q9QB 4Z90A 3Q5DA 1ZV4X 1HCIA 2LM9A 4DR6T 3PTRB 3ZC0A 4IHJE 1W9RA 2WS3A 5HXEA 4PK6A 4CN4A 1M7KA 1XNQT 3B5MA 5F3JA 2PFVA 1JNZA 2HN1A 3F2EA 2XAGB 2ODUA 1N33T 3IF8B 4K0UA 5DQWA 4GOUA 3CIRA 5LP6E 2WZIA 5HEHA 5HWXA 2BG9E 2H89A 4U7IA 1DU2A 3UUMA 1T8BA 2XM2A 5AQVB 2K24A 1Y01A 2W00A 4AXPA 2IHR1 3AEDA 3V5SA 4YY3T 4ASKA 2YKSA 1YXRA 4P0AA 2LJLA 2W67A 1ZP0A 3PUVF 2OLTA 3TLTA 3RIUA 3AEBA 3DP7A 3UFGA 2JQKA 2UXCT 2LOSA 2VB6A 4F7GB 2VK9A 3H37A 2RP4A 3ZMSB 3HA4A 5H6RB 3I0QA 2IAKA 2YU2A 4DR5T 4A56A 2IUBA 4DIDB 4FJOA 4YFSA 4H9RC 2W61A 2Q9QA 1H7CA 4ILBA 3UFEA 4X62T 4JBWF 3AXJA 4NXNT 2WMOA 2UXBT 5J2UE 5FL0A 2X9YA 3NZPA 3EHZA 2WY2A 1E7PA 3RC3A 2KSRA 4HN9A 1YQ4A
chains in the Genus database with same CATH topology
4DNDA 3NBXX 2SPCA 4FI5A 3KV6A 3PUAA 2XAJB 2HH7A 2VL8A 5FP3A 4AKGA 1QSDA 2V7MA 3HR0A 3RPUA 2VKHA 2MTCA 5T1DA 1MNEA 2X0LB 3JC6D 3HKEE 5DQVA 1QUUA 3S4UA 2QA7A 3CKDA 2DI4A 3OKQA 3PU8A 4PFPA 3UT5E 4ZHQE 5LOVE 4XBFB 3M65A 5LXTE 2XAHB 5EK4A 3LG7A 1HTJF 4ZI3D 4OYJA 4JEUB 2K9AA 3ZEFB 4OK0A 3UUXB 2BZBA 2N9DA 4WNKA 5FYMA 3AA7B 2JRKA 3H3AA 3CX7B 3LBXA 5CB4E 4IGUA 4CXWA 2V1DB 3KINB 3GWHA 3LFMA 4X1IE 4QXHB 3HKBE 1D1BA 2LEHA 2MTQA 3MACA 2E9XC 5L3GB 2K48A 1X79A 4DO0A 2N1GA 5LGTB 3Q5XA 3K8PC 4O4LE 5IHYA 2A72A 2D0UA 2VKJA 1MMGA 5DABA 2XUEA 3PUGA 3E08A 1ZHCA 2WBLA 3N9NA 4UEMA 3ZYMA 2KINB 4UIGA 3ZMTB 4UVCB 4O4JE 4YHJA 4H63V 4X1KE 4PJJA 5LYJE 1KNZA 4B6XA 3ZYKA 2KNDA 5KDMC 2N2NA 4HE8A 5HYAA 2NW8A 4YJ2E 3LK3B 5LGNB 2Y48B 3HKCE 3SS1A 4X20E 2D5UA 4H9QC 3C50A 5TAOA 3NZQA 5EZYE 5FY0A 2EHOC 3AVSA 4MBQA 1U5PA 2CCQA 5HWYA 2C0SA 3EUHA 5L3EB 3FHNA 4ISSA 2DNXA 2NTXA 2NW7A 3KBUA 4UF0A 4J2CA 2CEAA 3OYZA 2ODVA 2ZMAA 3O1IA 5KMGP 3L09A 3BQIA 4PJLA 2V26A 2C5JA 1UCUA 3QC9A 5J2TE 3PF0A 2E9XB 3PDYA 1HX8A 2X66A 4EYYR 3KDSE 4MFRA 3ZJ1A 2G0UA 2PJQA 3MJXA 5IYZE 5JDHA 4ILUA 5H6QB 2L9QA 2CMRA 1VRBA 2H7OA 3FXEB 3C51A 2D0TA 4O4IE 2V7LA 3GN5B 5C8YE 2CXDA 4CI1B 2LQUA 5JR9A 3ZN0B 4IE7A 4O2BE 2KLQA 3OBVE 3GMIA 3O9XA 3HL6A 1HG2A 2NP9A 4XZCA 2L8KA 3RRCA 2OA5A 2WAUA 2XQYA 3RKOA 4Z8XA 4IE5A 3WURA 3CWZB 3CPZA 4IE4A 4IDZA 4N78D 4O2AE 2CM0A 2EHOB 3B13A 2Y6XA 3ZJ2A 5JDMA 2XAFB 1D1CA 2EHOD 2LE8A 5E0OA 3ZN1B 4DVDA 3RH3A 4AQGA 5A1LA 2UXXB 3FB2A 3ONXA 4QX8B 2CXLA 5LBMA 4YJ3E 5LCYA 2CWOA 1D0XA 2JMHA 4MLKA 1MMAA 2CA5A 4HGAA 1FMWA 3IEEA 1OWAA 2LSYA 5JDNA 4CXYA 1WR6A 4H9OC 1MMDA 1US7B 5LBQB 3CQGB 3MZKB 3C64A 3PUSA 3MK7C 5DJQC 3KBTA 5EK2A 3MXZA 5HXHA 3QUJA 4ISTA 2E8IA 5HXSA 1MNDA 1MIVA 2J1DG 4ZS2A 4QXCB 3NRYA 3AAEB 1D1AA 4OFZA 3O1JA 2LHRA 3ETUA 2IC6A 2VKOA 1YD8G 2X51A 1SHZC 4KUMB 3NRXA 5F8PA 4AI6A 2JMKA 1EZ3A 4I43B 3N9PA 3ZPOA 1MIWA 1BR0A 4OYKA 2XTLA 4WBOA 4E7SA 4ANJA 4AKRB 4H9PC 2NTYA 3WAJA 2DCFA 3PURA 4HEAA 1MMNA 4I4TE 2YEVC 3OYXA 2HPLA 4IE6A 2C5KT 5L3DB 1OXZA 1BR2A 2HPJA 4G2AA 4QXBB 4EAHA 3M1CA 4PJMA 3J9X1 1LKXA 2WSSV 3ETVA 3AAAB 4CQIA 2BDEA 4MHCA 2XAQB 4L9IA 3BQLA 2YINA 5FNVE 1WYCA 1T98A 2UXNB 1BR1A 4P0BA 3ANWB 3F57A 3DJBA 2NWBA 4PFOA 2ACXA 2X68A 2D2SA 2W62A 1UX5A 4H9SE 5FXZA 5JREA 2NW9A 1IZNB 2E9XA 1Y64B 3ZMUB 2A3DA 4BJMA 5M4YA 4IE0A 4QX7B 2KWHA 4UXNB 2VASA 5LNKA 3RYIE 5JDQA 4E7ZA 2KXPB 4I50E 3LBXB 3BK9A 2KZ7B 3ESLA 3GN5A 3LK42 4KBMB 3EDUA 4O4HE 5LA6E 4DMWA 2X9XA 4OHFA 3KV5A 3KV4A 5JQGE 3I1AA 4QKNA 4PK4A 5JRCA 3WI3A 2H3RA 3MKDA 2KMFA 5JVDE 4C90A 4AKLA 2CXFA 5EK3A 