5HXXA

Crystal structure of aspat from corynebacterium glutamicum
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
424
structure length
424
Chain Sequence
VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural insights into a novel class of aspartate aminotransferase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Transferase
total genus 153
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5hxxA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5hxxA01
3FFHA 3K28A 2CJDA 4OTLA 4OBUA 1T3IA 2VLFA 3AOVA 3PDBB 4PVFA 4BQ0A 1I48A 2VMSA 3VK3A 1WSTA 1UU2A 1KKJA 2HUIA 3JU7A 5FT6A 3UE8A 1PG8A 1ASFA 4F5KA 4EB7A 3AV7A 1M0OA 4ZASA 4WLJA 1U08A 2OGAA 3RCHA 5G4IA 3PD6B 5M49A 4WYAA 5DJ1A 3LWSA 1BKGA 3HL2A 3OP7A 1LKCA 1QGNA 3EZ1A 4A0GA 4JEYA 4R2NA 3E2ZA 4XAUA 1YOOA 2OGEA 1DJEA 1AHYA 2WK7A 3FQ8A 4GE4A 1KL1A 3FZ7A 3FVXA 1QITA 4WYFA 1J32A 1IUGA 3WZFA 1ASCA 1LW5A 1SZSA 2HZPA 5FT4A 3A2BA 4W8IA 1AAMA 4ZDLA 3FCRA 4RKDA 5EIGB 3FTBA 3W1IA 5EQCA 1TOJA 4Y0DA 1ASBA 1XI9A 2VMYA 2VIAA 4WP0A 2GB3A 4A00A 1D7RA 4LW4A 4OC9A 1VJOA 3DXWA 3GSBA 1OHWA 5HHYA 3RBFA 2C44A 2VMQA 1ASEA 3WKRA 4W1XA 2FNIA 1AHGA 3EZSA 5C6UA 4OT8A 2BWOA 1QZ9A 2VGWA 3K7YA 3BC8A 4R5ZA 3QGUA 4E3RA 4ADEA 3AATA 5JAYA 1ARGA 3BCAA 2AY2A 2CH1A 1BJOB 1ZOBA 4JEXA 1QJ5A 3W1HA 4GDYA 2YRRA 5E4ZA 3ZRQA 1B5OA 4JEVA 4ZSWA 5D95A 2E7JA 3F6TA 1D7VA 1WYUB 4BA4A 1M0NA 3II0A 3I16A 3ELEA 2DGLA 3E77A 2Z67A 1UU1A 3HQTA 1S07A 3AOWA 1SZUA 1AY5A 3VP6A 1JG8A 1VEFA 1XEYA 5LH9A 2O7CA 3EI9A 3R4TA 3HDOA 3L8AA 3AELA 4AZKA 4MY5A 4BMKA 1LK9A 3MAFB 2W7LA 8AATA 3NRAA 4MKJA 1B9IA 3ASBA 2FNUA 3QBOA 4XJOA 3R9AA 2HUUA 2PB2A 1UU0A 5EFSA 3A8UX 3FD0A 4ZSYA 1C7GA 4CXRA 3B8XA 4UHNA 1SVVA 1KMJA 2JG2A 4ITXA 2XBNA 3HMUA 5G2QA 1I29A 3FKDA 1OHVA 2CB1A 4WYDA 3KGXA 2EGYA 4ADDA 1ARSA 1B4XA 3TFTA 2AEVA 2ZC0A 4A6RA 1ECXA 3EI6A 1S08A 3GZCA 4RLGA 4PIWA 1YIYA 4F5IA 4XJPA 3GR9A 2W8TA 1G4XA 4R8DA 1CZEA 5BJ4A 1ELQA 4LNLA 2E7UA 4WXBA 3I5TA 4A0RA 3EI7A 2BIGA 2OQXA 1TARA 1YJZA 3BN1A 2ZUKA 2QB3A 3AEMA 2BWPA 4U2HA 1KKPA 1ASMA 2QA3A 4OYTA 2BKWA 4IY7A 1IAYA 4FL0A 4OBVA 2QBTA 1E5FA 3BV0A 1WYTB 3F0HA 2BYLA 2BI5A 2OKJA 1KL2A 1MDXA 4IYOA 4MKKA 5EUNA 4ZLVA 1CQ8A 4A72A 3NX3A 5G2PA 3NYSA 1M32A 3MC6C 4W1WA 1EG5A 3KKIA 1PMMA 2YRIA 4KAMA 2W7FA 4QGRA 4PFFA 1CS1A 1AKAA 4JE5A 2CY8A 1AKBA 2BIEA 5M4BA 1MLYA 2VLHA 5BJ3A 1V2DA 3GZDC 1X28A 4E77A 1AHEA 4IX8A 3TQXA 1C4KA 4HVKA 1M4NA 2BI1A 2PB0A 2CJGA 3ZRRA 2QMAA 2X8UA 1GC4A 4RM1A 2R0TA 1BJNA 3BWNC 2D5YA 1S06A 5E5IA 4DQ6A 2D7YA 3LG0A 3LV2A 2VMNA 4TN4A 1BJWA 4DGTA 4RAEA 4WB0A 2VMTA 2ZY4A 3DZZA 5FT8A 1TATA 3MBBA 2FQ6A 2C7TA 1BT4A 3AENB 3PDBA 4IXSA 4TV7A 4XK1A 1DJUA 2DGKA 2R5EA 3USFA 1OATA 1C7OA 3PPLA 3VOMA 4DBCA 4KXKA 5G4JA 1FG7A 4AO9A 4ZAHA 4JF0A 3N5MA 2ZJGA 3QPGA 4F5LA 1MLZA 3FZ6A 4GEBA 5G09A 4EMYA 4B9BA 1AIAA 2Q7WA 3ZZJA 2O0RA 3BB8A 4E3QA 3DXVA 1IVRA 3FDBA 2CJHA 2VGTA 1CL2A 1RVYA 2YOBA 2VMPA 2CANA 1Z7DA 3AEPA 2YHKA 3PIUA 3MEBA 4ADCA 1IX8A 2BI9A 2BIAA 5EAVA 1UKJA 2YCTA 2ZYJA 2WKAA 4WYCA 4A0HA 1N8PA 2ZY2A 1DKAA 3Q8NA 2X3LA 4AO4A 2YKXA 1QISA 4EFFA 3NDNA 1GD9A 2Z20A 1SZKA 4J5UA 3EUCA 3PA9A 3E2FA 2AY5A 2TPLA 5DB5A 4MQRA 2Z61A 3DC1A 3L44A 2W8WA 2Z1YA 1AIBA 2VMUA 4RJYA 3B1DA 3F9TA 3NTJA 3DR4A 3FZ8A 4WXFA 4UHOA 3I4JA 2R5CB 3EIAA 4ZDOA 1AMSA 1BQAA 3E6GA 1IJIA 1S09A 3FVSA 3AEJC 2NMPA 2Z9UA 2X5FA 1WKHA 3ISLA 5G0AA 1O4SA 4WD2A 1BJOA 2W8UA 4M2MA 3NUIA 3A9XA 2GMSA 3A9ZA 3NNKA 3JWBA 4XJLA 1C7NA 1AMRA 2FM1A 1Z3ZA 1AJSB 4IXOA 2W7KA 2JJHA 3NU7A 1TOEA 1AICA 4AOAA 4BHDA 2D63A 4PFNA 1ASNA 1WYVB 4IW7A 3ATHA 1ORDA 2VMZA 2W7DA 5HXXA 3LVKA 1ELUA 1JF9A 2EO5A 1N2TA 3PGYA 2ORDA 3ACZA 4UQVA 4F5JA 1LC8A 1CQ6A 3COGA 3M5UA 2W8JA 4ITGA 2AY1A 1OHYA 3NYTA 3FRKA 5F8VA 2HOZA 1LW4A 1VP4A 3N75A 4RIZA 1GC0A 3MAFA 3GJUA 1EJIA 4B98A 2Z9VA 4F4EA 3BS8A 1M7YA 1AMQA 3IHJA 3CQ4A 1W3UA 2W7IA 4CBSA 1BW0A 1RVUA 4WYGA 2D66A 2FYFA 1E5EA 4P7YA 3FSLA 4CVQA 3ZRPA 