5HXXA

Crystal structure of aspat from corynebacterium glutamicum
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
424
structure length
424
Chain Sequence
VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into a novel class of aspartate aminotransferase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Transferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 153
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5hxxA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5hxxA01
2HUIA 1CQ8A 4UHMA 1C9CA 2ZC0A 1ARTA 2E7JA 3FQ8A 3PIUA 1I48A 1AIBA 4U1TA 3TCMA 1BKGA 4BQ0A 4I8AA 1G4VA 1C7NA 2HZPA 4OBUA 1RV4A 1PG8A 1SFFA 2VMYA 2X5DA 3NUIA 3AEOA 1DJEA 4ZSYA 1DJ9A 3HT4A 3R4TA 1AMRA 4J5UA 5G2PA 3ASBA 1OHVA 3OKSA 1VEFA 1W7MA 1CQ6A 3A9ZA 1YJSA 3K7YA 3B8XA 1MGVA 2YKXA 4UHOA 9AATA 1TOEA 1M32A 3MAUA 5FT6A 1MLZA 3UWCA 4WB0B 1ORDA 2FNUA 4EB7A 3TFUA 4WBTA 2VYCA 1EJIA 3FSLA 4F4EA 1M0NA 1ECXA 4GE9A 4N0WA 4WYFA 3N75A 1CQ7A 2CJGA 3E2YA 3EI5A 2W8WA 2G6WA 2VIAA 4IW7A 1GC4A 2VMWA 1MDZA 2NMPA 2CB1A 5D95A 1WKGA 1BS0A 2Z20A 1S09A 3ACZA 3AOVA 2W7EA 3PDXA 4ITXA 1ELQA 1QGNA 1ZODA 1V72A 2CANA 4ZASA 1WYTA 4Y0DA 2BWOA 2EGYA 2E7IA 1AHYA 2R2NA 4EMYA 3NUBA 1O4SA 4IX8A 4RJYA 1JS3A 4A6RA 3PAAA 4PFNA 3VK4A 1LW5A 2EO5A 3VK3A 2HUFA 4ZLVA 4EB5A 2C7TA 3E77A 4EU1A 1AHEA 2HOXA 2VMRA 3WCNA 3WGCA 3DODA 3AEMC 3JWBA 3H14A 4IY7A 4M2JA 3AEJA 4F5HA 2YRIA 3GSBA 3HL2A 3DU4A 4UQVA 3BC8A 1ELUA 2R5EA 2CSTA 1O69A 2YCNA 1QITA 2VMSA 2VGSA 1SZSA 3FZ7A 3FVSA 4ZM3A 1I43A 1KKPA 4F5FA 4N0BA 1BJOB 1ARIA 1ZOBA 5EFSA 2XH1A 4ZSWA 1AJSB 1AY5A 3B1CA 1B5OA 2CJHA 3K28A 1AHGA 3GZDA 1O61A 3AATA 3GJUA 3AOWA 1LW4A 3QHXA 2EPJA 2FM1A 4OCAA 2QA3A 4OMAA 4R2NA 3T32A 2AY7A 2CH2A 1AAMA 3L8AA 4AOAA 3A9YA 4B98A 4DBCA 3AEMA 2W7LA 5E5IA 2X8UA 3UAKA 5EUDA 5G4JA 1B8GA 4MQQA 2V0YA 1AIAA 3FVUA 5FT5A 4A72A 1AY4A 4AO9A 3BWOA 5DJ9A 3FKDA 2DGMA 4ADDA 3NU8A 1I29A 1RV3A 3BS8A 3NYTA 4HF8A 4Q76A 3KGWA 2O7CA 1LS3A 3NDNA 4XAUA 3W1IA 1G7WA 1MLYA 4ITGA 2GQNA 7AATA 2W7FA 3QGUA 1PMOA 3A9XA 3G7QA 3LV2A 1DKAA 3GR9A 4JE5D 2D7YA 4WYEA 1GC3A 4GE7A 1FG7A 3NYUA 2VIBA 1CL2A 2ZUKA 3OP7A 2W7IA 3RQ1A 2JGTA 3PD6B 1ARSA 3E2FA 3KE3A 1YIYA 4IXZA 3QM2A 5AX8A 2JJEA 2OATA 4M2KA 2HORA 3LG0A 1BW0A 2AY9A 3NU7A 2W7HA 1YJYA 4A6UA 1GEWA 3EI7A 3FQAA 3VK2A 2D7ZA 4OYTA 5M4DA 2HP1A 3D6KA 5G0AA 4JF0A 2BI9A 5F9SA 1TASA 2ZJGA 4WD2A 4MQPA 1QJ3A 3ATHA 2VGTA 1B9HA 4Q6RA 3F9TA 5LH9A 1I41A 3L44A 2QB2A 4MY5A 2VLHA 1S06A 1JG8A 1UU1A 1WYUA 1WYTB 3VOMA 2CINA 2VMUA 1FC4A 3AV7A 4LNJA 5F8VA 4XJOA 1QIRA 4ISYA 4E3RA 3FZ6A 1IX8A 3FFHA 4PIWA 4WXFA 1EG5A 2BYJA 1D7UA 2W7GA 5EIGB 2O0RA 4WYCA 1ARHA 5EAVA 2VMOA 3IHJA 1TATA 1CL1A 1TOGA 4LW4A 1LC7A 2GMUA 1LKCA 4UOYA 3NX3A 3BB8A 4RKCA 3M5UA 4WLHA 5EIGA 1SVVA 5G09A 1SZKA 4O6ZA 3TFTA 1KL2A 2FNIA 3EZSA 4DQ6A 4WXGA 2Z1YA 3FFRA 1IVRA 2BHXA 2OKJA 3FVXA 2PB2A 4KAMA 1BJOA 4OBVA 3TATA 4CBRA 1ASDA 4GSAA 1D7VA 1Z7DA 3HLMA 3MC6A 1AAWA 1WKHA 3JWAA 4AH3A 1VP4A 4FFCA 4OT8A 1M0QA 3GETA 5HXXA 3PDBA 2GMSA 1X29A 2ZY3A 2X5FA 1WSTA 3K40A 1D2FA 3WCOA 1V2DA 2EZ1A 2ORDA 4WLJA 2Z1ZA 2Z9VA 4M2MA 1AKAA 2Z61A 1YAAA 2OGEA 2WK9A 4JEZA 4RLGA 3Q8NA 1W7NA 4KYOA 2BWPA 1C7GA 1KMJA 1M0OA 4EFFA 4BMKA 1LC8A 1N8PA 1QJ5A 4U2HA 1X2AA 2YKYA 3AENB 2YRRA 3FDDA 1P3WA 3DC1A 4RJ0A 2VMPA 1ASAA 3COGA 2OQXA 1IAYA 4ZDOA 4PFFA 2WK8A 2WK7A 1YOOA 4BA5A 4F5JA 1AICA 2VGZA 5FT8A 1M0PA 2D65A 3FZ8A 3KGXA 4IXSA 3DYDA 3LVLB 4WYAA 4OTLA 1E5EA 1YNUA 2GB3A 3N0LA 4HVKA 1V2EA 2JISA 1J04A 3A2BA 4LNLA 1SF2A 4MKJA 1AMQA 3QN6A 1TPLA 3JTXA 3LVKA 1EQBA 1C4KA 1VJOA 3PGYA 3HDOA 1D7RA 3EUCA 5E4ZA 3FRKA 4Y0IA 3RBFA 3P6KA 3TQXA 1H1CA 1LC5A 4RIZA 3R9AA 3CQ4A 4F5LA 5D5SA 5EUEA 4P3MA 1ASCA 1CZEA 3NYSA 2W7MA 3B46A 4GDYA 4A0HA 1GEXA 3DXVA 4RKDA 3EI8A 4RITA 4ADEA 1BQAA 4J8LA 1UKJA 2YHKA 2AY1A 1V2FA 4R8DA 3RUYA 1IJIA 4CVQA 4W5KA 2VMQA 3BCBA 1G4XA 3LVMA 3MBBA 4KXKA 1Z3ZA 2D63A 2YKVA 1C0NA 1DJUA 1BT4A 4L0OA 4LW2A 1KMKA 2YCPA 1KL1A 1B5PA 4IYOB 3PA9A 1IBJA 4JF1A 1N2TA 2BI1A 1H0CA 3BCAA 1SPAA 1X28A 3EI6A 1TOKA 4ZAHA 3B1EA 3I5TA 2D64A 1AHFA 4XJLA 2O1BA 2VMZA 3P1TA 4JE5A 1B9IA 1T3IA 3FQ7A 1G7XA 1GBNA 4P7YA 5I92A 4GEBA 2VGUA 2RFVA 4RAEA 3VP6A 1B4XA 2PB0A 3B1DA 3QI6A 2Z9XA 4XJPA 1S0AA 2AEUA 1AY8A 1X0MA 3CBFA 3GBXA 4Q75A 5G4IA 1W23A 5IWQA 2BI5A 2BIEA 3E2ZB 3E9KA 2ZY4A 3EZ1A 3FCRA 1ASEA 2JJFA 3AENA 4NOGA 3JW9A 3WY7A 3DR4A 1W3UA 1XI9A 4W8IA 3BCXA 3MKJA 3ZZJA 4F5IA 3QBOA 4K2IA 4W1VA 2FYFA 1Y4IA 4TN4A 2CY8A 1E5FA 3CAIA 2R0TA 1LK9A 1PFFA 1MAQA 2D5YA 1TARA 3ELEA 2ZP7A 3QPGA 3RCHB 3WZFA 4F5GA 2CJDA 3USFA 4F5KA 3MAFB 1QISA 2AY8A 2OKKA 4K2MA 2QMAA 2CFBA 2D61A 2HUUA 4BA4A 8AATA 3NRAA 1ASNA 1BJ4A 3FD0A 5EUNA 4WYGA 1AKBA 5EAAA 1GC0A 3H7FA 4FL0A 2BWNA 3JU7A 2AATA 2FQ6A 1GD9A 3UE8A 5DJ1A 4ADBA 1C7OA 4K2BA 1KKJA 3HBXA 3GZDC 4A00A 5K8BA 4W1XA 4JEVA 4ATQA 2BYLA 1D7SA 2DGKA 1SZUA 2R5CA 3GZCA 1DGEA 2YKUA 3MEBA 3RBLA 1AKCA 2VMTA 3IF2A 2C81A 2OGAA 1MDOA 3BWNC 3JZLA 2QB3A 2BI2A 2VGWA 1U08A 1ARGA 2DKBA 3ECDA 3LWSA 2W8UA 2D66A 4WYDA 3ASAA 1BQDA 1O62A 4ADCA 5C6UA 4BHDA 3DZZA 1GCKA 4CXRA 3I4JA 3G8MA 4AZJA 2W7KA 4W91A 3RI6A 2DKJA 2PO3A 2VI9A 3HMUA 4RM1A 5E3KA 2XBNA 3GWPA 3LVJA 2QLRA 3ZRPA 4E1OA 4F5MA 3I16A 3MC6C 3CQ5A 2AEVA 1QZ9A 4A6TA 5M4BA 1AMAA 1CZCA 2VLFA 2W8JA 3F0HA 5TF5A 2X3LA 1DFOA 3FDBA 1DTYA 3PDBB 3EIBA 5EQCA 4ZM4A 5G2QA 2HOYA 1MAPA 1OXOA 1BJNA 3EI9A 3PD6A 3W1JA 1WYVB 1IX6A 5HDMA 3MADA 1TOIA 2Q7WA 2VMVA 4TMRA 1AMSA 3HQTA 4TV7A 2DOUA 2TPLA 4W1WA 5DX5A 4A0GA 2DGLA 4JEXA 4IXOA 3G0TA 2AY2A 4CBSA 4GRXA 2VMNA 3F6TA 2W7JA 2GSAA 4E77A 2HOZA 1YIZA 4R5ZA 2JJHA 4JEWA 2JG2A 1ASFA 4B9BA 2AY6A 3ZRRA 5J8QA 3WGBA 3ZRQA 1M4NA 1RVYA 3AEJC 1OHWA 4WB0A 4AZKA 2V1PA 2W7DA 4UHNA 4DGTA 2ZY2A 3WX9A 2BIGA 1OXPA 1GDEA 4GE4A 2YOBA 3PJ0A 4XEWA 5HHYA 2E54A 4XQ2A 2ZSLA 3VAXA 2AY3A 1ASLA 3WLXA 2C44A 3A8UX 2R5CB 2C0RA 3NNKA 1UU0A 2EZ2A 2ZSMA 1IUGA 2Z9UA 2ZYJA 3FTBA 1IX7A 2YCTA 4IYOA 4MKKA 4A0RA 1WYVA 2W8VA 3KKIA 1W7LA 3PPLA 4OC9A 3LY1A 2BIAA 1AHXA 5BJ4A 1GEYA 1MDXA 5BJ3A 1ZC9A 1ASMA 2CH1A 1AJSA 3ISLA 4MGRA 4R5FA 5FT4A 2F8JA 3RCHA 1S07A 1AX4A 1UU2A 4ZWVA 2WKAA 3W1HA 4WXBA 3AEPA 4PVFA 1YJZA 2AY4A 1J32A 2Z9WA 3ZZKA 2EH6A 3MAFA 3EIAA 1OATA 1M7YA 2QBTA 2ZY5A 2E7UA 1M6SA 2BKWA 4LC3A 1IAXA 2VMXA 4Q31A 1TOJA 3II0A 4MSOA 5DB5A 2CTZA 4XJMA 1AJRA 1ASGA 2AY5A 3HVYA 1OHYA 3NTJA 4ATPA 5LHAA 1WYUB 1CJ0A 2DR1A 1RVUA 2VGVA 3DRDA 3BWNA 2W8TA 1GC2A 1S08A 1CS1A 1N31A 5M46A 1XEYA 1JS6A 4ZDPA 3AELA 3ELPA 4LNMA 4MQRA 4QGRA 4CXQA 4Y0HA 3BN1A 3E2ZA 4A0FA 4XK1A 3CQ6A 3N5MA 3BV0A 1JF9A 4ZWMA 4WP0A 2FN6A 1DGDA 5M49A 2HP2A 2BI3A 2VI8A 2Z67A 3WKSA 2JJGA 4AO4A 1BJWA 3WKRA 5JAYA 4E3QA 3DXWA 1FG3A 4H51A 1ASBA 1PMMA 3DR7A 4JEYA 3E6GA 4ZDLA