1D0ZA 2GK9A 2E9XD 3B57A 3VKHA 4NUVA 1S94A 3HI2A 4V1Av 4IIJE 1LVKA 1O3XA 4BA9A 1NAFA 3KVAA 3BQKA 3C4WA 3LJCA 4HFVA 2PG8A 3O1HA 3R6NA 3AA1B 2EHOA 1YKHB 3N9LA 4QWNB 4UV8B 3U3IA 3GA8A 2BVLA 4KP3C 2CE7A 3T8OA 4EXTA 2VKDA 3A5XA 3OJAA 3PU3A 3VHLA 1NWMX 2Q9QC 3AA6B 3ZLIA 4PAGA 3RRWA 4YLHA 1G8XA 5LHIB 5L2LA 5HAXA 2LSIA 4UELA 4AQFC 2LSJA 1CUNA 4ECGA 1MIYA 3CQXC 2DWGA 3FBLA 2H7VC 2RA1A 3AB3B 3SOLA 3C98B 2IW5B 1WYBA 3CVRA 4JLEA 5ETWA 2WM9A 4PK5A 3N2KE 4UF0B 2MBGA 4AKIA 2V7KA 4JEHB 3E22E 3RYHE 1WRDA 2DWKA 3CX8B 4ZOLE 4H63H 3F31A 5FY7A 4CXXA 4UVBB 3EVYA 4U72A 4TV9E 3I9YA 4L0RA 2NOXA 4ERRA 4ZI3C 4CI3B 2DHRA 5L3BB 2C5IT 2IC9A 4M1PA 2CWYA 5LG4A 5J1GA 2XASB 5HXRA 4O8SA 3HKDE 3R84B 1B7TA 1IJ5A 2M67A 3ZMVB 5JDFA 4GK5E 4TX5A 1U4QA 1WLXA 3DTOA 2V7IA 3TKLB 3ZMZB 4X1YE 5JR9B 4TUYE 2LOPA 2ZM8A 1D0YA 3QK6A 3I9WA 4H9NC 1HS7A 3VU7H 3N9QA 4BGOA 5L3CB 1VOMA 3Q2MA 3UTKA 5AFUL 3RX6A 4PW8A 2W0GA 4TV8E 2KT9A 4GYRA 2Q9QB 4XAXB 1ZKEA 4EB6E 3Q5WA 5FXVA 3E0ZA 1FMVA 1IAPA 3PE0A 3AVRA 3PUQA 1ZV4X 1HCIA 4DMVA 5BMVE 2LM9A 1HG5A 1IJ6A 3PTRB 4BJNA 5KX5E 4EOZB 4L5GA 3K3OA 3ZC0A 3ANWA 4IHJE 4BAYB 5HXEA 1YW0A 3D0TA 4PK6A 3N9MA 2CLYB 4MALA 4UVAB 3PHF1 3Q9DA 5LGUB 2BVMA 2PFVA 5F3JA 3ZYLA 1SA0E 2JQQA 1HF8A 3ZC1A 1FIOA 3F2EA 3W15B 3CQCB 4GYSA 2XAGB 4DBQA 2ODUA 2ES0A 2KWIB 2LSGA 2JPFA 3IF8B 3I0OA 4K0UA 5DQWA 4GOUA 3J7Yq 2DLRA 2K5BB 3CMLA 3N2GE 5LHHB 5LP6E 3VJZA 3UUNA 2MYSA 1UX4A 5GONE 3AT7A 3KV9A 5HWXA 3KVBA 3RC8A 3N5LA 3MA9A 2A2FX 3WSCA 3V5UA 4CI2B 2X9HA 1LVFA 3C4ZA 3P7IA 4G63A 3P8CD 2JJ9A 2QGSA 1KK7A 2ZM0A 4HTEA 1V9DA 2ZM2A 4KMCA 3UUMA 1Z0PA 3AA0B 2K24A 3EDVA 4ONRA 4EZ4A 2W00A 2LHNA 4AXPA 1AJ3A 5LJMA 2V7JA 3VKGA 2MOZA 5JH7E 3LK2B 3IBPA 3IHRA 1FEWA 3V5SA 4ZI7E 3N2OA 2ZLYA 4ASKA 3FXDB 4EZHA 4ADZA 4P0AA 3AAIA 2LJLA 1LRZA 5JR9C 4GIWA 3CX6B 4DBRA 3K3QC 2LT3A 4HKAA 2WMNA 5HXCA 3UULA 4WBNE 3ZCIA 4AKHA 3DP7A 2LOSA 5FY1A 2L3LA 3K3NA 4ZI2C 5CA0E 3N9OA 2VB6A 4GK0E 3U78A 1ZEEA 2VK9A 5JDGA 5L3FB 2W63A 3H37A 4TN7B 2RP4A 2YU1A 5CA1E 3SWHA 3ZMSB 4JUYA 5JDLA 3HA4A 5H6RB 2Z6EA 3I0QA 3JC6C 2Y8DA 2I59A 2IAKA 3SRZA 2YU2A 4I55E 4A56A 2XHEB 5JRCB 4WW0A 3KFWX 2CLYC 4QHOA 4ZS3A 3L3PA 3RYCE 4P09A 4FJOA 2P9BA 4YFSA 4TZ4C 4H9RC 2W61A 2Q9QA 2LSKA 4PJNA 5LHGB 1H7CA 3UFEA 2X9WA 2VWAA 3O4XE 1E1HB 4AQFA 4C91A 3RYFE 1S35A 5FXXA 2WMOA 4F6RC 2PBIA 2YK0A 3C4XA 5J2UE 1G73A 2X9YA 4EYUA 2X67A 1YKEB 3ZCJA 4U74A 2WWUA 3WAKA 4EIWA 5ADXL 3NZPA 5FMNA 3RC3A 4CZZB 4NUUA 5LJNA 2Q9QD 4HN9A 4ZI2D 2B1EA 1HFAA 5FXWA 1BR4A 4PNIA 4UV9B 3FBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDL A;  5JDG A;  5HXC A;  5HYA A;  5HXR A;  5HWY A;  5JDN A;  3V5S A;  3V5U A;  5JDM A;  5JDQ A;  5JDH A;  5HXH A;  5HXE A;  5HXS A;  5HWX A;  5JDF A; 
#chains in the Genus database with same CATH topology
 2XAJ B;  2HH7 A;  3K1S A;  4AKG A;  2L7N A;  2V7M A;  3RPU A;  1MNE A;  3PU8 A;  3M65 A;  3LG7 A;  2QRX A;  3ZEF B;  5FYM A;  2JRK A;  3EAB A;  4IGU A;  1KF6 A;  3LFM A;  3UU5 A;  3HKB E;  2E9X C;  2JQH A;  1HNX T;  1X79 A;  2UUC T;  2A72 A;  5DAB A;  2WBL A;  5FL1 A;  3N9N A;  3ZYM A;  4X5T A;  3ZMT B;  4YHJ A;  1UGO A;  2XSA A;  4HFI A;  1N36 T;  4HE8 A;  2NW8 A;  4YJ2 E;  1OED C;  2Y48 B;  4DV7 T;  4JI2 T;  5HEJ A;  2EHO C;  2CCQ A;  1N34 T;  4IDO A;  3FHN A;  4ISS A;  2NTX A;  2UXD T;  3KBU A;  