4Q76A 1DFOA 4ZM4A 3FQAA 2ZY5A 4OCAA 1I43A 3PJ0A 1M0PA 1O61A 1KMKA 2DKBA 2VMRA 1YIZA 4F5FA 4OMAA 1TOIA 2D64A 3CBFA 4P3MA 4LNJA 4LC3A 3B1EA 1TOGA 1GEXA 4WBTA 4WLHA 4ZWMA 1J04A 2VMWA 1H1CA 2BYJA 3ASAA 2RFVA 3WGCA 1CQ7A 2W7JA 2HOYA 4W91A 1ASDA 2X5DA 1X0MA 3FQ7A 1DTYA 3GWPA 3G0TA 1ASLA 1H0CA 3ECDA 5J8QA 1X29A 2AY8A 2W7GA 1BS0A 4UOYA 4GSAA 3CQ5A 3H7FA 2HOXA 3RBLA 3P1TA 2EZ1A 1S0AA 2DOUA 3RCHB 3OKSA 1AHFA 2AY7A 1G4VA 3E9KA 2BWNA 5M4DA 1DJ9A 1BQDA 2AY9A 2PO3A 2ZP7A 5K8BA 3LVJA 3E2ZB 3RQ1A 1IX6A 3JTXA 4XEWA 2GQNA 3FDDA 2VI8A 2E7IA 2XH1A 1AKCA 3DR7A 4HF8A 2WK9A 4JF1A 2CSTA 3UWCA 4F5HA 1I41A 1MDZA 4K2IA 2D65A 3PDXA 1QIRA 3JW9A 5EUDA 3DODA 4JEWA 3WCOA 5F9SA 1ASGA 3EIBA 5M46A 2VIBA 3MAUA 1DGEA 1W7MA 1ZC9A 3QM2A 4XJMA 2ZY3A 2FN6A 2W8VA 2W7EA 3A9YA 1C9CA 2F8JA 2CTZA 4ATPA 3E2YA 3PD6A 3ELPA 1YJYA 2HP2A 4GE7A 4AH3A 3VAXA 4UHMA 2VGZA 1LC7A 2VMVA 4EU1A 5IWQA 2HORA 2BI2A 4CXQA 1MAQA 3AENA 3MC6A 4I8AA 4RITA 3HBXA 1TPLA 3WX9A 1W7LA 1AY8A 1AJRA 2JGTA 5EUEA 4BA5A 1IAXA 1AY4A 4MQQA 4E1OA 1PFFA 3NYUA 1SF2A 4K2BA 3BWOA 1D2FA 3HT4A 4L0OA 2CFBA 2AEUA 2JISA 4LNMA 3GZDA 3KGWA 1SFFA 2HP1A 2V1PA 3FVUA 2DKJA 2W7MA 1ARHA 1TASA 2VGSA 2Z9XA 3B46A 2ZSLA 2OKKA 5DJ9A 5EIGA 2EH6A 1CJ0A 3TATA 3WGBA 1X2AA 1CZCA 3NU8A 2W7HA 1B5PA 3G7QA 3BWNA 4W5KA 4ZDPA 1GC2A 4GRXA 1GEYA 5FT5A 3DU4A 1GEWA 1RV4A 3K40A 3LY1A 2D61A 4NOGA 1WKGA 3VK4A 1MAPA 1G7WA 2C81A 4TMRA 2CINA 2QLRA 4MSOA 3LVLB 1BJ4A 3RI6A 3NUBA 1M6SA 4M2KA 1TOKA 2G6WA 3DYDA 3KE3A 3P6KA 1ASAA 1LS3A 4Q75A 4U1TA 4A6UA 3AEOA 3WLXA 4ZWVA 1AAWA 2EPJA 1MDOA 1N31A 2ZSMA 1LC5A 3H14A 4WXGA 5EAAA 2VYCA 2D7ZA 2YKUA 1AX4A 3AEMC 1IX7A 1WYUA 1Y4IA 3RUYA 4Q6RA 1CL1A 3FFRA 2VMOA 3BCXA 2OATA 3QI6A 1SPAA 2R5CA 4A6TA 1AHXA 1OXPA 5D5SA 5DX5A 2BHXA 4N0BA 2AY4A 3TCMA 1ZODA 4MGRA 1YAAA 2YCNA 2Z9WA 2HUFA 4Y0HA 3BCBA 1V2EA 1PMOA 2AATA 2GMUA 5TF5A 4ATQA 1FG3A 1GDEA 1D7SA 2DGMA 3G8MA 3WCNA 3GBXA 3DRDA 1OXOA 4ZM3A 2JJFA 2VI9A 2WK8A 4K2MA 1JS3A 1V72A 1AJSA 2DR1A 4Y0IA 4J8LA 1FC4A 1MGVA 2EZ2A 3MADA 3QHXA 3WY7A 9AATA 2CH2A 4GE9A 1WYVA 5I92A 2AY3A 3CAIA 3B1CA 5E3KA 1B8GA 2YKVA 1GCKA 3PAAA 4FFCA 4F5MA 1AMAA 2QB2A 3HLMA 5AX8A 1W23A 1YJSA 1GC3A 1YNUA 3EI8A 2Z1ZA 3MKJA 1O62A 3JWAA 4W1VA 1V2FA 3LVMA 4R5FA 3T32A 1EQBA 4IYOB 3UAKA 1M0QA 4RKCA 3AEJA 2VGVA 2BI3A 3IF2A 4LW2A 3JZLA 3HVYA 3TFUA 2YCPA 1G7XA 1GBNA 1JS6A 3EI5A 4JEZA 3WKSA 2JJEA 1O69A 3QN6A 4A0FA 2YKYA 1ARTA 2C0RA 4AZJA 4ADBA 4H51A 1ARIA 1P3WA 4F5GA 4IXZA 4EB5A 2AY6A 2O1BA 2VMXA 4ISYA 4CBRA 4WYEA 4JE5D 1IBJA 2E54A 2JJGA 3ZZKA 2R2NA 7AATA 5LHAA 2VGUA 4N0WA 3CQ6A 1C0NA 4Q31A 4O6ZA 1D7UA 4RJ0A 1W7NA 3W1JA 1WYTA 2GSAA 3GETA 3N0LA 4M2JA 5HDMA 1RV3A 3VK2A 1QJ3A 3D6KA 2V0YA 4MQPA 4WB0B 1DGDA 4XQ2A 1B9HA 4KYOA
chains in the Genus database with same CATH superfamily
3FFHA 3K28A 2CJDA 4OTLA 4OBUA 1T3IA 2VLFA 3AOVA 3PDBB 4PVFA 4BQ0A 1I48A 2WB6A 2VMSA 2A1VA 3VK3A 1WSTA 1UU2A 1KKJA 2HUIA 3JU7A 5FT6A 3UE8A 1KAFA 1PG8A 1ASFA 4F5KA 4EB7A 3AV7A 1M0OA 4ZASA 4WLJA 1U08A 2OGAA 3RCHA 5G4IA 3PD6B 5M49A 4WYAA 5DJ1A 3LWSA 1BKGA 3HL2A 3OP7A 1LKCA 1QGNA 3EZ1A 4A0GA 4JEYA 4R2NA 3E2ZA 4XAUA 1YOOA 2OGEA 1DJEA 1AHYA 2WK7A 3FQ8A 4GE4A 1KL1A 3FZ7A 3FVXA 1QITA 4WYFA 1J32A 1IUGA 3WZFA 1ASCA 1LW5A 1SZSA 2HZPA 5FT4A 3A2BA 4W8IA 1AAMA 4ZDLA 3FCRA 4RKDA 5EIGB 3FTBA 3W1IA 5EQCA 1TOJA 4Y0DA 1ASBA 1XI9A 2VMYA 2VIAA 4WP0A 2GB3A 4A00A 1D7RA 2QSRA 4LW4A 4OC9A 1VJOA 3DXWA 3GSBA 1OHWA 5HHYA 3RBFA 2C44A 2VMQA 1ASEA 3WKRA 4W1XA 2FNIA 1AHGA 3EZSA 5C6UA 4OT8A 2BWOA 1QZ9A 2VGWA 3K7YA 3BC8A 4R5ZA 3QGUA 4E3RA 4ADEA 3AATA 5JAYA 1ARGA 3BCAA 2AY2A 2CH1A 1BJOB 1ZOBA 4JEXA 1QJ5A 3W1HA 4GDYA 2YRRA 5E4ZA 3ZRQA 1B5OA 4JEVA 4ZSWA 5D95A 2E7JA 3F6TA 1D7VA 1WYUB 4BA4A 1M0NA 3II0A 3I16A 3ELEA 2DGLA 3E77A 2Z67A 1UU1A 3HQTA 1S07A 3AOWA 1SZUA 1AY5A 3VP6A 1JG8A 1VEFA 1XEYA 5LH9A 2O7CA 3EI9A 3R4TA 3HDOA 3L8AA 3AELA 4AZKA 4MY5A 4BMKA 1LK9A 3MAFB 2W7LA 8AATA 3NRAA 4MKJA 