chains in the Genus database with same CATH superfamily
2HUIA 1CQ8A 4UHMA 1C9CA 2ZC0A 1ARTA 2E7JA 3FQ8A 3PIUA 1I48A 1AIBA 4U1TA 3TCMA 1BKGA 4BQ0A 4I8AA 1G4VA 1C7NA 2HZPA 4OBUA 1RV4A 1PG8A 1SFFA 2VMYA 2X5DA 3NUIA 3AEOA 1DJEA 4ZSYA 1DJ9A 3HT4A 3R4TA 1AMRA 4J5UA 5G2PA 3ASBA 1OHVA 3OKSA 1VEFA 2EYQA 1W7MA 1CQ6A 3A9ZA 1YJSA 3K7YA 3B8XA 1MGVA 2YKXA 4UHOA 9AATA 1TOEA 1M32A 3MAUA 5FT6A 1MLZA 3UWCA 4WB0B 1ORDA 3N4XA 2FNUA 4EB7A 3TFUA 4WBTA 2VYCA 1EJIA 3FSLA 4F4EA 1M0NA 1ECXA 4GE9A 4N0WA 4WYFA 3N75A 1CQ7A 2CJGA 3E2YA 3EI5A 2W8WA 2G6WA 2VIAA 4IW7A 1GC4A 2VMWA 1MDZA 2NMPA 2CB1A 5D95A 1WKGA 1BS0A 2Z20A 1S09A 3ACZA 3AOVA 2W7EA 3PDXA 4ITXA 1ELQA 1QGNA 1ZODA 1V72A 2CANA 4ZASA 1WYTA 4Y0DA 2BWOA 2EGYA 2E7IA 1AHYA 2R2NA 4EMYA 3NUBA 1O4SA 4IX8A 4RJYA 1JS3A 4A6RA 3N4SA 3PAAA 4PFNA 3VK4A 1LW5A 2EO5A 3VK3A 2HUFA 4ZLVA 4EB5A 2C7TA 3E77A 4EU1A 1AHEA 2HOXA 2VMRA 3WCNA 3WGCA 3DODA 3AEMC 3JWBA 3H14A 4IY7A 4M2JA 3AEJA 4F5HA 2YRIA 3GSBA 3HL2A 3DU4A 4UQVA 3BC8A 1ELUA 2R5EA 2CSTA 2WB6A 2FKIA 1O69A 2YCNA 1QITA 2VMSA 2VGSA 1SZSA 3FZ7A 3FVSA 4ZM3A 1I43A 1KKPA 4F5FA 4N0BA 1BJOB 1ARIA 1ZOBA 5EFSA 2XH1A 4ZSWA 1AJSB 1AY5A 3B1CA 1B5OA 2CJHA 3K28A 1AHGA 3GZDA 1O61A 3AATA 3GJUA 3AOWA 1LW4A 3QHXA 2EPJA 2FM1A 4OCAA 2QA3A 4OMAA 4R2NA 3T32A 2AY7A 2CH2A 1AAMA 3L8AA 4AOAA 3A9YA 4B98A 4DBCA 3AEMA 2W7LA 5E5IA 2X8UA 3UAKA 5EUDA 5G4JA 1B8GA 4MQQA 2V0YA 1AIAA 3FVUA 5FT5A 4A72A 1AY4A 4AO9A 3BWOA 5DJ9A 3FKDA 2DGMA 4ADDA 3NU8A 1I29A 1RV3A 3BS8A 3NYTA 4HF8A 4Q76A 3KGWA 2O7CA 1LS3A 3NDNA 4XAUA 3W1IA 1G7WA 1MLYA 4ITGA 2GQNA 7AATA 2W7FA 3QGUA 1PMOA 3A9XA 3G7QA 3LV2A 1DKAA 3GR9A 4JE5D 2D7YA 4WYEA 1GC3A 4GE7A 1FG7A 3NYUA 2VIBA 1CL2A 2ZUKA 3OP7A 2W7IA 3RQ1A 2JGTA 3PD6B 1ARSA 3E2FA 3KE3A 1YIYA 4IXZA 3QM2A 5AX8A 2JJEA 2OATA 4M2KA 2HORA 3LG0A 1BW0A 2AY9A 3NU7A 2W7HA 1YJYA 4A6UA 1GEWA 3EI7A 3FQAA 3VK2A 2D7ZA 5KTBA 4OYTA 5M4DA 2HP1A 3D6KA 5G0AA 4JF0A 2BI9A 5F9SA 1TASA 2ZJGA 4WD2A 4MQPA 1QJ3A 3ATHA 2VGTA 1B9HA 4Q6RA 3F9TA 5LH9A 1I41A 3L44A 2QB2A 4MY5A 2VLHA 1S06A 1JG8A 1UU1A 1WYUA 1WYTB 3VOMA 2CINA 2VMUA 4K05A 1FC4A 3AV7A 4LNJA 5F8VA 4XJOA 1QIRA 4ISYA 4E3RA 3FZ6A 1IX8A 3FFHA 4PIWA 4WXFA 1EG5A 2BYJA 1D7UA 2W7GA 5EIGB 2O0RA 4WYCA 1ARHA 5EAVA 2VMOA 3IHJA 1TATA 1CL1A 1TOGA 4LW4A 1LC7A 2GMUA 1LKCA 4UOYA 3NX3A 3BB8A 4RKCA 3M5UA 4WLHA 5EIGA 1SVVA 5G09A 1SZKA 4O6ZA 3TFTA 1KL2A 2FNIA 3EZSA 4DQ6A 4WXGA 2Z1YA 3FFRA 1IVRA 2BHXA 2OKJA 3FVXA 2PB2A 4KAMA 1BJOA 4OBVA 3TATA 4CBRA 1ASDA 4GSAA 1D7VA 1Z7DA 3HLMA 3MC6A 1AAWA 1WKHA 3JWAA 4AH3A 1VP4A 4FFCA 4OT8A 1M0QA 3GETA 5HXXA 3PDBA 2GMSA 1X29A 2ZY3A 2X5FA 1WSTA 3K40A 1D2FA 3WCOA 1V2DA 2EZ1A 2ORDA 4WLJA 2Z1ZA 2Z9VA 4M2MA 1AKAA 2Z61A 1YAAA 2OGEA 2WK9A 4JEZA 4RLGA 3Q8NA 1W7NA 4KYOA 2BWPA 1C7GA 1KMJA 1M0OA 4EFFA 4BMKA 1LC8A 1N8PA 1QJ5A 4U2HA 1X2AA 2YKYA 3N4RA 3AENB 2YRRA 3FDDA 1P3WA 3DC1A 4RJ0A 2VMPA 1ASAA 3COGA 2OQXA 1IAYA 4ZDOA 4PFFA 2WK8A 2WK7A 1YOOA 4BA5A 4F5JA 1AICA 2VGZA 5FT8A 1M0PA 2D65A 3FZ8A 3KGXA 4IXSA 3DYDA 3LVLB 4WYAA 4OTLA 1E5EA 1YNUA 2GB3A 3N0LA 4HVKA 1V2EA 2JISA 1J04A 3A2BA 4LNLA 1SF2A 4MKJA 1AMQA 3QN6A 1TPLA 3JTXA 3LVKA 1EQBA 1C4KA 1VJOA 3PGYA 3HDOA 1D7RA 3EUCA 5E4ZA 3FRKA 4Y0IA 3RBFA 3P6KA 3TQXA 1H1CA 1LC5A 4RIZA 3R9AA 3CQ4A 4F5LA 5D5SA 5EUEA 4P3MA 1ASCA 1CZEA 3NYSA 2W7MA 3B46A 4GDYA 4A0HA 1GEXA 3DXVA 4RKDA 3EI8A 4RITA 4ADEA 1BQAA 4J8LA 1UKJA 2YHKA 2AY1A 1V2FA 4R8DA 3RUYA 1IJIA 4CVQA 4W5KA 2VMQA 3BCBA 1G4XA 3LVMA 3MBBA 4KXKA 1Z3ZA 2D63A 2YKVA 1C0NA 1DJUA 1BT4A 4L0OA 4LW2A 1KMKA 2YCPA 1KL1A 1B5PA 4IYOB 3PA9A 1IBJA 4JF1A 1N2TA 4H63Q 2BI1A 1H0CA 3BCAA 1SPAA 1X28A 3EI6A 1TOKA 4ZAHA 3B1EA 3I5TA 2D64A 1AHFA 4XJLA 2O1BA 2VMZA 3P1TA 4JE5A 1B9IA 1T3IA 3FQ7A 1G7XA 1GBNA 4P7YA 5I92A 4GEBA 2VGUA 2RFVA 4RAEA 3VP6A 1B4XA 2PB0A 3B1DA 3QI6A 2Z9XA 4XJPA 1S0AA 2AEUA 1AY8A 1X0MA 3CBFA 2QSRA 3GBXA 4Q75A 5G4IA 1W23A 5IWQA 2BI5A 2BIEA 3E2ZB 3E9KA 2ZY4A 3EZ1A 3FCRA 1ASEA 2JJFA 3AENA 4NOGA 3JW9A 3WY7A 3DR4A 1W3UA 1XI9A 4W8IA 3BCXA 3MKJA 3ZZJA 4F5IA 3QBOA 4K2IA 4W1VA 2FYFA 1Y4IA 4TN4A 2CY8A 1E5FA 3CAIA 2R0TA 1LK9A 1PFFA 1MAQA 2D5YA 1TARA 3ELEA 2ZP7A 3QPGA 3RCHB 3WZFA 4F5GA 2CJDA 3USFA 4F5KA 3MAFB 1QISA 2AY8A 2OKKA 4K2MA 2QMAA 2CFBA 2D61A 2HUUA 4BA4A 8AATA 3NRAA 1ASNA 1BJ4A 3FD0A 5EUNA 4WYGA 1AKBA 5EAAA 1GC0A 3H7FA 4FL0A 2BWNA 3JU7A 2AATA 2FQ6A 1GD9A 3UE8A 5DJ1A 4ADBA 1C7OA 4K2BA 1KKJA 3HBXA 3GZDC 4A00A 5K8BA 4W1XA 4JEVA 4ATQA 2BYLA 1D7SA 2DGKA 1SZUA 2R5CA 3GZCA 1DGEA 2YKUA 3MEBA 3RBLA 1AKCA 2VMTA 3IF2A 2C81A 2OGAA 1MDOA 3BWNC 3JZLA 2QB3A 2BI2A 2VGWA 1U08A 1ARGA 2DKBA 3ECDA 3LWSA 2W8UA 2D66A 4WYDA 3ASAA 1BQDA 1O62A 4ADCA 5C6UA 4BHDA 3DZZA 1GCKA 4CXRA 3I4JA 3G8MA 4AZJA 2W7KA 4W91A 3RI6A 2DKJA 2PO3A 2VI9A 3H9XA 3HMUA 4RM1A 5E3KA 2XBNA 3GWPA 3LVJA 2QLRA 3ZRPA 4E1OA 4F5MA 3I16A 3MC6C 3CQ5A 2AEVA 1QZ9A 4A6TA 5M4BA 1AMAA 1CZCA 2VLFA 2W8JA 3F0HA 5TF5A 2X3LA 1DFOA 3FDBA 1DTYA 3PDBB 3EIBA 5EQCA 4ZM4A 5G2QA 2HOYA 1MAPA 1OXOA 1BJNA 3EI9A 3PD6A 3W1JA 1WYVB 1IX6A 5HDMA 3MADA 1TOIA 2Q7WA 2VMVA 4TMRA 1AMSA 3HQTA 4TV7A 2DOUA 2TPLA 4W1WA 5DX5A 4A0GA 1KAFA 2G7JA 2DGLA 4JEXA 2A1VA 4IXOA 3G0TA 2AY2A 4CBSA 4GRXA 2VMNA 3F6TA 2W7JA 2GSAA 4E77A 2HOZA 1YIZA 4R5ZA 2JJHA 