4UF0 A;  4J2C A;  4LMJ A;  2V26 A;  4DR1 T;  3PUW F;  4GKJ T;  3QC9 A;  3PDY A;  3RQW A;  4EYY R;  4MFR A;  2G0U A;  4ILU A;  5H6Q B;  2H7O A;  2V7L A;  3GN5 B;  4CI1 B;  2WCA A;  4ILA A;  3O9X A;  4HFE A;  1KEY A;  3WUR A;  4O2A E;  4CN6 A;  4A97 A;  2Y6X A;  3PJA J;  3P4W A;  2CXL A;  5CFB A;  3LDQ B;  2VUR A;  1MMA A;  1FMW A;  2LSY A;  1MMD A;  5LBQ B;  3CQG B;  3FZL B;  3H3M A;  5DJQ C;  3KBT A;  5EK2 A;  5HXH A;  3QUJ A;  4K0K T;  4IDQ A;  3Q5E A;  4U7Y A;  4KI0 F;  2BBJ A;  3O1J A;  3P4P A;  4I43 B;  3CK6 A;  3RF1 A;  1MIW A;  2XTL A;  4AKR B;  1WCR A;  4IT4 A;  4I4T E;  4KHZ F;  3PUX F;  5L3D B;  4DR7 T;  1BR2 A;  3JCF A;  3M1C A;  5FZT A;  2XAQ B;  1WYC A;  1T98 A;  2UXN B;  3ANW B;  3F57 A;  2ACX A;  1SJ8 A;  2UUA T;  5ABF A;  4DUY T;  4B3R T;  4QX7 B;  5AQQ B;  4Z91 A;  4I50 E;  3BK9 A;  2KZ7 B;  3ESL A;  3GN5 A;  4KBM B;  3EDU A;  5LA6 E;  1JNR A;  1CHU A;  3I1A A;  5JRC A;  3WI3 A;  4KHP T;  3VKH A;  1L0V A;  5AQN B;  3AE9 A;  3UQ7 A;  4JI4 T;  2CE7 A;  2LKH A;  2BKP A;  3FZM B;  3RQU A;  2CHN A;  4TNW A;  3UU3 A;  4DV0 T;  2VKD A;  3OJA A;  2W2U A;  3ZLI A;  3RRW A;  4YLH A;  5HAX A;  4UEL A;  3ABV A;  2VVN A;  2LSJ A;  1CUN A;  4ECG A;  3FBL A;  2RA1 A;  2IW5 B;  4PK5 A;  4JEH B;  3E22 E;  4CXX A;  4U72 A;  3ZSS A;  2HHH T;  2CBJ A;  5L47 A;  4U31 A;  4CI3 B;  5LG4 A;  2K3W A;  2HN2 A;  3HKD E;  1IJ5 A;  2M67 A;  2XQ4 A;  5JDF A;  4OX9 T;  1U4Q A;  3TKL B;  3ZMZ B;  4B3T T;  3I9W A;  3VU7 H;  1VOM A;  3Q2M A;  3UTK A;  3G06 A;  4TV8 E;  4AIU A;  5FXV A;  3E0Z A;  5BMV E;  3L39 A;  1HG5 A;  3JAD A;  5KX5 E;  4L5G A;  3ANW A;  4DV6 T;  1YW0 A;  3N9M A;  2XZE A;  1SA0 E;  1HF8 A;  1FIO A;  1KNP A;  4DBQ A;  2ES0 A;  2KWI B;  2QYW A;  2V5D A;  3CML A;  3N2G E;  3VJZ A;  4YTN A;  5GON E;  2XPK A;  3MA9 A;  2A2F X;  3V5U A;  4CI2 B;  3C4Z A;  3UU4 A;  3P8C D;  2H88 A;  1KK7 A;  2QGS A;  4KMC A;  1XNR T;  3AA0 B;  4ONR A;  4EZ4 A;  2YN6 A;  3TLV A;  2V7J A;  5AQR B;  4ZI7 E;  3N2O A;  4IRE A;  4EZH A;  1I94 T;  5JR9 C;  4GIW A;  3CX6 B;  3T1Y T;  3K3Q C;  4DV4 T;  1E2A A;  5HXC A;  4WBN E;  4COF A;  4AKH A;  3AE2 A;  5FY1 A;  2L3L A;  4YSZ A;  5JDG A;  4DR3 T;  4NXM T;  2W63 A;  5CA1 E;  3SWH A;  3JC6 C;  2DL1 A;  2XHE B;  2VL0 A;  2CLY C;  4ZS3 A;  3L3P A;  3RYC E;  2WU2 A;  3AE7 A;  4U2Y A;  3ONJ A;  4AQF A;  4QH4 A;  3VRB A;  2PBI A;  2W66 A;  3ZCJ A;  4U74 A;  2WWU A;  4EIW A;  1NEK A;  2Q9Q D;  4LFC T;  4ZI2 D;  2B1E A;  1BR4 A;  3FBZ A;  4JI0 T;  4LFA T;  4JI8 T;  1QSD A;  2VKH A;  2FJE A;  2X0L B;  5DQV A;  1QUU A;  1XDP A;  3AEA A;  3S4U A;  2QA7 A;  3CKD A;  2DI4 A;  4PFP A;  5AQP B;  5LOV E;  5LXT E;  2XAH B;  1HTJ F;  3TLU A;  5AQT B;  4ZI3 D;  4OYJ A;  4JEU B;  3VR9 A;  2B76 A;  2V6X A;  2BZB A;  3LBX A;  4NPP A;  5FVK A;  2V1D B;  3GWH A;  4HFD A;  4QXH B;  1D1B A;  2LEH A;  4DO0 A;  3TLS A;  2BG9 C;  3Q5X A;  4HFC A;  4O4L E;  2CBI A;  2XUE A;  3NVO A;  2I6H A;  2WU5 A;  4HWD A;  4KX6 A;  4PJJ A;  5LYJ E;  5AQM B;  5AQJ B;  2N2N A;  2QVA A;  2V8S V;  1ZOY A;  3HKC E;  2D5U A;  5TAO A;  3NZQ A;  5ABE A;  5EZY E;  5FY0 A;  4EGW A;  2C0S A;  3EUH A;  2NW7 A;  2ODV A;  3O1I A;  4GKK T;  2VQE T;  4YXD A;  2C5J A;  5L4E A;  3PF0 A;  2AXD S;  3KDS E;  4U2Z A;  2X0Y A;  