1B9IA 3ASBA 2FNUA 3QBOA 4XJOA 3R9AA 2HUUA 2PB2A 1UU0A 5EFSA 3A8UX 3FD0A 4ZSYA 1C7GA 4CXRA 2G7JA 3B8XA 4UHNA 1SVVA 1KMJA 2JG2A 4ITXA 2XBNA 3HMUA 5G2QA 1I29A 3FKDA 1OHVA 2CB1A 4WYDA 3KGXA 2EGYA 4ADDA 1ARSA 1B4XA 3TFTA 2AEVA 2ZC0A 4A6RA 1ECXA 3EI6A 1S08A 3GZCA 4RLGA 4PIWA 1YIYA 4F5IA 4XJPA 3GR9A 2W8TA 1G4XA 2FKIA 2EYQA 4R8DA 1CZEA 5BJ4A 1ELQA 4LNLA 2E7UA 4WXBA 3I5TA 4A0RA 3EI7A 2BIGA 2OQXA 1TARA 1YJZA 3BN1A 2ZUKA 2QB3A 3AEMA 2BWPA 4U2HA 1KKPA 1ASMA 2QA3A 4OYTA 2BKWA 4IY7A 1IAYA 4FL0A 4OBVA 2QBTA 1E5FA 3BV0A 1WYTB 3F0HA 2BYLA 2BI5A 2OKJA 4K05A 1KL2A 1MDXA 4IYOA 4MKKA 5EUNA 4ZLVA 1CQ8A 4A72A 3N4SA 3NX3A 5G2PA 3NYSA 1M32A 3MC6C 4W1WA 1EG5A 3KKIA 1PMMA 2YRIA 4KAMA 2W7FA 4QGRA 4PFFA 1CS1A 1AKAA 4JE5A 2CY8A 1AKBA 2BIEA 5M4BA 1MLYA 2VLHA 5BJ3A 1V2DA 3GZDC 1X28A 4E77A 1AHEA 4IX8A 3TQXA 1C4KA 4HVKA 1M4NA 2BI1A 2PB0A 2CJGA 3ZRRA 2QMAA 2X8UA 1GC4A 4RM1A 2R0TA 1BJNA 3BWNC 2D5YA 1S06A 5E5IA 3H9XA 4DQ6A 2D7YA 3LG0A 3LV2A 2VMNA 4TN4A 1BJWA 4DGTA 4RAEA 4WB0A 2VMTA 2ZY4A 3DZZA 5FT8A 1TATA 3MBBA 2FQ6A 2C7TA 5KTBA 1BT4A 3AENB 3PDBA 4IXSA 4TV7A 4XK1A 1DJUA 2DGKA 2R5EA 3USFA 1OATA 1C7OA 3PPLA 3VOMA 4DBCA 4KXKA 5G4JA 1FG7A 4AO9A 4ZAHA 4JF0A 3N4RA 3N5MA 2ZJGA 3QPGA 4F5LA 1MLZA 3FZ6A 4GEBA 5G09A 4EMYA 4B9BA 1AIAA 2Q7WA 3ZZJA 2O0RA 3BB8A 4E3QA 3DXVA 1IVRA 3FDBA 2CJHA 2VGTA 1CL2A 1RVYA 2YOBA 2VMPA 2CANA 1Z7DA 3AEPA 2YHKA 3PIUA 3MEBA 4ADCA 1IX8A 2BI9A 2BIAA 5EAVA 1UKJA 2YCTA 2ZYJA 2WKAA 4WYCA 4A0HA 1N8PA 2ZY2A 1DKAA 3Q8NA 2X3LA 4AO4A 2YKXA 1QISA 4EFFA 3NDNA 1GD9A 2Z20A 1SZKA 4J5UA 3EUCA 3PA9A 3E2FA 2AY5A 2TPLA 5DB5A 4MQRA 2Z61A 3DC1A 3L44A 2W8WA 2Z1YA 1AIBA 2VMUA 4RJYA 3B1DA 3F9TA 3NTJA 3DR4A 3FZ8A 4WXFA 4UHOA 3I4JA 2R5CB 3EIAA 4ZDOA 1AMSA 1BQAA 3E6GA 4H63Q 1IJIA 1S09A 3FVSA 3AEJC 2NMPA 2Z9UA 2X5FA 1WKHA 3ISLA 5G0AA 1O4SA 4WD2A 1BJOA 2W8UA 4M2MA 3NUIA 3A9XA 2GMSA 3A9ZA 3NNKA 3JWBA 4XJLA 1C7NA 1AMRA 2FM1A 1Z3ZA 1AJSB 4IXOA 2W7KA 2JJHA 3NU7A 1TOEA 1AICA 4AOAA 4BHDA 2D63A 4PFNA 1ASNA 1WYVB 4IW7A 3ATHA 1ORDA 2VMZA 2W7DA 5HXXA 3LVKA 1ELUA 1JF9A 2EO5A 1N2TA 3PGYA 2ORDA 3ACZA 4UQVA 4F5JA 1LC8A 1CQ6A 3COGA 3M5UA 2W8JA 4ITGA 2AY1A 1OHYA 3NYTA 3FRKA 5F8VA 2HOZA 1LW4A 1VP4A 3N75A 4RIZA 1GC0A 3MAFA 3GJUA 1EJIA 4B98A 2Z9VA 4F4EA 3BS8A 1M7YA 1AMQA 3IHJA 3CQ4A 1W3UA 2W7IA 4CBSA 1BW0A 1RVUA 4WYGA 2D66A 2FYFA 1E5EA 4P7YA 3FSLA 4CVQA 3ZRPA 4Q76A 1DFOA 4ZM4A 3FQAA 2ZY5A 4OCAA 1I43A 3PJ0A 1M0PA 1O61A 1KMKA 2DKBA 2VMRA 1YIZA 4F5FA 4OMAA 1TOIA 2D64A 3CBFA 4P3MA 4LNJA 4LC3A 3B1EA 1TOGA 1GEXA 4WBTA 4WLHA 4ZWMA 1J04A 2VMWA 1H1CA 2BYJA 3ASAA 2RFVA 3WGCA 1CQ7A 2W7JA 2HOYA 4W91A 1ASDA 2X5DA 1X0MA 3FQ7A 1DTYA 3GWPA 3G0TA 1ASLA 1H0CA 3ECDA 5J8QA 1X29A 2AY8A 2W7GA 1BS0A 4UOYA 4GSAA 3CQ5A 3H7FA 2HOXA 3RBLA 3P1TA 2EZ1A 1S0AA 2DOUA 3RCHB 3OKSA 1AHFA 2AY7A 1G4VA 3E9KA 2BWNA 5M4DA 1DJ9A 1BQDA 2AY9A 2PO3A 2ZP7A 5K8BA 3LVJA 3E2ZB 3RQ1A 1IX6A 3JTXA 4XEWA 2GQNA 3FDDA 2VI8A 2E7IA 2XH1A 1AKCA 3DR7A 4HF8A 2WK9A 4JF1A 2CSTA 3UWCA 4F5HA 1I41A 1MDZA 4K2IA 2D65A 3PDXA 1QIRA 3JW9A 5EUDA 3DODA 4JEWA 3WCOA 5F9SA 1ASGA 3EIBA 5M46A 2VIBA 3MAUA 1DGEA 1W7MA 1ZC9A 3QM2A 4XJMA 2ZY3A 2FN6A 2W8VA 2W7EA 3A9YA 1C9CA 2F8JA 2CTZA 4ATPA 3E2YA 3PD6A 3ELPA 1YJYA 2HP2A 4GE7A 4AH3A 3VAXA 4UHMA 2VGZA 1LC7A 2VMVA 4EU1A 5IWQA 2HORA 2BI2A 4CXQA 1MAQA 3AENA 3MC6A 4I8AA 4RITA 3HBXA 1TPLA 3WX9A 1W7LA 1AY8A 1AJRA 2JGTA 5EUEA 4BA5A 1IAXA 1AY4A 4MQQA 4E1OA 1PFFA 3NYUA 1SF2A 4K2BA 3BWOA 1D2FA 3HT4A 4L0OA 2CFBA 2AEUA 2JISA 4LNMA 3GZDA 3KGWA 1SFFA 2HP1A 2V1PA 3FVUA 2DKJA 2W7MA 1ARHA 1TASA 2VGSA 2Z9XA 3B46A 2ZSLA 2OKKA 5DJ9A 5EIGA 2EH6A 1CJ0A 3TATA 3WGBA 1X2AA 1CZCA 3NU8A 2W7HA 1B5PA 3G7QA 2KFPA 3BWNA 4W5KA 4ZDPA 1GC2A 4GRXA 1GEYA 5FT5A 3DU4A 1GEWA 1RV4A 3K40A 3LY1A 2D61A 4NOGA 1WKGA 3VK4A 1MAPA 1G7WA 2C81A 4TMRA 2CINA 2QLRA 4MSOA 3LVLB 1BJ4A 3RI6A 3NUBA 1M6SA 4M2KA 1TOKA 2G6WA 3DYDA 3KE3A 3P6KA 1ASAA 1LS3A 4Q75A 4U1TA 4A6UA 3AEOA 3WLXA 