4JEWA 2JG2A 1ASFA 4B9BA 2AY6A 3ZRRA 5J8QA 3WGBA 3ZRQA 1M4NA 1RVYA 3AEJC 1OHWA 4WB0A 4AZKA 2V1PA 2W7DA 4UHNA 4DGTA 2ZY2A 3WX9A 2BIGA 1OXPA 1GDEA 4GE4A 2YOBA 3PJ0A 4XEWA 5HHYA 2E54A 4XQ2A 2ZSLA 3VAXA 2AY3A 1ASLA 3WLXA 2C44A 3A8UX 2R5CB 2C0RA 3NNKA 1UU0A 2EZ2A 2ZSMA 1IUGA 2Z9UA 2ZYJA 3FTBA 1IX7A 2YCTA 4IYOA 4MKKA 4A0RA 1WYVA 2W8VA 3KKIA 1W7LA 3PPLA 4OC9A 3LY1A 2BIAA 1AHXA 5BJ4A 1GEYA 1MDXA 5BJ3A 1ZC9A 1ASMA 2CH1A 1AJSA 3ISLA 4MGRA 4R5FA 5FT4A 2F8JA 3RCHA 1S07A 1AX4A 1UU2A 4ZWVA 2WKAA 3W1HA 4WXBA 3AEPA 4PVFA 1YJZA 2AY4A 1J32A 2Z9WA 3ZZKA 2EH6A 3MAFA 3EIAA 1OATA 1M7YA 3N7NA 2QBTA 2ZY5A 2E7UA 1M6SA 2BKWA 4LC3A 1IAXA 2VMXA 4Q31A 1TOJA 3II0A 4MSOA 5DB5A 2CTZA 4XJMA 1AJRA 1ASGA 2AY5A 3HVYA 1OHYA 3NTJA 4ATPA 5LHAA 1WYUB 1CJ0A 2DR1A 1RVUA 2VGVA 3DRDA 3BWNA 2W8TA 1GC2A 1S08A 1CS1A 1N31A 5M46A 1XEYA 1JS6A 4ZDPA 3AELA 3ELPA 4LNMA 4MQRA 4QGRA 4CXQA 2KFPA 4Y0HA 3BN1A 3E2ZA 4A0FA 4XK1A 3CQ6A 3N5MA 3BV0A 1JF9A 4ZWMA 4WP0A 2FN6A 1DGDA 5M49A 2HP2A 2BI3A 2VI8A 2Z67A 3WKSA 2JJGA 4AO4A 1BJWA 3WKRA 5JAYA 4E3QA 3DXWA 1FG3A 4H51A 1ASBA 1PMMA 3DR7A 4JEYA 3E6GA 4ZDLA
chains in the Genus database with same CATH topology
2HUIA 1CQ8A 4UHMA 1C9CA 2ZC0A 1ARTA 2E7JA 3FQ8A 3PIUA 1I48A 1AIBA 4U1TA 3TCMA 1BKGA 4BQ0A 4I8AA 1G4VA 1C7NA 2HZPA 4OBUA 1RV4A 1PG8A 1SFFA 2VMYA 2X5DA 3NUIA 3AEOA 1DJEA 4ZSYA 1DJ9A 3HT4A 3R4TA 1AMRA 4J5UA 5G2PA 3ASBA 1OHVA 3OKSA 1VEFA 2EYQA 1W7MA 1CQ6A 3A9ZA 1YJSA 3K7YA 3B8XA 1MGVA 2YKXA 4UHOA 9AATA 1TOEA 1M32A 3MAUA 5FT6A 1MLZA 3UWCA 4WB0B 1ORDA 3N4XA 2FNUA 4EB7A 3TFUA 4WBTA 2VYCA 1EJIA 3FSLA 4F4EA 1M0NA 1ECXA 4GE9A 4N0WA 4WYFA 3N75A 1CQ7A 2CJGA 3E2YA 3EI5A 2W8WA 2G6WA 2VIAA 4IW7A 1GC4A 2VMWA 1MDZA 2NMPA 2CB1A 5D95A 1WKGA 1BS0A 2Z20A 1S09A 3ACZA 3AOVA 2W7EA 3PDXA 4ITXA 1ELQA 1QGNA 1ZODA 1V72A 2CANA 4ZASA 1WYTA 4Y0DA 2BWOA 2EGYA 2E7IA 1AHYA 2R2NA 4EMYA 3NUBA 1O4SA 4IX8A 4RJYA 1JS3A 4A6RA 3N4SA 3PAAA 4PFNA 3VK4A 1LW5A 2EO5A 3VK3A 2HUFA 4ZLVA 4EB5A 2C7TA 3E77A 4EU1A 1AHEA 2HOXA 2VMRA 3WCNA 3WGCA 3DODA 3AEMC 3JWBA 3H14A 4IY7A 4M2JA 3AEJA 4F5HA 2YRIA 3GSBA 3HL2A 3DU4A 4UQVA 3BC8A 1ELUA 2R5EA 2CSTA 2WB6A 2FKIA 1O69A 2YCNA 1QITA 2VMSA 2VGSA 1SZSA 3FZ7A 3FVSA 4ZM3A 1I43A 1KKPA 4F5FA 4N0BA 1BJOB 1ARIA 1ZOBA 5EFSA 2XH1A 4ZSWA 1AJSB 1AY5A 3B1CA 1B5OA 2CJHA 3K28A 1AHGA 3GZDA 1O61A 3AATA 3GJUA 3AOWA 1LW4A 3QHXA 2EPJA 2FM1A 4OCAA 2QA3A 4OMAA 4R2NA 3T32A 2AY7A 2CH2A 1AAMA 3L8AA 4AOAA 3A9YA 4B98A 4DBCA 3AEMA 2W7LA 5E5IA 2X8UA 3UAKA 5EUDA 5G4JA 1B8GA 4MQQA 2V0YA 1AIAA 3FVUA 5FT5A 4A72A 1AY4A 4AO9A 3BWOA 5DJ9A 3FKDA 2DGMA 4ADDA 3NU8A 1I29A 1RV3A 3BS8A 3NYTA 4HF8A 4Q76A 3KGWA 2O7CA 1LS3A 3NDNA 4XAUA 3W1IA 1G7WA 1MLYA 4ITGA 2GQNA 7AATA 2W7FA 3QGUA 1PMOA 3A9XA 3G7QA 3LV2A 1DKAA 3GR9A 4JE5D 2D7YA 4WYEA 1GC3A 4GE7A 1FG7A 3NYUA 2VIBA 1CL2A 2ZUKA 3OP7A 2W7IA 3RQ1A 2JGTA 3PD6B 1ARSA 3E2FA 3KE3A 1YIYA 4IXZA 3QM2A 5AX8A 2JJEA 2OATA 4M2KA 2HORA 3LG0A 1BW0A 2AY9A 3NU7A 2W7HA 1YJYA 4A6UA 1GEWA 3EI7A 3FQAA 3VK2A 2D7ZA 5KTBA 4OYTA 5M4DA 2HP1A 3D6KA 5G0AA 4JF0A 2BI9A 5F9SA 1TASA 2ZJGA 4WD2A 4MQPA 1QJ3A 3ATHA 2VGTA 1B9HA 4Q6RA 3F9TA 5LH9A 1I41A 3L44A 2QB2A 4MY5A 2VLHA 1S06A 1JG8A 1UU1A 1WYUA 1WYTB 3VOMA 2CINA 2VMUA 4K05A 1FC4A 3AV7A 4LNJA 5F8VA 4XJOA 1QIRA 4ISYA 4E3RA 3FZ6A 1IX8A 3FFHA 4PIWA 4WXFA 1EG5A 2BYJA 1D7UA 2W7GA 5EIGB 2O0RA 4WYCA 1ARHA 5EAVA 2VMOA 3IHJA 1TATA 1CL1A 1TOGA 4LW4A 1LC7A 2GMUA 1LKCA 4UOYA 3NX3A 3BB8A 4RKCA 3M5UA 4WLHA 5EIGA 1SVVA 5G09A 1SZKA 4O6ZA 3TFTA 1KL2A 2FNIA 3EZSA 4DQ6A 4WXGA 2Z1YA 3FFRA 1IVRA 2BHXA 2OKJA 3FVXA 2PB2A 4KAMA 1BJOA 4OBVA 3TATA 4CBRA 1ASDA 4GSAA 1D7VA 1Z7DA 3HLMA 3MC6A 1AAWA 1WKHA 3JWAA 4AH3A 1VP4A 4FFCA 4OT8A 1M0QA 3GETA 5HXXA 3PDBA 2GMSA 1X29A 2ZY3A 2X5FA 1WSTA 3K40A 1D2FA 3WCOA 1V2DA 2EZ1A 2ORDA 4WLJA 2Z1ZA 2Z9VA 4M2MA 1AKAA 2Z61A 1YAAA 2OGEA 2WK9A 4JEZA 4RLGA 3Q8NA 1W7NA 4KYOA 2BWPA 1C7GA 1KMJA 1M0OA 4EFFA 4BMKA 1LC8A 1N8PA 1QJ5A 4U2HA 1X2AA 2YKYA 3N4RA 3AENB 2YRRA 3FDDA 1P3WA 3DC1A 4RJ0A 2VMPA 1ASAA 3COGA 2OQXA 1IAYA 4ZDOA 4PFFA 2WK8A 2WK7A 1YOOA 4BA5A 4F5JA 1AICA 2VGZA 5FT8A 1M0PA 2D65A 3FZ8A 3KGXA 4IXSA 3DYDA 3LVLB 4WYAA 4OTLA 1E5EA 1YNUA 2GB3A 3N0LA 4HVKA 1V2EA 2JISA 1J04A 3A2BA 4LNLA 1SF2A 4MKJA 1AMQA 3QN6A 1TPLA 3JTXA 3LVKA 1EQBA 1C4KA 1VJOA 3PGYA 3HDOA 1D7RA 3EUCA 5E4ZA 3FRKA 4Y0IA 3RBFA 3P6KA 3TQXA 1H1CA 1LC5A 4RIZA 3R9AA 3CQ4A 4F5LA 5D5SA 5EUEA 4P3MA 1ASCA 1CZEA 3NYSA 2W7MA 3B46A 4GDYA 4A0HA 1GEXA 3DXVA 4RKDA 3EI8A 4RITA 4ADEA 1BQAA 4J8LA 1UKJA 2YHKA 2AY1A 1V2FA 4R8DA 3RUYA 1IJIA 4CVQA 4W5KA 2VMQA 3BCBA 1G4XA 3LVMA 3MBBA 4KXKA 1Z3ZA 2D63A 2YKVA 1C0NA 1DJUA 1BT4A 4L0OA 4LW2A 1KMKA 2YCPA 1KL1A 1B5PA 4IYOB 3PA9A 1IBJA 4JF1A 1N2TA 4H63Q 2BI1A 1H0CA 3BCAA 1SPAA 1X28A 3EI6A 1TOKA 4ZAHA 3B1EA 3I5TA 2D64A 1AHFA 4XJLA 2O1BA 2VMZA 3P1TA 4JE5A 1B9IA 1T3IA 3FQ7A 1G7XA 1GBNA 4P7YA 5I92A 4GEBA 2VGUA 2RFVA 4RAEA 3VP6A 1B4XA 2PB0A 3B1DA 3QI6A 2Z9XA 4XJPA 1S0AA 2AEUA 1AY8A 1X0MA 3CBFA 2QSRA 3GBXA 4Q75A 5G4IA 1W23A 5IWQA 2BI5A 2BIEA 3E2ZB 3E9KA 2ZY4A 3EZ1A 3FCRA 1ASEA 2JJFA 3AENA 4NOGA 3JW9A 3WY7A 3DR4A 1W3UA 1XI9A 4W8IA 3BCXA 3MKJA 3ZZJA 4F5IA 3QBOA 4K2IA 4W1VA 2FYFA 1Y4IA 4TN4A 2CY8A 1E5FA 3CAIA 2R0TA 1LK9A 1PFFA 1MAQA 2D5YA 1TARA 3ELEA 2ZP7A 3QPGA 3RCHB 3WZFA 4F5GA 2CJDA 3USFA 4F5KA 3MAFB 1QISA 2AY8A 2OKKA 4K2MA 2QMAA 2CFBA 2D61A 2HUUA 4BA4A 8AATA 3NRAA 1ASNA 1BJ4A 3FD0A 5EUNA 4WYGA 1AKBA 5EAAA 1GC0A 3H7FA 4FL0A 2BWNA 3JU7A 2AATA 2FQ6A 1GD9A 3UE8A 5DJ1A 4ADBA 1C7OA 4K2BA 1KKJA 3HBXA 3GZDC 4A00A 5K8BA 4W1XA 4JEVA 4ATQA 2BYLA 1D7SA 2DGKA 1SZUA 2R5CA 3GZCA 1DGEA 2YKUA 3MEBA 3RBLA 1AKCA 2VMTA 3IF2A 2C81A 2OGAA 1MDOA 3BWNC 3JZLA 2QB3A 2BI2A 2VGWA 1U08A 1ARGA 2DKBA 3ECDA 3LWSA 2W8UA 2D66A 4WYDA 3ASAA 1BQDA 1O62A 4ADCA 5C6UA 4BHDA 3DZZA 1GCKA 4CXRA 3I4JA 3G8MA 4AZJA 2W7KA 4W91A 3RI6A 2DKJA 2PO3A 2VI9A 3H9XA 3HMUA 4RM1A 5E3KA 2XBNA 3GWPA 3LVJA 2QLRA 3ZRPA 4E1OA 4F5MA 3I16A 3MC6C 3CQ5A 2AEVA 1QZ9A 4A6TA 