2CMR A;  1VRB A;  3FXE B;  3C51 A;  4O4I E;  3RI5 A;  3P4S A;  4IE7 A;  2NP9 A;  4XZC A;  2OA5 A;  2XQY A;  4IE5 A;  4IE4 A;  3AEE A;  2XAF B;  1D1C A;  3RH3 A;  5A1L A;  4DR2 T;  5LCY A;  4YJ3 E;  4DR4 T;  1D0X A;  2WQY A;  2W4X A;  2X0C A;  3IEE A;  1OWA A;  1WR6 A;  3PUS A;  4X64 T;  1MND A;  2J1D G;  4YT0 A;  1D1A A;  5AQU B;  2X51 A;  3VRA A;  1WR0 A;  4KUM B;  4AI6 A;  4UR9 A;  4TNV A;  3ZPO A;  4ANJ A;  4H9P C;  3WAJ A;  2DCF A;  3PUR A;  4HEA A;  1MMN A;  3UQ4 A;  1HR0 T;  4TWH A;  2C5K T;  2HPJ A;  3OTO T;  4PJM A;  2WSS V;  3ETV A;  3AAA B;  2LKG A;  1I6Z A;  2YIN A;  5FNV E;  4P0B A;  3DJB A;  2VQF T;  2X68 A;  4U33 A;  5FXZ A;  1IBM T;  4QH5 A;  3ZMU B;  4BJM A;  4IE0 A;  4UXN B;  3RYI E;  2ZM6 T;  4DV5 T;  3RIU C;  4HWF A;  1VCS A;  2KBB A;  2BKO A;  4DMW A;  2X9X A;  1UUS A;  3KV4 A;  5JQG E;  1YQ3 A;  2E5L T;  4LF6 T;  2H3R A;  3AE3 A;  5JVD E;  4AKL A;  2GK9 A;  3B57 A;  4V1A v;  4IIJ E;  2IML A;  3AE1 A;  3LJC A;  4HFV A;  3RKG A;  3R6N A;  1YKH B;  4JI7 T;  4UV8 B;  3X1D A;  3U3I A;  1J1J A;  2LRK A;  2BVL A;  3GA8 A;  5C2T A;  3AY5 A;  2LLY A;  2XM1 A;  1UK5 A;  3VHL A;  3PU3 A;  4YTP A;  2Q9Q C;  1MIY A;  3AB3 B;  3SOL A;  1WYB A;  3CVR A;  4JLE A;  3N2K E;  3RYH E;  4H63 H;  4YTM A;  5FY7 A;  4TV9 E;  4L0R A;  4ERR A;  2ACZ A;  4ZI3 C;  4ZXL A;  2L10 A;  2DHR A;  2CWY A;  2XAS B;  3JAF A;  2X0H A;  4O8S A;  4AQY T;  1B7T A;  4ZEY A;  3AE5 A;  5JR9 B;  2LOP A;  1D0Y A;  3QK6 A;  4H9N C;  1HS7 A;  1W0A A;  3P4R A;  5L3C B;  5AFU L;  3RX6 A;  2V5C A;  4XAX B;  1ZKE A;  4ZZC A;  1FMV A;  1IAP A;  3PUQ A;  3AVR A;  4DMV A;  4JI3 T;  2XSB A;  3ZT5 A;  4BJN A;  4EOZ B;  1KFY A;  5HCM A;  2CLY B;  4MAL A;  4IDP A;  3VR8 A;  5LGU B;  2BVM A;  2KGX A;  2BS4 A;  4IL4 A;  3CQC B;  2LSG A;  2F4V T;  1VCT A;  3J7Y q;  3TLW A;  4DV2 T;  2DLR A;  2K5B B;  3UUN A;  1QLB A;  2OV9 A;  3N5L A;  1LVF A;  4G63 A;  4A5X A;  2ZM0 A;  1V9D A;  4QH1 A;  1Z0P A;  3EDV A;  4LF8 T;  3VKG A;  2MOZ A;  5JH7 E;  3LK2 B;  4LF5 T;  3IBP A;  3IHR A;  1FEW A;  2ZLY A;  4ADZ A;  3AAI A;  2CPT A;  2WMN A;  3UUL A;  1M62 A;  1KNR A;  5HEU A;  3K3N A;  3N9O A;  5L3F B;  2YU1 A;  2XQ8 A;  2Z6E A;  2Y8D A;  2YDS A;  3JAE A;  4WW0 A;  5CGM A;  4P09 A;  4TZ4 C;  2WWV A;  1NEN A;  2LSK A;  5LHG B;  4ZZB A;  2VWA A;  3O4X E;  1E1H B;  4C91 A;  1S35 A;  2XQ9 A;  5FXX A;  4F6R C;  2YK0 A;  3C4X A;  1G73 A;  1HX1 B;  4EYU A;  5AQK B;  1YKE B;  5AQL B;  5ADX L;  4IDN A;  4CZZ B;  4NUU A;  5LJN A;  3T1H T;  4X66 T;  4PNI A;  4UV9 B;  4X65 T;  4DND A;  4FI5 A;  2SPC A;  5C3J A;  5FP3 A;  4EV6 A;  2MTC A;  5T1D A;  1J5W A;  3HKE E;  2V6Y B;  3OKQ A;  4ZHQ E;  3UT5 E;  4LMK A;  4XBF B;  4U3C A;  2WDQ A;  2K9A A;  2MPK A;  2CRB A;  4OK0 A;  1IBL T;  2N9D A;  4WNK A;  1N32 T;  3H3A A;  3P4Q A;  5LMU T;  5CB4 E;  4CXW A;  3NKZ A;  3KIN B;  3MAC A;  2N1G A;  3FZH B;  1Z8U A;  1J5E T;  4UIG A;  4JI6 T;  3PJA A;  4H63 V;  4X1K E;  1KNZ A;  2XQ7 A;  4B6X A;  5KDM C;  2NR4 A;  3AEF A;  3LK3 B;  3RGL A;  4H9Q C;  3RHW A;  5L3E B;  2DNX A;  2CEA A;  3OYZ A;  2ZMA A;  3QB5 A;  3L09 A;  4DV1 T;  1UCU A;  2E9X B;  1HX8 A;  3FZF B;  3ZJ1 A;  5HEO A;  5IYZ E;  5JDH A;  2L9Q A;  2D0T A;  4LF7 T;  2CXD A;  2LQU A;  5AQO B;  2FJB A;  