4ZWVA 1AAWA 2EPJA 1MDOA 1N31A 2ZSMA 1LC5A 3H14A 4WXGA 5EAAA 2VYCA 2D7ZA 2YKUA 1AX4A 3AEMC 1IX7A 1WYUA 1Y4IA 3RUYA 4Q6RA 1CL1A 3FFRA 2VMOA 3BCXA 2OATA 3QI6A 1SPAA 2R5CA 4A6TA 1AHXA 1OXPA 5D5SA 5DX5A 2BHXA 4N0BA 2AY4A 3TCMA 1ZODA 4MGRA 1YAAA 2YCNA 2Z9WA 2HUFA 4Y0HA 3BCBA 1V2EA 1PMOA 2AATA 2GMUA 5TF5A 4ATQA 1FG3A 1GDEA 1D7SA 2DGMA 3G8MA 3WCNA 3GBXA 3DRDA 1OXOA 4ZM3A 2JJFA 2VI9A 2WK8A 4K2MA 1JS3A 1V72A 1AJSA 2DR1A 4Y0IA 4J8LA 1FC4A 1MGVA 2EZ2A 3MADA 3QHXA 3WY7A 9AATA 2CH2A 4GE9A 1WYVA 5I92A 2AY3A 3CAIA 3B1CA 5E3KA 1B8GA 2YKVA 1GCKA 3PAAA 4FFCA 4F5MA 1AMAA 2QB2A 3HLMA 5AX8A 1W23A 1YJSA 1GC3A 1YNUA 3EI8A 2Z1ZA 3MKJA 1O62A 3JWAA 4W1VA 1V2FA 3LVMA 4R5FA 3T32A 1EQBA 4IYOB 3UAKA 1M0QA 4RKCA 3AEJA 2VGVA 2BI3A 3IF2A 3N7NA 4LW2A 3JZLA 3HVYA 3TFUA 2YCPA 1G7XA 1GBNA 1JS6A 3EI5A 4JEZA 3WKSA 2JJEA 1O69A 3QN6A 4A0FA 2YKYA 1ARTA 2C0RA 4AZJA 4ADBA 4H51A 1ARIA 1P3WA 4F5GA 4IXZA 4EB5A 2AY6A 2O1BA 2VMXA 4ISYA 4CBRA 4WYEA 4JE5D 1IBJA 2E54A 2JJGA 3ZZKA 2R2NA 3N4XA 7AATA 5LHAA 2VGUA 4N0WA 3CQ6A 1C0NA 4Q31A 4O6ZA 1D7UA 4RJ0A 1W7NA 3W1JA 1WYTA 2GSAA 3GETA 3N0LA 4M2JA 5HDMA 1RV3A 3VK2A 1QJ3A 3D6KA 2V0YA 4MQPA 4WB0B 1DGDA 4XQ2A 1B9HA 4KYOA
chains in the Genus database with same CATH topology
3FFHA 3K28A 2CJDA 4OTLA 4OBUA 1T3IA 2VLFA 3AOVA 3PDBB 4PVFA 4BQ0A 1I48A 2WB6A 2VMSA 2A1VA 3VK3A 1WSTA 1UU2A 1KKJA 2HUIA 3JU7A 5FT6A 3UE8A 1PG8A 1ASFA 4F5KA 4EB7A 3AV7A 1M0OA 4ZASA 4WLJA 1U08A 2OGAA 3RCHA 5G4IA 3PD6B 5M49A 4WYAA 5DJ1A 3LWSA 1BKGA 3HL2A 3OP7A 1LKCA 1QGNA 3EZ1A 4A0GA 4JEYA 4R2NA 3E2ZA 4XAUA 1YOOA 2OGEA 1DJEA 1AHYA 2WK7A 3FQ8A 4GE4A 1KL1A 3FZ7A 3FVXA 1QITA 4WYFA 1J32A 1IUGA 3WZFA 1ASCA 1LW5A 1SZSA 2HZPA 5FT4A 3A2BA 4W8IA 1AAMA 4ZDLA 3FCRA 4RKDA 5EIGB 3FTBA 3W1IA 5EQCA 1TOJA 4Y0DA 1ASBA 1XI9A 2VMYA 2VIAA 4WP0A 2GB3A 4A00A 1D7RA 2QSRA 4LW4A 4OC9A 1VJOA 3DXWA 3GSBA 1OHWA 5HHYA 3RBFA 2C44A 2VMQA 1ASEA 3WKRA 4W1XA 2FNIA 1AHGA 3EZSA 5C6UA 4OT8A 2BWOA 1QZ9A 2VGWA 3K7YA 3BC8A 4R5ZA 3QGUA 4E3RA 4ADEA 3AATA 5JAYA 1ARGA 3BCAA 2AY2A 2CH1A 1BJOB 1ZOBA 4JEXA 1QJ5A 3W1HA 4GDYA 2YRRA 5E4ZA 3ZRQA 1B5OA 4JEVA 4ZSWA 5D95A 2E7JA 3F6TA 1D7VA 1WYUB 4BA4A 1M0NA 3II0A 3I16A 3ELEA 2DGLA 3E77A 2Z67A 1UU1A 3HQTA 1S07A 3AOWA 1SZUA 1AY5A 3VP6A 1JG8A 1VEFA 1XEYA 5LH9A 2O7CA 3EI9A 3R4TA 3HDOA 3L8AA 3AELA 4AZKA 4MY5A 4BMKA 1LK9A 3MAFB 2W7LA 8AATA 3NRAA 4MKJA 1B9IA 3ASBA 2FNUA 3QBOA 4XJOA 3R9AA 2HUUA 2PB2A 1UU0A 5EFSA 3A8UX 3FD0A 4ZSYA 1C7GA 4CXRA 2G7JA 3B8XA 4UHNA 1SVVA 1KMJA 2JG2A 4ITXA 2XBNA 3HMUA 5G2QA 1I29A 3FKDA 1OHVA 2CB1A 4WYDA 3KGXA 2EGYA 4ADDA 1ARSA 1B4XA 3TFTA 2AEVA 2ZC0A 4A6RA 1ECXA 3EI6A 1S08A 3GZCA 4RLGA 4PIWA 1YIYA 4F5IA 4XJPA 3GR9A 2W8TA 1G4XA 2FKIA 2EYQA 4R8DA 1CZEA 5BJ4A 1ELQA 4LNLA 2E7UA 4WXBA 3I5TA 4A0RA 3EI7A 2BIGA 2OQXA 1TARA 1YJZA 3BN1A 2ZUKA 2QB3A 3AEMA 2BWPA 4U2HA 1KKPA 1ASMA 2QA3A 4OYTA 2BKWA 4IY7A 1IAYA 4FL0A 4OBVA 2QBTA 1E5FA 3BV0A 1WYTB 3F0HA 2BYLA 2BI5A 2OKJA 4K05A 1KL2A 1MDXA 4IYOA 4MKKA 5EUNA 4ZLVA 1CQ8A 4A72A 3N4SA 3NX3A 5G2PA 3NYSA 1M32A 3MC6C 4W1WA 1EG5A 3KKIA 1PMMA 2YRIA 4KAMA 2W7FA 4QGRA 4PFFA 1CS1A 1AKAA 4JE5A 2CY8A 1AKBA 2BIEA 5M4BA 1MLYA 2VLHA 5BJ3A 1V2DA 3GZDC 1X28A 4E77A 1AHEA 4IX8A 3TQXA 1C4KA 4HVKA 1M4NA 2BI1A 2PB0A 2CJGA 3ZRRA 2QMAA 2X8UA 1GC4A 4RM1A 2R0TA 1BJNA 3BWNC 2D5YA 1S06A 5E5IA 3H9XA 4DQ6A 2D7YA 3LG0A 3LV2A 2VMNA 4TN4A 1BJWA 4DGTA 4RAEA 4WB0A 2VMTA 2ZY4A 3DZZA 5FT8A 1TATA 3MBBA 2FQ6A 2C7TA 5KTBA 1BT4A 3AENB 3PDBA 4IXSA 4TV7A 4XK1A 1DJUA 2DGKA 2R5EA 3USFA 1OATA 1C7OA 3PPLA 3VOMA 4DBCA 4KXKA 5G4JA 1FG7A 4AO9A 4ZAHA 4JF0A 3N4RA 3N5MA 2ZJGA 3QPGA 4F5LA 1MLZA 3FZ6A 4GEBA 5G09A 4EMYA 4B9BA 1AIAA 2Q7WA 3ZZJA 2O0RA 3BB8A 4E3QA 3DXVA 1IVRA 3FDBA 2CJHA 2VGTA 1CL2A 1RVYA 2YOBA 2VMPA 2CANA 1Z7DA 3AEPA 2YHKA 3PIUA 3MEBA 4ADCA 1IX8A 2BI9A 2BIAA 5EAVA 1UKJA 2YCTA 2ZYJA 2WKAA 4WYCA 4A0HA 1N8PA 2ZY2A 1DKAA 3Q8NA 2X3LA 4AO4A 2YKXA 1QISA 4EFFA 3NDNA 1GD9A 