5M4BA 1AMAA 1CZCA 2VLFA 2W8JA 3F0HA 5TF5A 2X3LA 1DFOA 3FDBA 1DTYA 3PDBB 3EIBA 5EQCA 4ZM4A 5G2QA 2HOYA 1MAPA 1OXOA 1BJNA 3EI9A 3PD6A 3W1JA 1WYVB 1IX6A 5HDMA 3MADA 1TOIA 2Q7WA 2VMVA 4TMRA 1AMSA 3HQTA 4TV7A 2DOUA 2TPLA 4W1WA 5DX5A 4A0GA 2G7JA 2DGLA 4JEXA 2A1VA 4IXOA 3G0TA 2AY2A 4CBSA 4GRXA 2VMNA 3F6TA 2W7JA 2GSAA 4E77A 2HOZA 1YIZA 4R5ZA 2JJHA 4JEWA 2JG2A 1ASFA 4B9BA 2AY6A 3ZRRA 5J8QA 3WGBA 3ZRQA 1M4NA 1RVYA 3AEJC 1OHWA 4WB0A 4AZKA 2V1PA 2W7DA 4UHNA 4DGTA 2ZY2A 3WX9A 2BIGA 1OXPA 1GDEA 4GE4A 2YOBA 3PJ0A 4XEWA 5HHYA 2E54A 4XQ2A 2ZSLA 3VAXA 2AY3A 1ASLA 3WLXA 2C44A 3A8UX 2R5CB 2C0RA 3NNKA 1UU0A 2EZ2A 2ZSMA 1IUGA 2Z9UA 2ZYJA 3FTBA 1IX7A 2YCTA 4IYOA 4MKKA 4A0RA 1WYVA 2W8VA 3KKIA 1W7LA 3PPLA 4OC9A 3LY1A 2BIAA 1AHXA 5BJ4A 1GEYA 1MDXA 5BJ3A 1ZC9A 1ASMA 2CH1A 1AJSA 3ISLA 4MGRA 4R5FA 5FT4A 2F8JA 3RCHA 1S07A 1AX4A 1UU2A 4ZWVA 2WKAA 3W1HA 4WXBA 3AEPA 4PVFA 1YJZA 2AY4A 1J32A 2Z9WA 3ZZKA 2EH6A 3MAFA 3EIAA 1OATA 1M7YA 3N7NA 2QBTA 2ZY5A 2E7UA 1M6SA 2BKWA 4LC3A 1IAXA 2VMXA 4Q31A 1TOJA 3II0A 4MSOA 5DB5A 2CTZA 4XJMA 1AJRA 1ASGA 2AY5A 3HVYA 1OHYA 3NTJA 4ATPA 5LHAA 1WYUB 1CJ0A 2DR1A 1RVUA 2VGVA 3DRDA 3BWNA 2W8TA 1GC2A 1S08A 1CS1A 1N31A 5M46A 1XEYA 1JS6A 4ZDPA 3AELA 3ELPA 4LNMA 4MQRA 4QGRA 4CXQA 2KFPA 4Y0HA 3BN1A 3E2ZA 4A0FA 4XK1A 3CQ6A 3N5MA 3BV0A 1JF9A 4ZWMA 4WP0A 2FN6A 1DGDA 5M49A 2HP2A 2BI3A 2VI8A 2Z67A 3WKSA 2JJGA 4AO4A 1BJWA 3WKRA 5JAYA 4E3QA 3DXWA 1FG3A 4H51A 1ASBA 1PMMA 3DR7A 4JEYA 3E6GA 4ZDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUI A;  1CQ8 A;  4UHM A;  1C9C A;  2ZC0 A;  1ART A;  2E7J A;  3FQ8 A;  3PIU A;  1I48 A;  1AIB A;  4U1T A;  3TCM A;  1BKG A;  4BQ0 A;  4I8A A;  1G4V A;  1C7N A;  2HZP A;  4OBU A;  1RV4 A;  1PG8 A;  1SFF A;  2VMY A;  2X5D A;  3NUI A;  3AEO A;  1DJE A;  4ZSY A;  1DJ9 A;  3HT4 A;  3R4T A;  1AMR A;  4J5U A;  5G2P A;  3ASB A;  1OHV A;  3OKS A;  1VEF A;  1W7M A;  1CQ6 A;  3A9Z A;  1YJS A;  3K7Y A;  3B8X A;  1MGV A;  2YKX A;  4UHO A;  9AAT A;  1TOE A;  1M32 A;  3MAU A;  5FT6 A;  1MLZ A;  3UWC A;  4WB0 B;  1ORD A;  2FNU A;  4EB7 A;  3TFU A;  4WBT A;  2VYC A;  1EJI A;  3FSL A;  4F4E A;  1M0N A;  1ECX A;  4GE9 A;  4N0W A;  4WYF A;  3N75 A;  1CQ7 A;  2CJG A;  3E2Y A;  3EI5 A;  2W8W A;  2G6W A;  2VIA A;  4IW7 A;  1GC4 A;  2VMW A;  1MDZ A;  2NMP A;  2CB1 A;  5D95 A;  1WKG A;  1BS0 A;  2Z20 A;  1S09 A;  3ACZ A;  3AOV A;  2W7E A;  3PDX A;  4ITX A;  1ELQ A;  1QGN A;  1ZOD A;  1V72 A;  2CAN A;  4ZAS A;  1WYT A;  4Y0D A;  2BWO A;  2EGY A;  2E7I A;  1AHY A;  2R2N A;  4EMY A;  3NUB A;  1O4S A;  4IX8 A;  4RJY A;  1JS3 A;  4A6R A;  3PAA A;  4PFN A;  3VK4 A;  1LW5 A;  2EO5 A;  3VK3 A;  2HUF A;  4ZLV A;  4EB5 A;  2C7T A;  3E77 A;  4EU1 A;  1AHE A;  2HOX A;  2VMR A;  3WCN A;  3WGC A;  3DOD A;  3AEM C;  3JWB A;  3H14 A;  4IY7 A;  4M2J A;  3AEJ A;  4F5H A;  2YRI A;  3GSB A;  3HL2 A;  3DU4 A;  4UQV A;  3BC8 A;  1ELU A;  2R5E A;  2CST A;  1O69 A;  2YCN A;  1QIT A;  2VMS A;  2VGS A;  1SZS A;  3FZ7 A;  3FVS A;  4ZM3 A;  1I43 A;  1KKP A;  4F5F A;  4N0B A;  1BJO B;  1ARI A;  1ZOB A;  5EFS A;  2XH1 A;  4ZSW A;  1AJS B;  1AY5 A;  3B1C A;  1B5O A;  2CJH A;  3K28 A;  1AHG A;  3GZD A;  1O61 A;  3AAT A;  3GJU A;  3AOW A;  1LW4 A;  3QHX A;  2EPJ A;  2FM1 A;  4OCA A;  2QA3 A;  4OMA A;  4R2N A;  3T32 A;  2AY7 A;  2CH2 A;  1AAM A;  3L8A A;  4AOA A;  3A9Y A;  4B98 A;  4DBC A;  3AEM A;  2W7L A;  5E5I A;  2X8U A;  3UAK A;  5EUD A;  5G4J A;  1B8G A;  4MQQ A;  2V0Y A;  1AIA A;  3FVU A;  5FT5 A;  4A72 A;  1AY4 A;  4AO9 A;  3BWO A;  5DJ9 A;  3FKD A;  2DGM A;  4ADD A;  3NU8 A;  1I29 A;  1RV3 A;  3BS8 A;  3NYT A;  4HF8 A;  4Q76 A;  3KGW A;  2O7C A;  1LS3 A;  3NDN A;  4XAU A;  3W1I A;  1G7W A;  1MLY A;  4ITG A;  2GQN A;  7AAT A;  2W7F A;  3QGU A;  1PMO A;  3A9X A;  3G7Q A;  3LV2 A;  1DKA A;  3GR9 A;  4JE5 D;  2D7Y A;  4WYE A;  1GC3 A;  4GE7 A;  1FG7 A;  3NYU A;  2VIB A;  1CL2 A;  2ZUK A;  3OP7 A;  2W7I A;  3RQ1 A;  2JGT A;  3PD6 B;  1ARS A;  3E2F A;  3KE3 A;  1YIY A;  4IXZ A;  3QM2 A;  5AX8 A;  2JJE A;  2OAT A;  4M2K A;  2HOR A;  3LG0 A;  1BW0 A;  2AY9 A;  3NU7 A;  2W7H A;  1YJY A;  4A6U A;  1GEW A;  3EI7 A;  3FQA A;  3VK2 A;  2D7Z A;  4OYT A;  5M4D A;  2HP1 A;  3D6K A;  5G0A A;  4JF0 A;  2BI9 A;  5F9S A;  1TAS A;  2ZJG A;  4WD2 A;  4MQP A;  1QJ3 A;  3ATH A;  2VGT A;  1B9H A;  4Q6R A;  3F9T A;  5LH9 A;  1I41 A;  3L44 A;  2QB2 A;  4MY5 A;  2VLH A;  1S06 A;  1JG8 A;  1UU1 A;  1WYU A;  1WYT B;  3VOM A;  2CIN A;  2VMU A;  1FC4 A;  3AV7 A;  4LNJ A;  5F8V A;  4XJO A;  1QIR A;  4ISY A;  4E3R A;  3FZ6 A;  1IX8 A;  3FFH A;  4PIW A;  4WXF A;  1EG5 A;  2BYJ A;  1D7U A;  2W7G A;  5EIG B;  2O0R A;  4WYC A;  1ARH A;  5EAV A;  2VMO A;  3IHJ A;  1TAT A;  1CL1 A;  1TOG A;  4LW4 A;  1LC7 A;  2GMU A;  1LKC A;  4UOY A;  3NX3 A;  3BB8 A;  4RKC A;  3M5U A;  4WLH A;  5EIG A;  1SVV A;  5G09 A;  1SZK A;  4O6Z A;  3TFT A;  1KL2 A;  2FNI A;  3EZS A;  4DQ6 A;  4WXG A;  2Z1Y A;  3FFR A;  1IVR A;  2BHX A;  2OKJ A;  3FVX A;  2PB2 A;  4KAM A;  1BJO A;  4OBV A;  3TAT A;  4CBR A;  1ASD A;  4GSA A;  1D7V A;  1Z7D A;  3HLM A;  3MC6 A;  1AAW A;  1WKH A;  3JWA A;  4AH3 A;  1VP4 A;  4FFC A;  4OT8 A;  1M0Q A;  3GET A;  5HXX A;  3PDB A;  2GMS A;  1X29 A;  2ZY3 A;  2X5F A;  1WST A;  3K40 A;  1D2F A;  3WCO A;  1V2D A;  2EZ1 A;  2ORD A;  4WLJ A;  2Z1Z A;  2Z9V A;  4M2M A;  1AKA A;  2Z61 A;  1YAA A;  2OGE A;  2WK9 A;  4JEZ A;  4RLG A;  3Q8N A;  1W7N A;  4KYO A;  2BWP A;  1C7G A;  1KMJ A;  1M0O A;  4EFF A;  4BMK A;  1LC8 A;  1N8P A;  1QJ5 A;  4U2H A;  1X2A A;  2YKY A;  3AEN B;  2YRR A;  3FDD A;  1P3W A;  3DC1 A;  4RJ0 A;  2VMP A;  1ASA A;  3COG A;  2OQX A;  1IAY A;  4ZDO A;  4PFF A;  2WK8 A;  2WK7 A;  1YOO A;  4BA5 A;  4F5J A;  1AIC A;  2VGZ A;  5FT8 A;  1M0P A;  2D65 A;  3FZ8 A;  3KGX A;  4IXS A;  3DYD A;  3LVL B;  4WYA A;  4OTL A;  1E5E A;  1YNU A;  2GB3 A;  3N0L A;  4HVK A;  1V2E A;  2JIS A;  1J04 A;  3A2B A;  4LNL A;  1SF2 A;  4MKJ A;  1AMQ A;  3QN6 A;  1TPL A;  3JTX A;  3LVK A;  1EQB A;  1C4K A;  1VJO A;  3PGY A;  3HDO A;  1D7R A;  3EUC A;  5E4Z A;  3FRK A;  4Y0I A;  3RBF A;  3P6K A;  3TQX A;  1H1C A;  1LC5 A;  4RIZ A;  3R9A A;  3CQ4 A;  4F5L A;  5D5S A;  5EUE A;  4P3M A;  1ASC A;  1CZE A;  3NYS A;  2W7M A;  3B46 A;  4GDY A;  4A0H A;  1GEX A;  3DXV A;  4RKD A;  3EI8 A;  4RIT A;  4ADE A;  1BQA A;  4J8L A;  1UKJ A;  2YHK A;  2AY1 A;  1V2F A;  4R8D A;  3RUY A;  1IJI A;  4CVQ A;  4W5K A;  2VMQ A;  3BCB A;  1G4X A;  3LVM A;  3MBB A;  4KXK A;  1Z3Z A;  2D63 A;  2YKV A;  1C0N A;  1DJU A;  1BT4 A;  4L0O A;  4LW2 A;  1KMK A;  2YCP A;  1KL1 A;  1B5P A;  4IYO B;  3PA9 A;  1IBJ A;  4JF1 A;  1N2T A;  2BI1 A;  1H0C A;  3BCA A;  1SPA A;  1X28 A;  3EI6 A;  1TOK A;  4ZAH A;  3B1E A;  3I5T A;  2D64 A;  1AHF A;  4XJL A;  2O1B A;  2VMZ A;  3P1T A;  4JE5 A;  1B9I A;  1T3I A;  3FQ7 A;  1G7X A;  1GBN A;  4P7Y A;  5I92 A;  4GEB A;  2VGU A;  2RFV A;  4RAE A;  3VP6 A;  1B4X A;  2PB0 A;  3B1D A;  3QI6 A;  2Z9X A;  4XJP A;  1S0A A;  2AEU A;  1AY8 A;  1X0M A;  3CBF A;  3GBX A;  4Q75 A;  5G4I A;  1W23 A;  5IWQ A;  2BI5 A;  2BIE A;  3E2Z B;  3E9K A;  2ZY4 A;  3EZ1 A;  3FCR A;  1ASE A;  2JJF A;  3AEN A;  4NOG A;  3JW9 A;  3WY7 A;  3DR4 A;  1W3U A;  1XI9 A;  4W8I A;  3BCX A;  3MKJ A;  3ZZJ A;  4F5I A;  3QBO A;  4K2I A;  4W1V A;  2FYF A;  1Y4I A;  4TN4 A;  2CY8 A;  1E5F A;  3CAI A;  2R0T A;  1LK9 A;  1PFF A;  1MAQ A;  2D5Y A;  1TAR A;  3ELE A;  2ZP7 A;  3QPG A;  3RCH B;  3WZF A;  4F5G A;  2CJD A;  3USF A;  4F5K A;  3MAF B;  1QIS A;  2AY8 A;  2OKK A;  4K2M A;  2QMA A;  2CFB A;  2D61 A;  2HUU A;  4BA4 A;  8AAT A;  3NRA A;  1ASN A;  1BJ4 A;  3FD0 A;  5EUN A;  4WYG A;  1AKB A;  5EAA A;  1GC0 A;  3H7F A;  4FL0 A;  2BWN A;  3JU7 A;  2AAT A;  2FQ6 A;  1GD9 A;  3UE8 A;  5DJ1 A;  4ADB A;  1C7O A;  4K2B A;  1KKJ A;  3HBX A;  3GZD C;  4A00 A;  5K8B A;  4W1X A;  4JEV A;  4ATQ A;  2BYL A;  1D7S A;  2DGK A;  1SZU A;  2R5C A;  3GZC A;  1DGE A;  2YKU A;  3MEB A;  3RBL A;  1AKC A;  2VMT A;  3IF2 A;  2C81 A;  2OGA A;  1MDO A;  3BWN C;  3JZL A;  2QB3 A;  2BI2 A;  2VGW A;  1U08 A;  1ARG A;  2DKB A;  3ECD A;  3LWS A;  2W8U A;  2D66 A;  4WYD A;  3ASA A;  1BQD A;  1O62 A;  4ADC A;  5C6U A;  4BHD A;  3DZZ A;  1GCK A;  4CXR A;  3I4J A;  3G8M A;  4AZJ A;  2W7K A;  4W91 A;  3RI6 A;  2DKJ A;  2PO3 A;  2VI9 A;  3HMU A;  4RM1 A;  5E3K A;  2XBN A;  3GWP A;  3LVJ A;  2QLR A;  3ZRP A;  4E1O A;  4F5M A;  3I16 A;  3MC6 C;  3CQ5 A;  2AEV A;  1QZ9 A;  4A6T A;  5M4B A;  1AMA A;  1CZC A;  2VLF A;  2W8J A;  3F0H A;  5TF5 A;  2X3L A;  1DFO A;  3FDB A;  1DTY A;  3PDB B;  3EIB A;  5EQC A;  4ZM4 A;  5G2Q A;  2HOY A;  1MAP A;  1OXO A;  1BJN A;  3EI9 A;  3PD6 A;  3W1J A;  1WYV B;  1IX6 A;  5HDM A;  3MAD A;  1TOI A;  2Q7W A;  2VMV A;  4TMR A;  1AMS A;  3HQT A;  4TV7 A;  2DOU A;  2TPL A;  4W1W A;  5DX5 A;  4A0G A;  2DGL A;  4JEX A;  4IXO A;  3G0T A;  2AY2 A;  4CBS A;  4GRX A;  2VMN A;  3F6T A;  2W7J A;  2GSA A;  4E77 A;  2HOZ A;  1YIZ A;  4R5Z A;  2JJH A;  4JEW A;  2JG2 A;  1ASF A;  4B9B A;  2AY6 A;  3ZRR A;  5J8Q A;  3WGB A;  3ZRQ A;  1M4N A;  1RVY A;  3AEJ C;  1OHW A;  4WB0 A;  4AZK A;  2V1P A;  2W7D A;  4UHN A;  4DGT A;  2ZY2 A;  3WX9 A;  2BIG A;  1OXP A;  1GDE A;  4GE4 A;  2YOB A;  3PJ0 A;  4XEW A;  5HHY A;  2E54 A;  4XQ2 A;  2ZSL A;  3VAX A;  2AY3 A;  1ASL A;  3WLX A;  2C44 A;  3A8U X;  2R5C B;  2C0R A;  3NNK A;  1UU0 A;  2EZ2 A;  2ZSM A;  1IUG A;  2Z9U A;  2ZYJ A;  3FTB A;  1IX7 A;  2YCT A;  4IYO A;  4MKK A;  4A0R A;  1WYV A;  2W8V A;  3KKI A;  1W7L A;  3PPL A;  4OC9 A;  3LY1 A;  2BIA A;  1AHX A;  5BJ4 A;  1GEY A;  1MDX A;  5BJ3 A;  1ZC9 A;  1ASM A;  2CH1 A;  1AJS A;  3ISL A;  4MGR A;  4R5F A;  5FT4 A;  2F8J A;  3RCH A;  1S07 A;  1AX4 A;  1UU2 A;  4ZWV A;  2WKA A;  3W1H A;  4WXB A;  3AEP A;  4PVF A;  1YJZ A;  2AY4 A;  1J32 A;  2Z9W A;  3ZZK A;  2EH6 A;  3MAF A;  3EIA A;  1OAT A;  1M7Y A;  2QBT A;  2ZY5 A;  2E7U A;  1M6S A;  2BKW A;  4LC3 A;  1IAX A;  2VMX A;  4Q31 A;  1TOJ A;  3II0 A;  4MSO A;  5DB5 A;  2CTZ A;  4XJM A;  1AJR A;  1ASG A;  2AY5 A;  3HVY A;  1OHY A;  3NTJ A;  4ATP A;  5LHA A;  1WYU B;  1CJ0 A;  2DR1 A;  1RVU A;  2VGV A;  3DRD A;  3BWN A;  2W8T A;  1GC2 A;  1S08 A;  1CS1 A;  1N31 A;  5M46 A;  1XEY A;  1JS6 A;  4ZDP A;  3AEL A;  3ELP A;  4LNM A;  4MQR A;  4QGR A;  4CXQ A;  4Y0H A;  3BN1 A;  3E2Z A;  4A0F A;  4XK1 A;  3CQ6 A;  3N5M A;  3BV0 A;  1JF9 A;  4ZWM A;  4WP0 A;  2FN6 A;  1DGD A;  5M49 A;  2HP2 A;  2BI3 A;  2VI8 A;  2Z67 A;  3WKS A;  2JJG A;  4AO4 A;  1BJW A;  3WKR A;  5JAY A;  4E3Q A;  3DXW A;  1FG3 A;  4H51 A;  1ASB A;  1PMM A;  3DR7 A;  4JEY A;  3E6G A;  4ZDL A; 
#chains in the Genus database with same CATH topology
 2HUI A;  1CQ8 A;  4UHM A;  1C9C A;  2ZC0 A;  1ART A;  2E7J A;  3FQ8 A;  3PIU A;  1I48 A;  1AIB A;  4U1T A;  3TCM A;  1BKG A;  4BQ0 A;  4I8A A;  1G4V A;  1C7N A;  2HZP A;  4OBU A;  1RV4 A;  1PG8 A;  1SFF A;  2VMY A;  2X5D A;  3NUI A;  3AEO A;  1DJE A;  4ZSY A;  1DJ9 A;  3HT4 A;  3R4T A;  1AMR A;  4J5U A;  5G2P A;  3ASB A;  1OHV A;  3OKS A;  1VEF A;  2EYQ A;  1W7M A;  1CQ6 A;  3A9Z A;  1YJS A;  3K7Y A;  3B8X A;  1MGV A;  2YKX A;  4UHO A;  9AAT A;  1TOE A;  1M32 A;  3MAU A;  5FT6 A;  1MLZ A;  3UWC A;  4WB0 B;  1ORD A;  3N4X A;  2FNU A;  4EB7 A;  3TFU A;  4WBT A;  2VYC A;  1EJI A;  3FSL A;  4F4E A;  1M0N A;  1ECX A;  4GE9 A;  4N0W A;  4WYF A;  3N75 A;  1CQ7 A;  2CJG A;  3E2Y A;  3EI5 A;  2W8W A;  2G6W A;  2VIA A;  4IW7 A;  1GC4 A;  2VMW A;  1MDZ A;  2NMP A;  2CB1 A;  5D95 A;  1WKG A;  1BS0 A;  2Z20 A;  1S09 A;  3ACZ A;  3AOV A;  2W7E A;  3PDX A;  4ITX A;  1ELQ A;  1QGN A;  1ZOD A;  1V72 A;  2CAN A;  4ZAS A;  1WYT A;  4Y0D A;  2BWO A;  2EGY A;  2E7I A;  1AHY A;  2R2N A;  4EMY A;  