4O2B E;  2KLQ A;  3SFE A;  3HL6 A;  3RRC A;  2L8K A;  2WAU A;  3RKO A;  3QB5 K;  4Z8X A;  3CWZ B;  1OED B;  1X9B A;  2EHO B;  3ZJ2 A;  5JDM A;  2EHO D;  2WZH A;  2LE8 A;  2YDR A;  3ZKR A;  5E0O A;  3ZST A;  4DVD A;  3FB2 A;  3ONX A;  2CWO A;  2V6Y A;  2JMH A;  4MLK A;  5HEG A;  1HNW T;  2WDV A;  4CXY A;  4H9O C;  5KXJ A;  3MK7 C;  3RIF A;  3MXZ A;  5HXS A;  1MIV A;  3AEC A;  3EAM A;  3AAE B;  3LSV A;  4OFZ A;  3ONL C;  3ETU A;  2IC6 A;  2VKO A;  3DYJ A;  3OVU A;  1SHZ C;  3AXJ B;  3NRX A;  5F8P A;  2JMK A;  1EZ3 A;  3N9P A;  4NIQ A;  4OYK A;  1SE7 A;  4E7S A;  4B3S T;  1T72 A;  2YEV C;  2HPL A;  5LB7 B;  4IE6 A;  1OXZ A;  4G2A A;  2BKN A;  4EAH A;  3UU8 A;  2UU9 T;  4MHC A;  4L9I A;  2FJA A;  1BR1 A;  4HFH A;  4PFO A;  2D2S A;  3UU6 A;  2W62 A;  5JRE A;  2E9X A;  1Y64 B;  5M4Y A;  2VAS A;  5LNK A;  5JDQ A;  2YOE A;  1UUR A;  3LK4 2;  3PV0 F;  5ABH A;  3PUY F;  4OHF A;  4WZX A;  4PK4 A;  4HFB A;  2R6G F;  2WDR A;  3MKD A;  4C90 A;  2CXF A;  5EK3 A;  1D0Z A;  4HWC A;  5BR8 T;  5HCJ A;  4NUV A;  1S94 A;  2RPA A;  3HI2 A;  4BA9 A;  1OED A;  1NAF A;  2PG8 A;  3O1H A;  5F5W A;  2EHO A;  3N9L A;  2VVS A;  3NWI A;  4KP3 C;  3UUB A;  3RIA A;  1SUM B;  3ZT6 A;  1GQE A;  1NWM X;  4PAG A;  5LHI B;  2PTF A;  1WFD A;  4AQF C;  3CQX C;  2H7V C;  5LMN T;  4AKI A;  5ETW A;  2WM9 A;  4UF0 B;  1WRD A;  2DWK A;  3CX8 B;  4ZOL E;  3F31 A;  4UVB B;  3I9Y A;  2NOX A;  2D9D A;  4I0U A;  4HWI B;  2J62 A;  5L3B B;  4M1P A;  4TWD A;  3R84 B;  3ZMV B;  2KVP A;  4BGO A;  4ILC A;  5ABG A;  2AE9 A;  2W0G A;  2KT9 A;  4GYR A;  4EB6 E;  3Q5W A;  3PE0 A;  4DV3 T;  1XWM A;  1IJ6 A;  2LRL A;  3K3O A;  3ZT7 A;  4BAY B;  3D0T A;  1W09 A;  4UVA B;  3PHF 1;  3Q9D A;  3ZYL A;  2JQQ A;  3ZC1 A;  3W15 B;  1XDO A;  4GYS A;  2XJ7 A;  2JPF A;  3I0O A;  5LHH B;  2MYS A;  4LF9 T;  1UX4 A;  3AT7 A;  3KV9 A;  2IIU A;  3KVB A;  3RC8 A;  3AE8 A;  3WSC A;  5IUX A;  2JIW A;  2X9H A;  3P7I A;  2JJ9 A;  1IBK T;  4HTE A;  2ZM2 A;  2LHN A;  1AJ3 A;  5LJM A;  2A9U A;  3FXD B;  5JTG A;  1OED E;  1LRZ A;  3FZK B;  4DBR A;  2LT3 A;  4HKA A;  3ZCI A;  4A98 A;  5ABF B;  4ZI2 C;  5CA0 E;  4GK0 E;  3U78 A;  1ZEE A;  4TN7 B;  5L4H A;  3A8Y C;  4JUY A;  5JDL A;  2M6B A;  4CN1 A;  2I59 A;  3SRZ A;  4I55 E;  4IL9 A;  3P50 A;  5JRC B;  2E2A A;  3KFW X;  4QHO A;  2P9B A;  2E5V A;  1R8I A;  4PJN A;  2X9W A;  5IWA T;  3RYF E;  4EEB A;  3M3Z B;  4W8P A;  4LFB T;  2XQ5 A;  3RLF F;  1FJG T;  2X67 A;  2MAW A;  3WAK A;  5FMN A;  2YDQ A;  2FUP A;  5LG3 A;  1HFA A;  5FXW A;  2CHO A;  3NBX X;  5FKY A;  3KV6 A;  3PUA A;  2VL8 A;  4EED A;  3HR0 A;  4YHH T;  3AE6 A;  3JC6 D;  4P1N A;  5EK4 A;  2M6I A;  2J47 A;  3UUX B;  3AA7 B;  3CX7 B;  4JYA T;  2BS2 A;  4YSY A;  4X1I E;  2MTQ A;  5L3G B;  2K48 A;  5LGT B;  3K8P C;  5IHY A;  2D0U A;  2VKJ A;  1MMG A;  3PUG A;  3E08 A;  1ZHC A;  4UEM A;  4AIS A;  2J4G A;  3AEG A;  1W0B A;  2KIN B;  4UVC B;  4O4J E;  3L8R A;  3ZYK A;  4JI1 T;  2KND A;  5HYA A;  5AQF B;  5LGN B;  3SS1 A;  4X20 E;  3C50 A;  3AVS A;  2I0M A;  1U5P A;  4MBQ A;  5HWY A;  5FVL A;  1XMO T;  5AQI B;  5KMG P;  3BQI A;  4PJL A;  5AQG B;  5J2T E;  2X66 A;  2XQ3 A;  2BG9 B;  2PJQ A;  3MJX A;  3QNU A;  5C8Y E;  5JR9 A;  3ZN0 B;  3OBV E;  3GMI A;  3SFD A;  1HG2 A;  3CPZ A;  4IDZ A;  4N78 D;  2CM0 A;  5J0Z A;  3B13 A;  3EI0 A;  2LM2 A;  3ZN1 B;  4AQG A;  2UXX B;  4QX8 B;  5LBM A;  2IDO B;  2WP9 A;  4DUZ T;  2CA5 A;  4HGA A;  5JDN A;  1US7 B;  4HWH A;  4TWF A;  3MZK B;  3C64 A;  4F8H A;  4IST A;  2E8I A;  4ZS2 A;  4QXC B;  3NRY A;  2LHR A;  2JQ9 A;  1YD8 G;  5AQS B;  1BR0 A;  2XQA A;  4WBO A;  2NTY A;  3OYX A;  3AE4 A;  4QXB B;  4LML A;  3J9X 1;  1LKX A;  4CQI A;  2BDE A;  3BQL A;  2XY8 B;  4JI5 T;  2NWB A;  1UX5 A;  1SJ7 A;  4H9S E;  4WYV A;  2NW9 A;  1IZN B;  3QOF A;  2UUB T;  2A3D A;  3IA3 A;  4Q25 A;  2KWH A;  2XQ6 A;  2BG9 A;  3PUZ F;  4LF4 T;  4E7Z A;  2KXP B;  3LBX B;  2FJD A;  4O4H E;  5AQH B;  4B3M T;  2FBW A;  3KV5 A;  4QKN A;  3OPC A;  5CJ5 A;  2KMF A;  2E9X D;  1LVK A;  1O3X A;  3KVA A;  3BQK A;  3C4W A;  1HNZ T;  3AA1 B;  4QWN B;  2WB5 A;  3T8O A;  4EXT A;  3A5X A;  3AA6 B;  5L2L A;  1XMQ T;  1G8X A;  2LSI A;  2DWG A;  3C98 B;  2MBG A;  2V7K A;  3EVY A;  3FYQ A;  1XZY A;  1T7S A;  2C5I T;  2IC9 A;  5J1G A;  5HXR A;  4YSX A;  3A7M A;  4JV5 T;  4GK5 E;  4TX5 A;  1WLX A;  3DTO A;  2V7I A;  4X1Y E;  4TUY E;  2ZM8 A;  3N9Q A;  2BBH A;  4PW8 A;  2BS3 A;  2Q9Q B;  4Z90 A;  3Q5D A;  1ZV4 X;  1HCI A;  2LM9 A;  4DR6 T;  3PTR B;  3ZC0 A;  4IHJ E;  1W9R A;  2WS3 A;  5HXE A;  4PK6 A;  4CN4 A;  1M7K A;  1XNQ T;  3B5M A;  5F3J A;  2PFV A;  1JNZ A;  2HN1 A;  3F2E A;  2XAG B;  2ODU A;  1N33 T;  3IF8 B;  4K0U A;  5DQW A;  4GOU A;  3CIR A;  5LP6 E;  2WZI A;  5HEH A;  5HWX A;  2BG9 E;  2H89 A;  4U7I A;  1DU2 A;  3UUM A;  1T8B A;  2XM2 A;  5AQV B;  2K24 A;  1Y01 A;  2W00 A;  4AXP A;  2IHR 1;  3AED A;  3V5S A;  4YY3 T;  4ASK A;  2YKS A;  1YXR A;  4P0A A;  2LJL A;  2W67 A;  1ZP0 A;  3PUV F;  2OLT A;  3TLT A;  3RIU A;  3AEB A;  3DP7 A;  3UFG A;  2JQK A;  2UXC T;  2LOS A;  2VB6 A;  4F7G B;  2VK9 A;  3H37 A;  2RP4 A;  3ZMS B;  3HA4 A;  5H6R B;  3I0Q A;  2IAK A;  2YU2 A;  4DR5 T;  4A56 A;  2IUB A;  4DID B;  4FJO A;  4YFS A;  4H9R C;  2W61 A;  2Q9Q A;  1H7C A;  4ILB A;  3UFE A;  4X62 T;  4JBW F;  3AXJ A;  4NXN T;  2WMO A;  2UXB T;  5J2U E;  5FL0 A;  2X9Y A;  3NZP A;  3EHZ A;  2WY2 A;  1E7P A;  3RC3 A;  2KSR A;  4HN9 A;  1YQ4 A; 
#chains in the Genus database with same CATH homology
 4DND A;  3NBX X;  2SPC A;  4FI5 A;  3KV6 A;  3PUA A;  2XAJ B;  2HH7 A;  2VL8 A;  5FP3 A;  4AKG A;  1QSD A;  2V7M A;  3HR0 A;  3RPU A;  2VKH A;  2MTC A;  5T1D A;  1MNE A;  2X0L B;  3JC6 D;  3HKE E;  5DQV A;  1QUU A;  3S4U A;  2QA7 A;  3CKD A;  2DI4 A;  3OKQ A;  3PU8 A;  4PFP A;  3UT5 E;  4ZHQ E;  5LOV E;  4XBF B;  3M65 A;  5LXT E;  2XAH B;  5EK4 A;  3LG7 A;  1HTJ F;  4ZI3 D;  4OYJ A;  4JEU B;  2K9A A;  3ZEF B;  4OK0 A;  3UUX B;  2BZB A;  2N9D A;  4WNK A;  5FYM A;  3AA7 B;  2JRK A;  3H3A A;  3CX7 B;  3LBX A;  5CB4 E;  4IGU A;  4CXW A;  2V1D B;  3KIN B;  3GWH A;  3LFM A;  4X1I E;  4QXH B;  3HKB E;  1D1B A;  2LEH A;  2MTQ A;  3MAC A;  2E9X C;  5L3G B;  2K48 A;  1X79 A;  4DO0 A;  2N1G A;  5LGT B;  3Q5X A;  3K8P C;  4O4L E;  5IHY A;  2A72 A;  2D0U A;  2VKJ A;  1MMG A;  5DAB A;  2XUE A;  3PUG A;  3E08 A;  1ZHC A;  2WBL A;  3N9N A;  4UEM A;  3ZYM A;  2KIN B;  4UIG A;  3ZMT B;  4UVC B;  4O4J E;  4YHJ A;  4H63 V;  4X1K E;  4PJJ A;  5LYJ E;  1KNZ A;  4B6X A;  3ZYK A;  2KND A;  5KDM C;  2N2N A;  4HE8 