2Z20A 1SZKA 4J5UA 3EUCA 3PA9A 3E2FA 2AY5A 2TPLA 5DB5A 4MQRA 2Z61A 3DC1A 3L44A 2W8WA 2Z1YA 1AIBA 2VMUA 4RJYA 3B1DA 3F9TA 3NTJA 3DR4A 3FZ8A 4WXFA 4UHOA 3I4JA 2R5CB 3EIAA 4ZDOA 1AMSA 1BQAA 3E6GA 4H63Q 1IJIA 1S09A 3FVSA 3AEJC 2NMPA 2Z9UA 2X5FA 1WKHA 3ISLA 5G0AA 1O4SA 4WD2A 1BJOA 2W8UA 4M2MA 3NUIA 3A9XA 2GMSA 3A9ZA 3NNKA 3JWBA 4XJLA 1C7NA 1AMRA 2FM1A 1Z3ZA 1AJSB 4IXOA 2W7KA 2JJHA 3NU7A 1TOEA 1AICA 4AOAA 4BHDA 2D63A 4PFNA 1ASNA 1WYVB 4IW7A 3ATHA 1ORDA 2VMZA 2W7DA 5HXXA 3LVKA 1ELUA 1JF9A 2EO5A 1N2TA 3PGYA 2ORDA 3ACZA 4UQVA 4F5JA 1LC8A 1CQ6A 3COGA 3M5UA 2W8JA 4ITGA 2AY1A 1OHYA 3NYTA 3FRKA 5F8VA 2HOZA 1LW4A 1VP4A 3N75A 4RIZA 1GC0A 3MAFA 3GJUA 1EJIA 4B98A 2Z9VA 4F4EA 3BS8A 1M7YA 1AMQA 3IHJA 3CQ4A 1W3UA 2W7IA 4CBSA 1BW0A 1RVUA 4WYGA 2D66A 2FYFA 1E5EA 4P7YA 3FSLA 4CVQA 3ZRPA 4Q76A 1DFOA 4ZM4A 3FQAA 2ZY5A 4OCAA 1I43A 3PJ0A 1M0PA 1O61A 1KMKA 2DKBA 2VMRA 1YIZA 4F5FA 4OMAA 1TOIA 2D64A 3CBFA 4P3MA 4LNJA 4LC3A 3B1EA 1TOGA 1GEXA 4WBTA 4WLHA 4ZWMA 1J04A 2VMWA 1H1CA 2BYJA 3ASAA 2RFVA 3WGCA 1CQ7A 2W7JA 2HOYA 4W91A 1ASDA 2X5DA 1X0MA 3FQ7A 1DTYA 3GWPA 3G0TA 1ASLA 1H0CA 3ECDA 5J8QA 1X29A 2AY8A 2W7GA 1BS0A 4UOYA 4GSAA 3CQ5A 3H7FA 2HOXA 3RBLA 3P1TA 2EZ1A 1S0AA 2DOUA 3RCHB 3OKSA 1AHFA 2AY7A 1G4VA 3E9KA 2BWNA 5M4DA 1DJ9A 1BQDA 2AY9A 2PO3A 2ZP7A 5K8BA 3LVJA 3E2ZB 3RQ1A 1IX6A 3JTXA 4XEWA 2GQNA 3FDDA 2VI8A 2E7IA 2XH1A 1AKCA 3DR7A 4HF8A 2WK9A 4JF1A 2CSTA 3UWCA 4F5HA 1I41A 1MDZA 4K2IA 2D65A 3PDXA 1QIRA 3JW9A 5EUDA 3DODA 4JEWA 3WCOA 5F9SA 1ASGA 3EIBA 5M46A 2VIBA 3MAUA 1DGEA 1W7MA 1ZC9A 3QM2A 4XJMA 2ZY3A 2FN6A 2W8VA 2W7EA 3A9YA 1C9CA 2F8JA 2CTZA 4ATPA 3E2YA 3PD6A 3ELPA 1YJYA 2HP2A 4GE7A 4AH3A 3VAXA 4UHMA 2VGZA 1LC7A 2VMVA 4EU1A 5IWQA 2HORA 2BI2A 4CXQA 1MAQA 3AENA 3MC6A 4I8AA 4RITA 3HBXA 1TPLA 3WX9A 1W7LA 1AY8A 1AJRA 2JGTA 5EUEA 4BA5A 1IAXA 1AY4A 4MQQA 4E1OA 1PFFA 3NYUA 1SF2A 4K2BA 3BWOA 1D2FA 3HT4A 4L0OA 2CFBA 2AEUA 2JISA 4LNMA 3GZDA 3KGWA 1SFFA 2HP1A 2V1PA 3FVUA 2DKJA 2W7MA 1ARHA 1TASA 2VGSA 2Z9XA 3B46A 2ZSLA 2OKKA 5DJ9A 5EIGA 2EH6A 1CJ0A 3TATA 3WGBA 1X2AA 1CZCA 3NU8A 2W7HA 1B5PA 3G7QA 2KFPA 3BWNA 4W5KA 4ZDPA 1GC2A 4GRXA 1GEYA 5FT5A 3DU4A 1GEWA 1RV4A 3K40A 3LY1A 2D61A 4NOGA 1WKGA 3VK4A 1MAPA 1G7WA 2C81A 4TMRA 2CINA 2QLRA 4MSOA 3LVLB 1BJ4A 3RI6A 3NUBA 1M6SA 4M2KA 1TOKA 2G6WA 3DYDA 3KE3A 3P6KA 1ASAA 1LS3A 4Q75A 4U1TA 4A6UA 3AEOA 3WLXA 4ZWVA 1AAWA 2EPJA 1MDOA 1N31A 2ZSMA 1LC5A 3H14A 4WXGA 5EAAA 2VYCA 2D7ZA 2YKUA 1AX4A 3AEMC 1IX7A 1WYUA 1Y4IA 3RUYA 4Q6RA 1CL1A 3FFRA 2VMOA 3BCXA 2OATA 3QI6A 1SPAA 2R5CA 4A6TA 1AHXA 1OXPA 5D5SA 5DX5A 2BHXA 4N0BA 2AY4A 3TCMA 1ZODA 4MGRA 1YAAA 2YCNA 2Z9WA 2HUFA 4Y0HA 3BCBA 1V2EA 1PMOA 2AATA 2GMUA 5TF5A 4ATQA 1FG3A 1GDEA 1D7SA 2DGMA 3G8MA 3WCNA 3GBXA 3DRDA 1OXOA 4ZM3A 2JJFA 2VI9A 2WK8A 4K2MA 1JS3A 1V72A 1AJSA 2DR1A 4Y0IA 4J8LA 1FC4A 1MGVA 2EZ2A 3MADA 3QHXA 3WY7A 9AATA 2CH2A 4GE9A 1WYVA 5I92A 2AY3A 3CAIA 3B1CA 5E3KA 1B8GA 2YKVA 1GCKA 3PAAA 4FFCA 4F5MA 1AMAA 2QB2A 3HLMA 5AX8A 1W23A 1YJSA 1GC3A 1YNUA 3EI8A 2Z1ZA 3MKJA 1O62A 3JWAA 4W1VA 1V2FA 3LVMA 4R5FA 3T32A 1EQBA 4IYOB 3UAKA 1M0QA 4RKCA 3AEJA 2VGVA 2BI3A 3IF2A 3N7NA 4LW2A 3JZLA 3HVYA 3TFUA 2YCPA 1G7XA 1GBNA 1JS6A 3EI5A 4JEZA 3WKSA 2JJEA 1O69A 3QN6A 4A0FA 2YKYA 1ARTA 2C0RA 4AZJA 4ADBA 4H51A 1ARIA 1P3WA 4F5GA 4IXZA 4EB5A 2AY6A 2O1BA 2VMXA 4ISYA 4CBRA 4WYEA 4JE5D 1IBJA 2E54A 2JJGA 3ZZKA 2R2NA 3N4XA 7AATA 5LHAA 2VGUA 4N0WA 3CQ6A 1C0NA 4Q31A 4O6ZA 1D7UA 4RJ0A 1W7NA 3W1JA 1WYTA 2GSAA 3GETA 3N0LA 4M2JA 5HDMA 1RV3A 3VK2A 1QJ3A 3D6KA 2V0YA 4MQPA 4WB0B 1DGDA 4XQ2A 1B9HA 4KYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFH A;  3K28 A;  2CJD A;  4OTL A;  4OBU A;  1T3I A;  2VLF A;  3AOV A;  3PDB B;  4PVF A;  4BQ0 A;  1I48 A;  2VMS A;  3VK3 A;  1WST A;  1UU2 A;  1KKJ A;  2HUI A;  3JU7 A;  5FT6 A;  3UE8 A;  1PG8 A;  1ASF A;  4F5K A;  4EB7 A;  3AV7 A;  1M0O A;  4ZAS A;  4WLJ A;  1U08 A;  2OGA A;  