3NUB A;  1O4S A;  4IX8 A;  4RJY A;  1JS3 A;  4A6R A;  3N4S A;  3PAA A;  4PFN A;  3VK4 A;  1LW5 A;  2EO5 A;  3VK3 A;  2HUF A;  4ZLV A;  4EB5 A;  2C7T A;  3E77 A;  4EU1 A;  1AHE A;  2HOX A;  2VMR A;  3WCN A;  3WGC A;  3DOD A;  3AEM C;  3JWB A;  3H14 A;  4IY7 A;  4M2J A;  3AEJ A;  4F5H A;  2YRI A;  3GSB A;  3HL2 A;  3DU4 A;  4UQV A;  3BC8 A;  1ELU A;  2R5E A;  2CST A;  2WB6 A;  2FKI A;  1O69 A;  2YCN A;  1QIT A;  2VMS A;  2VGS A;  1SZS A;  3FZ7 A;  3FVS A;  4ZM3 A;  1I43 A;  1KKP A;  4F5F A;  4N0B A;  1BJO B;  1ARI A;  1ZOB A;  5EFS A;  2XH1 A;  4ZSW A;  1AJS B;  1AY5 A;  3B1C A;  1B5O A;  2CJH A;  3K28 A;  1AHG A;  3GZD A;  1O61 A;  3AAT A;  3GJU A;  3AOW A;  1LW4 A;  3QHX A;  2EPJ A;  2FM1 A;  4OCA A;  2QA3 A;  4OMA A;  4R2N A;  3T32 A;  2AY7 A;  2CH2 A;  1AAM A;  3L8A A;  4AOA A;  3A9Y A;  4B98 A;  4DBC A;  3AEM A;  2W7L A;  5E5I A;  2X8U A;  3UAK A;  5EUD A;  5G4J A;  1B8G A;  4MQQ A;  2V0Y A;  1AIA A;  3FVU A;  5FT5 A;  4A72 A;  1AY4 A;  4AO9 A;  3BWO A;  5DJ9 A;  3FKD A;  2DGM A;  4ADD A;  3NU8 A;  1I29 A;  1RV3 A;  3BS8 A;  3NYT A;  4HF8 A;  4Q76 A;  3KGW A;  2O7C A;  1LS3 A;  3NDN A;  4XAU A;  3W1I A;  1G7W A;  1MLY A;  4ITG A;  2GQN A;  7AAT A;  2W7F A;  3QGU A;  1PMO A;  3A9X A;  3G7Q A;  3LV2 A;  1DKA A;  3GR9 A;  4JE5 D;  2D7Y A;  4WYE A;  1GC3 A;  4GE7 A;  1FG7 A;  3NYU A;  2VIB A;  1CL2 A;  2ZUK A;  3OP7 A;  2W7I A;  3RQ1 A;  2JGT A;  3PD6 B;  1ARS A;  3E2F A;  3KE3 A;  1YIY A;  4IXZ A;  3QM2 A;  5AX8 A;  2JJE A;  2OAT A;  4M2K A;  2HOR A;  3LG0 A;  1BW0 A;  2AY9 A;  3NU7 A;  2W7H A;  1YJY A;  4A6U A;  1GEW A;  3EI7 A;  3FQA A;  3VK2 A;  2D7Z A;  5KTB A;  4OYT A;  5M4D A;  2HP1 A;  3D6K A;  5G0A A;  4JF0 A;  2BI9 A;  5F9S A;  1TAS A;  2ZJG A;  4WD2 A;  4MQP A;  1QJ3 A;  3ATH A;  2VGT A;  1B9H A;  4Q6R A;  3F9T A;  5LH9 A;  1I41 A;  3L44 A;  2QB2 A;  4MY5 A;  2VLH A;  1S06 A;  1JG8 A;  1UU1 A;  1WYU A;  1WYT B;  3VOM A;  2CIN A;  2VMU A;  4K05 A;  1FC4 A;  3AV7 A;  4LNJ A;  5F8V A;  4XJO A;  1QIR A;  4ISY A;  4E3R A;  3FZ6 A;  1IX8 A;  3FFH A;  4PIW A;  4WXF A;  1EG5 A;  2BYJ A;  1D7U A;  2W7G A;  5EIG B;  2O0R A;  4WYC A;  1ARH A;  5EAV A;  2VMO A;  3IHJ A;  1TAT A;  1CL1 A;  1TOG A;  4LW4 A;  1LC7 A;  2GMU A;  1LKC A;  4UOY A;  3NX3 A;  3BB8 A;  4RKC A;  3M5U A;  4WLH A;  5EIG A;  1SVV A;  5G09 A;  1SZK A;  4O6Z A;  3TFT A;  1KL2 A;  2FNI A;  3EZS A;  4DQ6 A;  4WXG A;  2Z1Y A;  3FFR A;  1IVR A;  2BHX A;  2OKJ A;  3FVX A;  2PB2 A;  4KAM A;  1BJO A;  4OBV A;  3TAT A;  4CBR A;  1ASD A;  4GSA A;  1D7V A;  1Z7D A;  3HLM A;  3MC6 A;  1AAW A;  1WKH A;  3JWA A;  4AH3 A;  1VP4 A;  4FFC A;  4OT8 A;  1M0Q A;  3GET A;  5HXX A;  3PDB A;  2GMS A;  1X29 A;  2ZY3 A;  2X5F A;  1WST A;  3K40 A;  1D2F A;  3WCO A;  1V2D A;  2EZ1 A;  2ORD A;  4WLJ A;  2Z1Z A;  2Z9V A;  4M2M A;  1AKA A;  2Z61 A;  1YAA A;  2OGE A;  2WK9 A;  4JEZ A;  4RLG A;  3Q8N A;  1W7N A;  4KYO A;  2BWP A;  1C7G A;  1KMJ A;  1M0O A;  4EFF A;  4BMK A;  1LC8 A;  1N8P A;  1QJ5 A;  4U2H A;  1X2A A;  2YKY A;  3N4R A;  3AEN B;  2YRR A;  3FDD A;  1P3W A;  3DC1 A;  4RJ0 A;  2VMP A;  1ASA A;  3COG A;  2OQX A;  1IAY A;  4ZDO A;  4PFF A;  2WK8 A;  2WK7 A;  1YOO A;  4BA5 A;  4F5J A;  1AIC A;  2VGZ A;  5FT8 A;  1M0P A;  2D65 A;  3FZ8 A;  3KGX A;  4IXS A;  3DYD A;  3LVL B;  4WYA A;  4OTL A;  1E5E A;  1YNU A;  2GB3 A;  3N0L A;  4HVK A;  1V2E A;  2JIS A;  1J04 A;  3A2B A;  4LNL A;  1SF2 A;  4MKJ A;  1AMQ A;  3QN6 A;  1TPL A;  3JTX A;  3LVK A;  1EQB A;  1C4K A;  1VJO A;  3PGY A;  3HDO A;  1D7R A;  3EUC A;  5E4Z A;  3FRK A;  4Y0I A;  3RBF A;  3P6K A;  3TQX A;  1H1C A;  1LC5 A;  4RIZ A;  3R9A A;  3CQ4 A;  4F5L A;  5D5S A;  5EUE A;  4P3M A;  1ASC A;  1CZE A;  3NYS A;  2W7M A;  3B46 A;  4GDY A;  4A0H A;  1GEX A;  3DXV A;  4RKD A;  3EI8 A;  4RIT A;  4ADE A;  1BQA A;  4J8L A;  1UKJ A;  2YHK A;  2AY1 A;  1V2F A;  4R8D A;  3RUY A;  1IJI A;  4CVQ A;  4W5K A;  2VMQ A;  3BCB A;  1G4X A;  3LVM A;  3MBB A;  4KXK A;  1Z3Z A;  2D63 A;  2YKV A;  1C0N A;  1DJU A;  1BT4 A;  4L0O A;  4LW2 A;  1KMK A;  2YCP A;  1KL1 A;  1B5P A;  4IYO B;  3PA9 A;  1IBJ A;  4JF1 A;  1N2T A;  4H63 Q;  2BI1 A;  1H0C A;  3BCA A;  1SPA A;  1X28 A;  3EI6 A;  1TOK A;  4ZAH A;  3B1E A;  3I5T A;  2D64 A;  1AHF A;  4XJL A;  2O1B A;  2VMZ A;  3P1T A;  4JE5 A;  1B9I A;  1T3I A;  3FQ7 A;  1G7X A;  1GBN A;  4P7Y A;  5I92 A;  4GEB A;  2VGU A;  2RFV A;  4RAE A;  3VP6 A;  1B4X A;  2PB0 A;  3B1D A;  3QI6 A;  2Z9X A;  4XJP A;  1S0A A;  2AEU A;  1AY8 A;  1X0M A;  3CBF A;  2QSR A;  3GBX A;  4Q75 A;  5G4I A;  1W23 A;  5IWQ A;  2BI5 A;  2BIE A;  3E2Z B;  3E9K A;  2ZY4 A;  3EZ1 A;  3FCR A;  1ASE A;  2JJF A;  3AEN A;  4NOG A;  3JW9 A;  3WY7 A;  3DR4 A;  1W3U A;  1XI9 A;  4W8I A;  3BCX A;  3MKJ A;  3ZZJ A;  4F5I A;  3QBO A;  4K2I A;  4W1V A;  2FYF A;  1Y4I A;  4TN4 A;  2CY8 A;  1E5F A;  3CAI A;  2R0T A;  1LK9 A;  1PFF A;  1MAQ A;  2D5Y A;  1TAR A;  3ELE A;  2ZP7 A;  3QPG A;  3RCH B;  3WZF A;  4F5G A;  2CJD A;  3USF A;  4F5K A;  3MAF B;  1QIS A;  2AY8 A;  2OKK A;  4K2M A;  2QMA A;  2CFB A;  2D61 A;  2HUU A;  4BA4 A;  8AAT A;  3NRA A;  1ASN A;  1BJ4 A;  3FD0 A;  5EUN A;  4WYG A;  1AKB A;  5EAA A;  1GC0 A;  3H7F A;  4FL0 A;  2BWN A;  3JU7 A;  2AAT A;  2FQ6 A;  1GD9 A;  3UE8 A;  5DJ1 A;  4ADB A;  1C7O A;  4K2B A;  1KKJ A;  3HBX A;  3GZD C;  4A00 A;  5K8B A;  4W1X A;  4JEV A;  4ATQ A;  2BYL A;  1D7S A;  2DGK A;  1SZU A;  2R5C A;  3GZC A;  1DGE A;  2YKU A;  3MEB A;  3RBL A;  1AKC A;  2VMT A;  3IF2 A;  2C81 A;  2OGA A;  1MDO A;  3BWN C;  3JZL A;  2QB3 A;  2BI2 A;  2VGW A;  1U08 A;  1ARG A;  2DKB A;  3ECD A;  3LWS A;  2W8U A;  2D66 A;  4WYD A;  3ASA A;  1BQD A;  1O62 A;  4ADC A;  5C6U A;  4BHD A;  3DZZ A;  1GCK A;  4CXR A;  3I4J A;  3G8M A;  4AZJ A;  2W7K A;  4W91 A;  3RI6 A;  2DKJ A;  2PO3 A;  2VI9 A;  3H9X A;  