A;  5HYA A;  2NW8 A;  4YJ2 E;  3LK3 B;  5LGN B;  2Y48 B;  3HKC E;  3SS1 A;  4X20 E;  2D5U A;  4H9Q C;  3C50 A;  5TAO A;  3NZQ A;  5EZY E;  5FY0 A;  2EHO C;  3AVS A;  4MBQ A;  1U5P A;  2CCQ A;  5HWY A;  2C0S A;  3EUH A;  5L3E B;  3FHN A;  4ISS A;  2DNX A;  2NTX A;  2NW7 A;  3KBU A;  4UF0 A;  4J2C A;  2CEA A;  3OYZ A;  2ODV A;  2ZMA A;  3O1I A;  5KMG P;  3L09 A;  3BQI A;  4PJL A;  2V26 A;  2C5J A;  1UCU A;  3QC9 A;  5J2T E;  3PF0 A;  2E9X B;  3PDY A;  1HX8 A;  2X66 A;  4EYY R;  3KDS E;  4MFR A;  3ZJ1 A;  2G0U A;  2PJQ A;  3MJX A;  5IYZ E;  5JDH A;  4ILU A;  5H6Q B;  2L9Q A;  2CMR A;  1VRB A;  2H7O A;  3FXE B;  3C51 A;  2D0T A;  4O4I E;  2V7L A;  3GN5 B;  5C8Y E;  2CXD A;  4CI1 B;  2LQU A;  5JR9 A;  3ZN0 B;  4IE7 A;  4O2B E;  2KLQ A;  3OBV E;  3GMI A;  3O9X A;  3HL6 A;  1HG2 A;  2NP9 A;  4XZC A;  2L8K A;  3RRC A;  2OA5 A;  2WAU A;  2XQY A;  3RKO A;  4Z8X A;  4IE5 A;  3WUR A;  3CWZ B;  3CPZ A;  4IE4 A;  4IDZ A;  4N78 D;  4O2A E;  2CM0 A;  2EHO B;  3B13 A;  2Y6X A;  3ZJ2 A;  5JDM A;  2XAF B;  1D1C A;  2EHO D;  2LE8 A;  5E0O A;  3ZN1 B;  4DVD A;  3RH3 A;  4AQG A;  5A1L A;  2UXX B;  3FB2 A;  3ONX A;  4QX8 B;  2CXL A;  5LBM A;  4YJ3 E;  5LCY A;  2CWO A;  1D0X A;  2JMH A;  4MLK A;  1MMA A;  2CA5 A;  4HGA A;  1FMW A;  3IEE A;  1OWA A;  2LSY A;  5JDN A;  4CXY A;  1WR6 A;  4H9O C;  1MMD A;  1US7 B;  5LBQ B;  3CQG B;  3MZK B;  3C64 A;  3PUS A;  3MK7 C;  5DJQ C;  3KBT A;  5EK2 A;  3MXZ A;  5HXH A;  3QUJ A;  4IST A;  2E8I A;  5HXS A;  1MND A;  1MIV A;  2J1D G;  4ZS2 A;  4QXC B;  3NRY A;  3AAE B;  1D1A A;  4OFZ A;  3O1J A;  2LHR A;  3ETU A;  2IC6 A;  2VKO A;  1YD8 G;  2X51 A;  1SHZ C;  4KUM B;  3NRX A;  5F8P A;  4AI6 A;  2JMK A;  1EZ3 A;  4I43 B;  3N9P A;  3ZPO A;  1MIW A;  1BR0 A;  4OYK A;  2XTL A;  4WBO A;  4E7S A;  4ANJ A;  4AKR B;  4H9P C;  2NTY A;  3WAJ A;  2DCF A;  3PUR A;  4HEA A;  1MMN A;  4I4T E;  2YEV C;  3OYX A;  2HPL A;  4IE6 A;  2C5K T;  5L3D B;  1OXZ A;  1BR2 A;  2HPJ A;  4G2A A;  4QXB B;  4EAH A;  3M1C A;  4PJM A;  3J9X 1;  1LKX A;  2WSS V;  3ETV A;  3AAA B;  4CQI A;  2BDE A;  4MHC A;  2XAQ B;  4L9I A;  3BQL A;  2YIN A;  5FNV E;  1WYC A;  1T98 A;  2UXN B;  1BR1 A;  4P0B A;  3ANW B;  3F57 A;  3DJB A;  2NWB A;  4PFO A;  2ACX A;  2X68 A;  2D2S A;  2W62 A;  1UX5 A;  4H9S E;  5FXZ A;  5JRE A;  2NW9 A;  1IZN B;  2E9X A;  1Y64 B;  3ZMU B;  2A3D A;  4BJM A;  5M4Y A;  4IE0 A;  4QX7 B;  2KWH A;  4UXN B;  2VAS A;  5LNK A;  3RYI E;  5JDQ A;  4E7Z A;  2KXP B;  4I50 E;  3LBX B;  3BK9 A;  2KZ7 B;  3ESL A;  3GN5 A;  3LK4 2;  4KBM B;  3EDU A;  4O4H E;  5LA6 E;  4DMW A;  2X9X A;  4OHF A;  3KV5 A;  3KV4 A;  5JQG E;  3I1A A;  4QKN A;  4PK4 A;  5JRC A;  3WI3 A;  2H3R A;  3MKD A;  2KMF A;  5JVD E;  4C90 A;  4AKL A;  2CXF A;  5EK3 A;  1D0Z A;  2GK9 A;  2E9X D;  3B57 A;  3VKH A;  4NUV A;  1S94 A;  3HI2 A;  4V1A v;  4IIJ E;  1LVK A;  1O3X A;  4BA9 A;  1NAF A;  3KVA A;  3BQK A;  3C4W A;  3LJC A;  4HFV A;  2PG8 A;  3O1H A;  3R6N A;  3AA1 B;  2EHO A;  1YKH B;  3N9L A;  4QWN B;  4UV8 B;  3U3I A;  3GA8 A;  2BVL A;  4KP3 C;  2CE7 A;  3T8O A;  4EXT A;  2VKD A;  3A5X A;  3OJA A;  3PU3 A;  3VHL A;  1NWM X;  2Q9Q C;  3AA6 B;  3ZLI A;  4PAG A;  3RRW A;  4YLH A;  1G8X A;  5LHI B;  5L2L A;  5HAX A;  2LSI A;  4UEL A;  4AQF