3RCH A;  5G4I A;  3PD6 B;  5M49 A;  4WYA A;  5DJ1 A;  3LWS A;  1BKG A;  3HL2 A;  3OP7 A;  1LKC A;  1QGN A;  3EZ1 A;  4A0G A;  4JEY A;  4R2N A;  3E2Z A;  4XAU A;  1YOO A;  2OGE A;  1DJE A;  1AHY A;  2WK7 A;  3FQ8 A;  4GE4 A;  1KL1 A;  3FZ7 A;  3FVX A;  1QIT A;  4WYF A;  1J32 A;  1IUG A;  3WZF A;  1ASC A;  1LW5 A;  1SZS A;  2HZP A;  5FT4 A;  3A2B A;  4W8I A;  1AAM A;  4ZDL A;  3FCR A;  4RKD A;  5EIG B;  3FTB A;  3W1I A;  5EQC A;  1TOJ A;  4Y0D A;  1ASB A;  1XI9 A;  2VMY A;  2VIA A;  4WP0 A;  2GB3 A;  4A00 A;  1D7R A;  4LW4 A;  4OC9 A;  1VJO A;  3DXW A;  3GSB A;  1OHW A;  5HHY A;  3RBF A;  2C44 A;  2VMQ A;  1ASE A;  3WKR A;  4W1X A;  2FNI A;  1AHG A;  3EZS A;  5C6U A;  4OT8 A;  2BWO A;  1QZ9 A;  2VGW A;  3K7Y A;  3BC8 A;  4R5Z A;  3QGU A;  4E3R A;  4ADE A;  3AAT A;  5JAY A;  1ARG A;  3BCA A;  2AY2 A;  2CH1 A;  1BJO B;  1ZOB A;  4JEX A;  1QJ5 A;  3W1H A;  4GDY A;  2YRR A;  5E4Z A;  3ZRQ A;  1B5O A;  4JEV A;  4ZSW A;  5D95 A;  2E7J A;  3F6T A;  1D7V A;  1WYU B;  4BA4 A;  1M0N A;  3II0 A;  3I16 A;  3ELE A;  2DGL A;  3E77 A;  2Z67 A;  1UU1 A;  3HQT A;  1S07 A;  3AOW A;  1SZU A;  1AY5 A;  3VP6 A;  1JG8 A;  1VEF A;  1XEY A;  5LH9 A;  2O7C A;  3EI9 A;  3R4T A;  3HDO A;  3L8A A;  3AEL A;  4AZK A;  4MY5 A;  4BMK A;  1LK9 A;  3MAF B;  2W7L A;  8AAT A;  3NRA A;  4MKJ A;  1B9I A;  3ASB A;  2FNU A;  3QBO A;  4XJO A;  3R9A A;  2HUU A;  2PB2 A;  1UU0 A;  5EFS A;  3A8U X;  3FD0 A;  4ZSY A;  1C7G A;  4CXR A;  3B8X A;  4UHN A;  1SVV A;  1KMJ A;  2JG2 A;  4ITX A;  2XBN A;  3HMU A;  5G2Q A;  1I29 A;  3FKD A;  1OHV A;  2CB1 A;  4WYD A;  3KGX A;  2EGY A;  4ADD A;  1ARS A;  1B4X A;  3TFT A;  2AEV A;  2ZC0 A;  4A6R A;  1ECX A;  3EI6 A;  1S08 A;  3GZC A;  4RLG A;  4PIW A;  1YIY A;  4F5I A;  4XJP A;  3GR9 A;  2W8T A;  1G4X A;  4R8D A;  1CZE A;  5BJ4 A;  1ELQ A;  4LNL A;  2E7U A;  4WXB A;  3I5T A;  4A0R A;  3EI7 A;  2BIG A;  2OQX A;  1TAR A;  1YJZ A;  3BN1 A;  2ZUK A;  2QB3 A;  3AEM A;  2BWP A;  4U2H A;  1KKP A;  1ASM A;  2QA3 A;  4OYT A;  2BKW A;  4IY7 A;  1IAY A;  4FL0 A;  4OBV A;  2QBT A;  1E5F A;  3BV0 A;  1WYT B;  3F0H A;  2BYL A;  2BI5 A;  2OKJ A;  1KL2 A;  1MDX A;  4IYO A;  4MKK A;  5EUN A;  4ZLV A;  1CQ8 A;  4A72 A;  3NX3 A;  5G2P A;  3NYS A;  1M32 A;  3MC6 C;  4W1W A;  1EG5 A;  3KKI A;  1PMM A;  2YRI A;  4KAM A;  2W7F A;  4QGR A;  4PFF A;  1CS1 A;  1AKA A;  4JE5 A;  2CY8 A;  1AKB A;  2BIE A;  5M4B A;  1MLY A;  2VLH A;  5BJ3 A;  1V2D A;  3GZD C;  1X28 A;  4E77 A;  1AHE A;  4IX8 A;  3TQX A;  1C4K A;  4HVK A;  1M4N A;  2BI1 A;  2PB0 A;  2CJG A;  3ZRR A;  2QMA A;  2X8U A;  1GC4 A;  4RM1 A;  2R0T A;  1BJN A;  3BWN C;  2D5Y A;  1S06 A;  5E5I A;  4DQ6 A;  2D7Y A;  3LG0 A;  3LV2 A;  2VMN A;  4TN4 A;  1BJW A;  4DGT A;  4RAE A;  4WB0 A;  2VMT A;  2ZY4 A;  3DZZ A;  5FT8 A;  1TAT A;  3MBB A;  2FQ6 A;  2C7T A;  1BT4 A;  3AEN B;  3PDB A;  4IXS A;  4TV7 A;  4XK1 A;  1DJU A;  2DGK A;  2R5E A;  3USF A;  1OAT A;  1C7O A;  3PPL A;  3VOM A;  4DBC A;  4KXK A;  5G4J A;  1FG7 A;  4AO9 A;  4ZAH A;  4JF0 A;  3N5M A;  2ZJG A;  3QPG A;  4F5L A;  1MLZ A;  3FZ6 A;  4GEB A;  5G09 A;  4EMY A;  4B9B A;  1AIA A;  2Q7W A;  3ZZJ A;  2O0R A;  3BB8 A;  4E3Q A;  3DXV A;  1IVR A;  3FDB A;  2CJH A;  2VGT A;  1CL2 A;  1RVY A;  2YOB A;  2VMP A;  2CAN A;  1Z7D A;  3AEP A;  2YHK A;  3PIU A;  3MEB A;  4ADC A;  1IX8 A;  2BI9 A;  2BIA A;  5EAV A;  1UKJ A;  2YCT A;  2ZYJ A;  2WKA A;  4WYC A;  4A0H A;  1N8P A;  2ZY2 A;  1DKA A;  3Q8N A;  2X3L A;  4AO4 A;  2YKX A;  1QIS A;  4EFF A;  3NDN A;  1GD9 A;  2Z20 A;  1SZK A;  4J5U A;  3EUC A;  3PA9 A;  3E2F A;  2AY5 A;  2TPL A;  5DB5 A;  4MQR A;  2Z61 A;  3DC1 A;  3L44 A;  2W8W A;  2Z1Y A;  1AIB A;  2VMU A;  4RJY A;  3B1D A;  3F9T A;  3NTJ A;  3DR4 A;  3FZ8 A;  4WXF A;  4UHO A;  3I4J A;  2R5C B;  3EIA A;  4ZDO A;  1AMS A;  1BQA A;  3E6G A;  1IJI A;  