3HMU A;  4RM1 A;  5E3K A;  2XBN A;  3GWP A;  3LVJ A;  2QLR A;  3ZRP A;  4E1O A;  4F5M A;  3I16 A;  3MC6 C;  3CQ5 A;  2AEV A;  1QZ9 A;  4A6T A;  5M4B A;  1AMA A;  1CZC A;  2VLF A;  2W8J A;  3F0H A;  5TF5 A;  2X3L A;  1DFO A;  3FDB A;  1DTY A;  3PDB B;  3EIB A;  5EQC A;  4ZM4 A;  5G2Q A;  2HOY A;  1MAP A;  1OXO A;  1BJN A;  3EI9 A;  3PD6 A;  3W1J A;  1WYV B;  1IX6 A;  5HDM A;  3MAD A;  1TOI A;  2Q7W A;  2VMV A;  4TMR A;  1AMS A;  3HQT A;  4TV7 A;  2DOU A;  2TPL A;  4W1W A;  5DX5 A;  4A0G A;  1KAF A;  2G7J A;  2DGL A;  4JEX A;  2A1V A;  4IXO A;  3G0T A;  2AY2 A;  4CBS A;  4GRX A;  2VMN A;  3F6T A;  2W7J A;  2GSA A;  4E77 A;  2HOZ A;  1YIZ A;  4R5Z A;  2JJH A;  4JEW A;  2JG2 A;  1ASF A;  4B9B A;  2AY6 A;  3ZRR A;  5J8Q A;  3WGB A;  3ZRQ A;  1M4N A;  1RVY A;  3AEJ C;  1OHW A;  4WB0 A;  4AZK A;  2V1P A;  2W7D A;  4UHN A;  4DGT A;  2ZY2 A;  3WX9 A;  2BIG A;  1OXP A;  1GDE A;  4GE4 A;  2YOB A;  3PJ0 A;  4XEW A;  5HHY A;  2E54 A;  4XQ2 A;  2ZSL A;  3VAX A;  2AY3 A;  1ASL A;  3WLX A;  2C44 A;  3A8U X;  2R5C B;  2C0R A;  3NNK A;  1UU0 A;  2EZ2 A;  2ZSM A;  1IUG A;  2Z9U A;  2ZYJ A;  3FTB A;  1IX7 A;  2YCT A;  4IYO A;  4MKK A;  4A0R A;  1WYV A;  2W8V A;  3KKI A;  1W7L A;  3PPL A;  4OC9 A;  3LY1 A;  2BIA A;  1AHX A;  5BJ4 A;  1GEY A;  1MDX A;  5BJ3 A;  1ZC9 A;  1ASM A;  2CH1 A;  1AJS A;  3ISL A;  4MGR A;  4R5F A;  5FT4 A;  2F8J A;  3RCH A;  1S07 A;  1AX4 A;  1UU2 A;  4ZWV A;  2WKA A;  3W1H A;  4WXB A;  3AEP A;  4PVF A;  1YJZ A;  2AY4 A;  1J32 A;  2Z9W A;  3ZZK A;  2EH6 A;  3MAF A;  3EIA A;  1OAT A;  1M7Y A;  3N7N A;  2QBT A;  2ZY5 A;  2E7U A;  1M6S A;  2BKW A;  4LC3 A;  1IAX A;  2VMX A;  4Q31 A;  1TOJ A;  3II0 A;  4MSO A;  5DB5 A;  2CTZ A;  4XJM A;  1AJR A;  1ASG A;  2AY5 A;  3HVY A;  1OHY A;  3NTJ A;  4ATP A;  5LHA A;  1WYU B;  1CJ0 A;  2DR1 A;  1RVU A;  2VGV A;  3DRD A;  3BWN A;  2W8T A;  1GC2 A;  1S08 A;  1CS1 A;  1N31 A;  5M46 A;  1XEY A;  1JS6 A;  4ZDP A;  3AEL A;  3ELP A;  4LNM A;  4MQR A;  4QGR A;  4CXQ A;  2KFP A;  4Y0H A;  3BN1 A;  3E2Z A;  4A0F A;  4XK1 A;  3CQ6 A;  3N5M A;  3BV0 A;  1JF9 A;  4ZWM A;  4WP0 A;  2FN6 A;  1DGD A;  5M49 A;  2HP2 A;  2BI3 A;  2VI8 A;  2Z67 A;  3WKS A;  2JJG A;  4AO4 A;  1BJW A;  3WKR A;  5JAY A;  4E3Q A;  3DXW A;  1FG3 A;  4H51 A;  1ASB A;  1PMM A;  3DR7 A;  4JEY A;  3E6G A;  4ZDL A; 
#chains in the Genus database with same CATH homology
 2HUI A;  1CQ8 A;  4UHM A;  1C9C A;  2ZC0 A;  1ART A;  2E7J A;  3FQ8 A;  3PIU A;  1I48 A;  1AIB A;  4U1T A;  3TCM A;  1BKG A;  4BQ0 A;  4I8A A;  1G4V A;  1C7N A;  2HZP A;  4OBU A;  1RV4 A;  1PG8 A;  1SFF A;  2VMY A;  2X5D A;  3NUI A;  3AEO A;  1DJE A;  4ZSY A;  1DJ9 A;  3HT4 A;  3R4T A;  1AMR A;  4J5U A;  5G2P A;  3ASB A;  1OHV A;  3OKS A;  1VEF A;  2EYQ A;  1W7M A;  1CQ6 A;  3A9Z A;  1YJS A;  3K7Y A;  3B8X A;  1MGV A;  2YKX A;  4UHO A;  9AAT A;  1TOE A;  1M32 A;  3MAU A;  5FT6 A;  1MLZ A;  3UWC A;  4WB0 B;  1ORD A;  3N4X A;  2FNU A;  4EB7 A;  3TFU A;  4WBT A;  2VYC A;  1EJI A;  3FSL A;  4F4E A;  1M0N A;  1ECX A;  4GE9 A;  4N0W A;  4WYF A;  3N75 A;  1CQ7 A;  2CJG A;  3E2Y A;  3EI5 A;  2W8W A;  2G6W A;  2VIA A;  4IW7 A;  1GC4 A;  2VMW A;  1MDZ A;  2NMP A;  2CB1 A;  5D95 A;  1WKG A;  1BS0 A;  2Z20 A;  1S09 A;  3ACZ A;  3AOV A;  2W7E A;  3PDX A;  4ITX A;  1ELQ A;  1QGN A;  1ZOD A;  1V72 A;  2CAN A;  4ZAS A;  1WYT A;  4Y0D A;  2BWO A;  2EGY A;  2E7I A;  1AHY A;  2R2N A;  4EMY A;  3NUB A;  1O4S A;  4IX8 A;  4RJY A;  1JS3 A;  4A6R A;  3N4S A;  3PAA A;  4PFN A;  3VK4 A;  1LW5 A;  2EO5 A;  3VK3 A;  2HUF A;  4ZLV A;  4EB5 A;  2C7T A;  3E77 A;  4EU1 A;  1AHE A;  2HOX A;  2VMR A;  3WCN A;  3WGC A;  3DOD A;  3AEM C;  3JWB A;  3H14 A;  4IY7 A;  4M2J A;  3AEJ A;  4F5H A;  2YRI A;  3GSB A;  3HL2 A;  3DU4 A;  4UQV A;  3BC8 A;  1ELU A;  2R5E A;  2CST A;  2WB6 A;  2FKI A;  1O69 A;  2YCN A;  1QIT A;  2VMS A;  2VGS A;  1SZS A;  3FZ7 A;  3FVS A;  4ZM3 A;  1I43 A;  1KKP A;  4F5F A;  4N0B A;  1BJO B;  1ARI A;  1ZOB A;  5EFS A;  2XH1 A;  4ZSW A;  1AJS B;  1AY5 A;  3B1C A;  1B5O A;  2CJH A;  3K28 A;  1AHG A;  3GZD A;  1O61 A;  3AAT A;  3GJU A;  3AOW A;  1LW4 A;  3QHX A;  2EPJ A;  2FM1 A;  4OCA A;  2QA3 A;  4OMA A;  4R2N A;  3T32 A;  2AY7 A;  2CH2 A;  1AAM A;  3L8A A;  4AOA A;  3A9Y A;  4B98 A;  4DBC A;  3AEM A;  2W7L A;  5E5I A;  2X8U A;  3UAK A;  5EUD A;  5G4J A;  1B8G A;  4MQQ A;  2V0Y A;  1AIA A;  3FVU A;  5FT5 A;  4A72 A;  1AY4 A;  4AO9 A;  3BWO A;  5DJ9 A;  3FKD A;  2DGM A;  4ADD A;  3NU8 A;  1I29 A;  1RV3 A;  3BS8 A;  3NYT A;  4HF8 A;  4Q76 A;  3KGW A;  2O7C A;  1LS3 A;  3NDN A;  4XAU A;  3W1I A;  1G7W A;  1MLY A;  4ITG A;  2GQN A;  7AAT A;  2W7F A;  3QGU A;  1PMO A;  3A9X A;  3G7Q A;  3LV2 A;  1DKA A;  3GR9 A;  4JE5 D;  2D7Y A;  4WYE A;  1GC3 A;  4GE7 A;  1FG7 A;  3NYU A;  2VIB A;  1CL2 A;  2ZUK A;  3OP7 A;  2W7I A;  3RQ1 A;  2JGT A;  3PD6 B;  1ARS A;  3E2F A;  3KE3 A;  1YIY A;  4IXZ A;  3QM2 A;  5AX8 A;  2JJE A;  2OAT A;  4M2K A;  2HOR A;  3LG0 A;  1BW0 A;  2AY9 A;  3NU7 A;  2W7H A;  1YJY A;  4A6U A;  1GEW A;  3EI7 A;  3FQA A;  3VK2 A;  2D7Z A;  5KTB A;  4OYT A;  5M4D A;  2HP1 A;  3D6K A;  5G0A A;  4JF0 A;  2BI9 A;  5F9S A;  1TAS A;  2ZJG A;  4WD2 A;  4MQP A;  1QJ3 A;  3ATH A;  2VGT A;  1B9H A;  4Q6R A;  3F9T A;  5LH9 A;  1I41 A;  3L44 A;  2QB2 A;  4MY5 A;  2VLH A;  1S06 A;  1JG8 A;  1UU1 A;  1WYU A;  1WYT B;  3VOM A;  2CIN A;  2VMU A;  4K05 A;  1FC4 A;  3AV7 A;  4LNJ A;  5F8V A;  4XJO A;  1QIR A;  4ISY A;  4E3R A;  3FZ6 A;  1IX8 A;  3FFH A;  4PIW A;  4WXF A;  1EG5 A;  2BYJ A;  1D7U A;  2W7G A;  5EIG B;  2O0R A;  4WYC A;  1ARH A;  5EAV A;  2VMO A;  3IHJ A;  1TAT A;  1CL1 A;  1TOG A;  4LW4 A;  1LC7 A;  2GMU A;  1LKC A;  4UOY A;  3NX3 A;  3BB8 A;  4RKC A;  3M5U A;  4WLH A;  5EIG A;  1SVV A;  5G09 A;  1SZK A;  4O6Z A;  3TFT A;  1KL2 A;  2FNI