C;  2LSJ A;  1CUN A;  4ECG A;  1MIY A;  3CQX C;  2DWG A;  3FBL A;  2H7V C;  2RA1 A;  3AB3 B;  3SOL A;  3C98 B;  2IW5 B;  1WYB A;  3CVR A;  4JLE A;  5ETW A;  2WM9 A;  4PK5 A;  3N2K E;  4UF0 B;  2MBG A;  4AKI A;  2V7K A;  4JEH B;  3E22 E;  3RYH E;  1WRD A;  2DWK A;  3CX8 B;  4ZOL E;  4H63 H;  3F31 A;  5FY7 A;  4CXX A;  4UVB B;  3EVY A;  4U72 A;  4TV9 E;  3I9Y A;  4L0R A;  2NOX A;  4ERR A;  4ZI3 C;  4CI3 B;  2DHR A;  5L3B B;  2C5I T;  2IC9 A;  4M1P A;  2CWY A;  5LG4 A;  5J1G A;  2XAS B;  5HXR A;  4O8S A;  3HKD E;  3R84 B;  1B7T A;  1IJ5 A;  2M67 A;  3ZMV B;  5JDF A;  4GK5 E;  4TX5 A;  1U4Q A;  1WLX A;  3DTO A;  2V7I A;  3TKL B;  3ZMZ B;  4X1Y E;  5JR9 B;  4TUY E;  2LOP A;  2ZM8 A;  1D0Y A;  3QK6 A;  3I9W A;  4H9N C;  1HS7 A;  3VU7 H;  3N9Q A;  4BGO A;  5L3C B;  1VOM A;  3Q2M A;  3UTK A;  5AFU L;  3RX6 A;  4PW8 A;  2W0G A;  4TV8 E;  2KT9 A;  4GYR A;  2Q9Q B;  4XAX B;  1ZKE A;  4EB6 E;  3Q5W A;  5FXV A;  3E0Z A;  1FMV A;  1IAP A;  3PE0 A;  3AVR A;  3PUQ A;  1ZV4 X;  1HCI A;  4DMV A;  5BMV E;  2LM9 A;  1HG5 A;  1IJ6 A;  3PTR B;  4BJN A;  5KX5 E;  4EOZ B;  4L5G A;  3K3O A;  3ZC0 A;  3ANW A;  4IHJ E;  4BAY B;  5HXE A;  1YW0 A;  3D0T A;  4PK6 A;  3N9M A;  2CLY B;  4MAL A;  4UVA B;  3PHF 1;  3Q9D A;  5LGU B;  2BVM A;  2PFV A;  5F3J A;  3ZYL A;  1SA0 E;  2JQQ A;  1HF8 A;  3ZC1 A;  1FIO A;  3F2E A;  3W15 B;  3CQC B;  4GYS A;  2XAG B;  4DBQ A;  2ODU A;  2ES0 A;  2KWI B;  2LSG A;  2JPF A;  3IF8 B;  3I0O A;  4K0U A;  5DQW A;  4GOU A;  3J7Y q;  2DLR A;  2K5B B;  3CML A;  3N2G E;  5LHH B;  5LP6 E;  3VJZ A;  3UUN A;  2MYS A;  1UX4 A;  5GON E;  3AT7 A;  3KV9 A;  5HWX A;  3KVB A;  3RC8 A;  3N5L A;  3MA9 A;  2A2F X;  3WSC A;  3V5U A;  4CI2 B;  2X9H A;  1LVF A;  3C4Z A;  3P7I A;  4G63 A;  3P8C D;  2JJ9 A;  2QGS A;  1KK7 A;  2ZM0 A;  4HTE A;  1V9D A;  2ZM2 A;  4KMC A;  3UUM A;  1Z0P A;  3AA0 B;  2K24 A;  3EDV A;  4ONR A;  4EZ4 A;  2W00 A;  2LHN A;  4AXP A;  1AJ3 A;  5LJM A;  2V7J A;  3VKG A;  2MOZ A;  5JH7 E;  3LK2 B;  3IBP A;  3IHR A;  1FEW A;  3V5S A;  4ZI7 E;  3N2O A;  2ZLY A;  4ASK A;  3FXD B;  4EZH A;  4ADZ A;  4P0A A;  3AAI A;  2LJL A;  1LRZ A;  5JR9 C;  4GIW A;  3CX6 B;  4DBR A;  3K3Q C;  2LT3 A;  4HKA A;  2WMN A;  5HXC A;  3UUL A;  4WBN E;  3ZCI A;  4AKH A;  3DP7 A;  2LOS A;  5FY1 A;  2L3L A;  3K3N A;  4ZI2 C;  5CA0 E;  3N9O A;  2VB6 A;  4GK0 E;  3U78 A;  1ZEE A;  2VK9 A;  5JDG A;  5L3F B;  2W63 A;  3H37 A;  4TN7 B;  2RP4 A;  2YU1 A;  5CA1 E;  3SWH A;  3ZMS B;  4JUY A;  5JDL A;  3HA4 A;  5H6R B;  2Z6E A;  3I0Q A;  3JC6 C;  2Y8D A;  2I59 A;  2IAK A;  3SRZ A;  2YU2 A;  4I55 E;  4A56 A;  2XHE B;  5JRC B;  4WW0 A;  3KFW X;  2CLY C;  4QHO A;  4ZS3 A;  3L3P A;  3RYC E;  4P09 A;  4FJO A;  2P9B A;  4YFS A;  4TZ4 C;  4H9R C;  2W61 A;  2Q9Q A;  2LSK A;  4PJN A;  5LHG B;  1H7C A;  3UFE A;  2X9W A;  2VWA A;  3O4X E;  1E1H B;  4AQF A;  4C91 A;  3RYF E;  1S35 A;  5FXX A;  2WMO A;  4F6R C;  2PBI A;  2YK0 A;  3C4X A;  5J2U E;  1G73 A;  2X9Y A;  4EYU A;  2X67 A;  1YKE B;  3ZCJ A;  4U74 A;  2WWU A;  3WAK A;  4EIW A;  5ADX L;  3NZP A;  5FMN A;  3RC3 A;  4CZZ B;  4NUU A;  5LJN A;  2Q9Q D;  4HN9 A;  4ZI2 D;  2B1E A;  1HFA A;  5FXW A;  1BR4 A;  4PNI A;  4UV9 B;  3FBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...