1S09 A;  3FVS A;  3AEJ C;  2NMP A;  2Z9U A;  2X5F A;  1WKH A;  3ISL A;  5G0A A;  1O4S A;  4WD2 A;  1BJO A;  2W8U A;  4M2M A;  3NUI A;  3A9X A;  2GMS A;  3A9Z A;  3NNK A;  3JWB A;  4XJL A;  1C7N A;  1AMR A;  2FM1 A;  1Z3Z A;  1AJS B;  4IXO A;  2W7K A;  2JJH A;  3NU7 A;  1TOE A;  1AIC A;  4AOA A;  4BHD A;  2D63 A;  4PFN A;  1ASN A;  1WYV B;  4IW7 A;  3ATH A;  1ORD A;  2VMZ A;  2W7D A;  5HXX A;  3LVK A;  1ELU A;  1JF9 A;  2EO5 A;  1N2T A;  3PGY A;  2ORD A;  3ACZ A;  4UQV A;  4F5J A;  1LC8 A;  1CQ6 A;  3COG A;  3M5U A;  2W8J A;  4ITG A;  2AY1 A;  1OHY A;  3NYT A;  3FRK A;  5F8V A;  2HOZ A;  1LW4 A;  1VP4 A;  3N75 A;  4RIZ A;  1GC0 A;  3MAF A;  3GJU A;  1EJI A;  4B98 A;  2Z9V A;  4F4E A;  3BS8 A;  1M7Y A;  1AMQ A;  3IHJ A;  3CQ4 A;  1W3U A;  2W7I A;  4CBS A;  1BW0 A;  1RVU A;  4WYG A;  2D66 A;  2FYF A;  1E5E A;  4P7Y A;  3FSL A;  4CVQ A;  3ZRP A;  4Q76 A;  1DFO A;  4ZM4 A;  3FQA A;  2ZY5 A;  4OCA A;  1I43 A;  3PJ0 A;  1M0P A;  1O61 A;  1KMK A;  2DKB A;  2VMR A;  1YIZ A;  4F5F A;  4OMA A;  1TOI A;  2D64 A;  3CBF A;  4P3M A;  4LNJ A;  4LC3 A;  3B1E A;  1TOG A;  1GEX A;  4WBT A;  4WLH A;  4ZWM A;  1J04 A;  2VMW A;  1H1C A;  2BYJ A;  3ASA A;  2RFV A;  3WGC A;  1CQ7 A;  2W7J A;  2HOY A;  4W91 A;  1ASD A;  2X5D A;  1X0M A;  3FQ7 A;  1DTY A;  3GWP A;  3G0T A;  1ASL A;  1H0C A;  3ECD A;  5J8Q A;  1X29 A;  2AY8 A;  2W7G A;  1BS0 A;  4UOY A;  4GSA A;  3CQ5 A;  3H7F A;  2HOX A;  3RBL A;  3P1T A;  2EZ1 A;  1S0A A;  2DOU A;  3RCH B;  3OKS A;  1AHF A;  2AY7 A;  1G4V A;  3E9K A;  2BWN A;  5M4D A;  1DJ9 A;  1BQD A;  2AY9 A;  2PO3 A;  2ZP7 A;  5K8B A;  3LVJ A;  3E2Z B;  3RQ1 A;  1IX6 A;  3JTX A;  4XEW A;  2GQN A;  3FDD A;  2VI8 A;  2E7I A;  2XH1 A;  1AKC A;  3DR7 A;  4HF8 A;  2WK9 A;  4JF1 A;  2CST A;  3UWC A;  4F5H A;  1I41 A;  1MDZ A;  4K2I A;  2D65 A;  3PDX A;  1QIR A;  3JW9 A;  5EUD A;  3DOD A;  4JEW A;  3WCO A;  5F9S A;  1ASG A;  3EIB A;  5M46 A;  2VIB A;  3MAU A;  1DGE A;  1W7M A;  1ZC9 A;  3QM2 A;  4XJM A;  2ZY3 A;  2FN6 A;  2W8V A;  2W7E A;  3A9Y A;  1C9C A;  2F8J A;  2CTZ A;  4ATP A;  3E2Y A;  3PD6 A;  3ELP A;  1YJY A;  2HP2 A;  4GE7 A;  4AH3 A;  3VAX A;  4UHM A;  2VGZ A;  1LC7 A;  2VMV A;  4EU1 A;  5IWQ A;  2HOR A;  2BI2 A;  4CXQ A;  1MAQ A;  3AEN A;  3MC6 A;  4I8A A;  4RIT A;  3HBX A;  1TPL A;  3WX9 A;  1W7L A;  1AY8 A;  1AJR A;  2JGT A;  5EUE A;  4BA5 A;  1IAX A;  1AY4 A;  4MQQ A;  4E1O A;  1PFF A;  3NYU A;  1SF2 A;  4K2B A;  3BWO A;  1D2F A;  3HT4 A;  4L0O A;  2CFB A;  2AEU A;  2JIS A;  4LNM A;  3GZD A;  3KGW A;  1SFF A;  2HP1 A;  2V1P A;  3FVU A;  2DKJ A;  2W7M A;  1ARH A;  1TAS A;  2VGS A;  2Z9X A;  3B46 A;  2ZSL A;  2OKK A;  5DJ9 A;  5EIG A;  2EH6 A;  1CJ0 A;  3TAT A;  3WGB A;  1X2A A;  1CZC A;  3NU8 A;  2W7H A;  1B5P A;  3G7Q A;  3BWN A;  4W5K A;  4ZDP A;  1GC2 A;  4GRX A;  1GEY A;  5FT5 A;  3DU4 A;  1GEW A;  1RV4 A;  3K40 A;  3LY1 A;  2D61 A;  4NOG A;  1WKG A;  3VK4 A;  1MAP A;  1G7W A;  2C81 A;  4TMR A;  2CIN A;  2QLR A;  4MSO A;  3LVL B;  1BJ4 A;  3RI6 A;  3NUB A;  1M6S A;  4M2K A;  1TOK A;  2G6W A;  3DYD A;  3KE3 A;  3P6K A;  1ASA A;  1LS3 A;  4Q75 A;  4U1T A;  4A6U A;  3AEO A;  3WLX A;  4ZWV A;  1AAW A;  2EPJ A;  1MDO A;  1N31 A;  2ZSM A;  1LC5 A;  3H14 A;  4WXG A;  5EAA A;  2VYC A;  2D7Z A;  2YKU A;  1AX4 A;  3AEM C;  1IX7 A;  1WYU A;  1Y4I A;  3RUY A;  4Q6R A;  1CL1 A;  3FFR A;  2VMO A;  3BCX A;  2OAT A;  3QI6 A;  1SPA A;  2R5C A;  4A6T A;  1AHX A;  1OXP A;  5D5S A;  5DX5 A;  2BHX A;  4N0B A;  2AY4 A;  3TCM A;  1ZOD A;  4MGR A;  1YAA A;  2YCN A;  2Z9W A;  2HUF A;  4Y0H A;  3BCB A;  1V2E A;  1PMO A;  2AAT A;  2GMU A;  5TF5 A;  4ATQ A;  1FG3 A;  1GDE A;  1D7S A;  2DGM A;  3G8M A;  3WCN A;  3GBX A;  3DRD A;  1OXO A;  4ZM3 A;  2JJF A;  2VI9 A;  2WK8 A;  4K2M A;  1JS3 A;  1V72 A;  1AJS A;  2DR1 A;  4Y0I A;  4J8L A;  1FC4 A;  1MGV