A;  3EZS A;  4DQ6 A;  4WXG A;  2Z1Y A;  3FFR A;  1IVR A;  2BHX A;  2OKJ A;  3FVX A;  2PB2 A;  4KAM A;  1BJO A;  4OBV A;  3TAT A;  4CBR A;  1ASD A;  4GSA A;  1D7V A;  1Z7D A;  3HLM A;  3MC6 A;  1AAW A;  1WKH A;  3JWA A;  4AH3 A;  1VP4 A;  4FFC A;  4OT8 A;  1M0Q A;  3GET A;  5HXX A;  3PDB A;  2GMS A;  1X29 A;  2ZY3 A;  2X5F A;  1WST A;  3K40 A;  1D2F A;  3WCO A;  1V2D A;  2EZ1 A;  2ORD A;  4WLJ A;  2Z1Z A;  2Z9V A;  4M2M A;  1AKA A;  2Z61 A;  1YAA A;  2OGE A;  2WK9 A;  4JEZ A;  4RLG A;  3Q8N A;  1W7N A;  4KYO A;  2BWP A;  1C7G A;  1KMJ A;  1M0O A;  4EFF A;  4BMK A;  1LC8 A;  1N8P A;  1QJ5 A;  4U2H A;  1X2A A;  2YKY A;  3N4R A;  3AEN B;  2YRR A;  3FDD A;  1P3W A;  3DC1 A;  4RJ0 A;  2VMP A;  1ASA A;  3COG A;  2OQX A;  1IAY A;  4ZDO A;  4PFF A;  2WK8 A;  2WK7 A;  1YOO A;  4BA5 A;  4F5J A;  1AIC A;  2VGZ A;  5FT8 A;  1M0P A;  2D65 A;  3FZ8 A;  3KGX A;  4IXS A;  3DYD A;  3LVL B;  4WYA A;  4OTL A;  1E5E A;  1YNU A;  2GB3 A;  3N0L A;  4HVK A;  1V2E A;  2JIS A;  1J04 A;  3A2B A;  4LNL A;  1SF2 A;  4MKJ A;  1AMQ A;  3QN6 A;  1TPL A;  3JTX A;  3LVK A;  1EQB A;  1C4K A;  1VJO A;  3PGY A;  3HDO A;  1D7R A;  3EUC A;  5E4Z A;  3FRK A;  4Y0I A;  3RBF A;  3P6K A;  3TQX A;  1H1C A;  1LC5 A;  4RIZ A;  3R9A A;  3CQ4 A;  4F5L A;  5D5S A;  5EUE A;  4P3M A;  1ASC A;  1CZE A;  3NYS A;  2W7M A;  3B46 A;  4GDY A;  4A0H A;  1GEX A;  3DXV A;  4RKD A;  3EI8 A;  4RIT A;  4ADE A;  1BQA A;  4J8L A;  1UKJ A;  2YHK A;  2AY1 A;  1V2F A;  4R8D A;  3RUY A;  1IJI A;  4CVQ A;  4W5K A;  2VMQ A;  3BCB A;  1G4X A;  3LVM A;  3MBB A;  4KXK A;  1Z3Z A;  2D63 A;  2YKV A;  1C0N A;  1DJU A;  1BT4 A;  4L0O A;  4LW2 A;  1KMK A;  2YCP A;  1KL1 A;  1B5P A;  4IYO B;  3PA9 A;  1IBJ A;  4JF1 A;  1N2T A;  4H63 Q;  2BI1 A;  1H0C A;  3BCA A;  1SPA A;  1X28 A;  3EI6 A;  1TOK A;  4ZAH A;  3B1E A;  3I5T A;  2D64 A;  1AHF A;  4XJL A;  2O1B A;  2VMZ A;  3P1T A;  4JE5 A;  1B9I A;  1T3I A;  3FQ7 A;  1G7X A;  1GBN A;  4P7Y A;  5I92 A;  4GEB A;  2VGU A;  2RFV A;  4RAE A;  3VP6 A;  1B4X A;  2PB0 A;  3B1D A;  3QI6 A;  2Z9X A;  4XJP A;  1S0A A;  2AEU A;  1AY8 A;  1X0M A;  3CBF A;  2QSR A;  3GBX A;  4Q75 A;  5G4I A;  1W23 A;  5IWQ A;  2BI5 A;  2BIE A;  3E2Z B;  3E9K A;  2ZY4 A;  3EZ1 A;  3FCR A;  1ASE A;  2JJF A;  3AEN A;  4NOG A;  3JW9 A;  3WY7 A;  3DR4 A;  1W3U A;  1XI9 A;  4W8I A;  3BCX A;  3MKJ A;  3ZZJ A;  4F5I A;  3QBO A;  4K2I A;  4W1V A;  2FYF A;  1Y4I A;  4TN4 A;  2CY8 A;  1E5F A;  3CAI A;  2R0T A;  1LK9 A;  1PFF A;  1MAQ A;  2D5Y A;  1TAR A;  3ELE A;  2ZP7 A;  3QPG A;  3RCH B;  3WZF A;  4F5G A;  2CJD A;  3USF A;  4F5K A;  3MAF B;  1QIS A;  2AY8 A;  2OKK A;  4K2M A;  2QMA A;  2CFB A;  2D61 A;  2HUU A;  4BA4 A;  8AAT A;  3NRA A;  1ASN A;  1BJ4 A;  3FD0 A;  5EUN A;  4WYG A;  1AKB A;  5EAA A;  1GC0 A;  3H7F A;  4FL0 A;  2BWN A;  3JU7 A;  2AAT A;  2FQ6 A;  1GD9 A;  3UE8 A;  5DJ1 A;  4ADB A;  1C7O A;  4K2B A;  1KKJ A;  3HBX A;  3GZD C;  4A00 A;  5K8B A;  4W1X A;  4JEV A;  4ATQ A;  2BYL A;  1D7S A;  2DGK A;  1SZU A;  2R5C A;  3GZC A;  1DGE A;  2YKU A;  3MEB A;  3RBL A;  1AKC A;  2VMT A;  3IF2 A;  2C81 A;  2OGA A;  1MDO A;  3BWN C;  3JZL A;  2QB3 A;  2BI2 A;  2VGW A;  1U08 A;  1ARG A;  2DKB A;  3ECD A;  3LWS A;  2W8U A;  2D66 A;  4WYD A;  3ASA A;  1BQD A;  1O62 A;  4ADC A;  5C6U A;  4BHD A;  3DZZ A;  1GCK A;  4CXR A;  3I4J A;  3G8M A;  4AZJ A;  2W7K A;  4W91 A;  3RI6 A;  2DKJ A;  2PO3 A;  2VI9 A;  3H9X A;  3HMU A;  4RM1 A;  5E3K A;  2XBN A;  3GWP A;  3LVJ A;  2QLR A;  3ZRP A;  4E1O A;  4F5M A;  3I16 A;  3MC6 C;  3CQ5 A;  2AEV A;  1QZ9 A;  4A6T A;  5M4B A;  1AMA A;  1CZC A;  2VLF A;  2W8J A;  3F0H A;  5TF5 A;  2X3L A;  1DFO A;  3FDB A;  1DTY A;  3PDB B;  3EIB A;  5EQC A;  4ZM4 A;  5G2Q A;  2HOY A;  1MAP A;  1OXO A;  1BJN A;  3EI9 A;  3PD6 A;  3W1J A;  1WYV B;  1IX6 A;  5HDM A;  3MAD A;  1TOI A;  2Q7W A;  2VMV A;  4TMR A;  1AMS A;  3HQT A;  4TV7 A;  2DOU A;  2TPL A;  4W1W A;  5DX5 A;  4A0G A;  2G7J A;  2DGL A;  4JEX A;  2A1V A;  4IXO A;  3G0T A;  2AY2 A;  4CBS A;  4GRX A;  2VMN A;  3F6T A;  2W7J A;  2GSA A;  4E77 A;  2HOZ A;  1YIZ A;  4R5Z A;  2JJH A;  4JEW A;  2JG2 A;  1ASF A;  4B9B A;  2AY6 A;  3ZRR A;  5J8Q A;  3WGB A;  3ZRQ A;  1M4N A;  1RVY A;  3AEJ C;  1OHW A;  4WB0 A;  4AZK A;  2V1P A;  2W7D A;  4UHN A;  4DGT A;  2ZY2 A;  3WX9 A;  2BIG A;  1OXP A;  1GDE A;  4GE4 A;  2YOB A;  3PJ0 A;  4XEW A;  5HHY A;  2E54 A;  4XQ2 A;  2ZSL A;  3VAX A;  2AY3 A;  1ASL A;  3WLX A;  2C44 A;  3A8U X;  2R5C B;  2C0R A;  3NNK A;  1UU0 A;  2EZ2 A;  2ZSM A;  1IUG A;  2Z9U A;  2ZYJ A;  3FTB A;  1IX7 A;  2YCT A;  4IYO A;  4MKK A;  4A0R A;  1WYV A;  2W8V A;  3KKI A;  1W7L A;  3PPL A;  4OC9 A;  3LY1 A;  2BIA A;  1AHX A;  5BJ4 A;  1GEY A;  1MDX A;  5BJ3 A;  1ZC9 A;  1ASM A;  2CH1 A;  1AJS A;  3ISL A;  4MGR A;  4R5F A;  5FT4 A;  2F8J A;  3RCH A;  1S07 A;  1AX4 A;  1UU2 A;  4ZWV A;  2WKA A;  3W1H A;  4WXB A;  3AEP A;  4PVF A;  1YJZ A;  2AY4 A;  1J32 A;  2Z9W A;  3ZZK A;  2EH6 A;  3MAF A;  3EIA A;  1OAT A;  1M7Y A;  3N7N A;  2QBT A;  2ZY5 A;  2E7U A;  1M6S A;  2BKW A;  4LC3 A;  1IAX A;  2VMX A;  4Q31 A;  1TOJ A;  3II0 A;  4MSO A;  5DB5 A;  2CTZ A;  4XJM A;  1AJR A;  1ASG A;  2AY5 A;  3HVY A;  1OHY A;  3NTJ A;  4ATP A;  5LHA A;  1WYU B;  1CJ0 A;  2DR1 A;  1RVU A;  2VGV A;  3DRD A;  3BWN A;  2W8T A;  1GC2 A;  1S08 A;  1CS1 A;  1N31 A;  5M46 A;  1XEY A;  1JS6 A;  4ZDP A;  3AEL A;  3ELP A;  4LNM A;  4MQR A;  4QGR A;  4CXQ A;  2KFP A;  4Y0H A;  3BN1 A;  3E2Z A;  4A0F A;  4XK1 A;  3CQ6 A;  3N5M A;  3BV0 A;  1JF9 A;  4ZWM A;  4WP0 A;  2FN6 A;  1DGD A;  5M49 A;  2HP2 A;  2BI3 A;  2VI8 A;  2Z67 A;  3WKS A;  2JJG A;  4AO4 A;  1BJW A;  3WKR A;  5JAY A;  4E3Q A;  3DXW A;  1FG3 A;  4H51 A;  1ASB A;  1PMM A;  3DR7 A;  4JEY A;  3E6G A;  4ZDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...