A;  2EZ2 A;  3MAD A;  3QHX A;  3WY7 A;  9AAT A;  2CH2 A;  4GE9 A;  1WYV A;  5I92 A;  2AY3 A;  3CAI A;  3B1C A;  5E3K A;  1B8G A;  2YKV A;  1GCK A;  3PAA A;  4FFC A;  4F5M A;  1AMA A;  2QB2 A;  3HLM A;  5AX8 A;  1W23 A;  1YJS A;  1GC3 A;  1YNU A;  3EI8 A;  2Z1Z A;  3MKJ A;  1O62 A;  3JWA A;  4W1V A;  1V2F A;  3LVM A;  4R5F A;  3T32 A;  1EQB A;  4IYO B;  3UAK A;  1M0Q A;  4RKC A;  3AEJ A;  2VGV A;  2BI3 A;  3IF2 A;  4LW2 A;  3JZL A;  3HVY A;  3TFU A;  2YCP A;  1G7X A;  1GBN A;  1JS6 A;  3EI5 A;  4JEZ A;  3WKS A;  2JJE A;  1O69 A;  3QN6 A;  4A0F A;  2YKY A;  1ART A;  2C0R A;  4AZJ A;  4ADB A;  4H51 A;  1ARI A;  1P3W A;  4F5G A;  4IXZ A;  4EB5 A;  2AY6 A;  2O1B A;  2VMX A;  4ISY A;  4CBR A;  4WYE A;  4JE5 D;  1IBJ A;  2E54 A;  2JJG A;  3ZZK A;  2R2N A;  7AAT A;  5LHA A;  2VGU A;  4N0W A;  3CQ6 A;  1C0N A;  4Q31 A;  4O6Z A;  1D7U A;  4RJ0 A;  1W7N A;  3W1J A;  1WYT A;  2GSA A;  3GET A;  3N0L A;  4M2J A;  5HDM A;  1RV3 A;  3VK2 A;  1QJ3 A;  3D6K A;  2V0Y A;  4MQP A;  4WB0 B;  1DGD A;  4XQ2 A;  1B9H A;  4KYO A; 
#chains in the Genus database with same CATH topology
 3FFH A;  3K28 A;  2CJD A;  4OTL A;  4OBU A;  1T3I A;  2VLF A;  3AOV A;  3PDB B;  4PVF A;  4BQ0 A;  1I48 A;  2WB6 A;  2VMS A;  2A1V A;  3VK3 A;  1WST A;  1UU2 A;  1KKJ A;  2HUI A;  3JU7 A;  5FT6 A;  3UE8 A;  1KAF A;  1PG8 A;  1ASF A;  4F5K A;  4EB7 A;  3AV7 A;  1M0O A;  4ZAS A;  4WLJ A;  1U08 A;  2OGA A;  3RCH A;  5G4I A;  3PD6 B;  5M49 A;  4WYA A;  5DJ1 A;  3LWS A;  1BKG A;  3HL2 A;  3OP7 A;  1LKC A;  1QGN A;  3EZ1 A;  4A0G A;  4JEY A;  4R2N A;  3E2Z A;  4XAU A;  1YOO A;  2OGE A;  1DJE A;  1AHY A;  2WK7 A;  3FQ8 A;  4GE4 A;  1KL1 A;  3FZ7 A;  3FVX A;  1QIT A;  4WYF A;  1J32 A;  1IUG A;  3WZF A;  1ASC A;  1LW5 A;  1SZS A;  2HZP A;  5FT4 A;  3A2B A;  4W8I A;  1AAM A;  4ZDL A;  3FCR A;  4RKD A;  5EIG B;  3FTB A;  3W1I A;  5EQC A;  1TOJ A;  4Y0D A;  1ASB A;  1XI9 A;  2VMY A;  2VIA A;  4WP0 A;  2GB3 A;  4A00 A;  1D7R A;  2QSR A;  4LW4 A;  4OC9 A;  1VJO A;  3DXW A;  3GSB A;  1OHW A;  5HHY A;  3RBF A;  2C44 A;  2VMQ A;  1ASE A;  3WKR A;  4W1X A;  2FNI A;  1AHG A;  3EZS A;  5C6U A;  4OT8 A;  2BWO A;  1QZ9 A;  2VGW A;  3K7Y A;  3BC8 A;  4R5Z A;  3QGU A;  4E3R A;  4ADE A;  3AAT A;  5JAY A;  1ARG A;  3BCA A;  2AY2 A;  2CH1 A;  1BJO B;  1ZOB A;  4JEX A;  1QJ5 A;  3W1H A;  4GDY A;  2YRR A;  5E4Z A;  3ZRQ A;  1B5O A;  4JEV A;  4ZSW A;  5D95 A;  2E7J A;  3F6T A;  1D7V A;  1WYU B;  4BA4 A;  1M0N A;  3II0 A;  3I16 A;  3ELE A;  2DGL A;  3E77 A;  2Z67 A;  1UU1 A;  3HQT A;  1S07 A;  3AOW A;  1SZU A;  1AY5 A;  3VP6 A;  1JG8 A;  1VEF A;  1XEY A;  5LH9 A;  2O7C A;  3EI9 A;  3R4T A;  3HDO A;  3L8A A;  3AEL A;  4AZK A;  4MY5 A;  4BMK A;  1LK9 A;  3MAF B;  2W7L A;  8AAT A;  3NRA A;  4MKJ A;  1B9I A;  3ASB A;  2FNU A;  3QBO A;  4XJO A;  3R9A A;  2HUU A;  2PB2 A;  1UU0 A;  5EFS A;  3A8U X;  3FD0 A;  4ZSY A;  1C7G A;  4CXR A;  2G7J A;  3B8X A;  4UHN A;  1SVV A;  1KMJ A;  2JG2 A;  4ITX A;  2XBN A;  3HMU A;  5G2Q A;  1I29 A;  3FKD A;  1OHV A;  2CB1 A;  4WYD A;  3KGX A;  2EGY A;  4ADD A;  1ARS A;  1B4X A;  3TFT A;  2AEV A;  2ZC0 A;  4A6R A;  1ECX A;  3EI6 A;  1S08 A;  3GZC A;  4RLG A;  4PIW A;  1YIY A;  4F5I A;  4XJP A;  3GR9 A;  2W8T A;  1G4X A;  2FKI A;  2EYQ A;  4R8D A;  1CZE A;  5BJ4 A;  1ELQ A;  4LNL A;  2E7U A;  4WXB A;  3I5T A;  4A0R A;  3EI7 A;  2BIG A;  2OQX A;  1TAR A;  1YJZ A;  3BN1 A;  2ZUK A;  2QB3 A;  3AEM A;  2BWP A;  4U2H A;  1KKP A;  1ASM A;  2QA3 A;  4OYT A;  2BKW A;  4IY7 A;  1IAY A;  4FL0 A;  4OBV A;  2QBT A;  1E5F A;  3BV0 A;  1WYT B;  3F0H A;  2BYL A;  2BI5 A;  2OKJ A;  4K05 A;  1KL2 A;  1MDX A;  4IYO A;  4MKK A;  5EUN A;  4ZLV A;  1CQ8 A;  4A72 A;  3N4S A;  3NX3 A;  5G2P A;  3NYS A;  1M32 A;  3MC6 C;  4W1W A;  1EG5 A;  3KKI A;  1PMM A;  2YRI A;  4KAM A;  2W7F A;  4QGR A;  4PFF A;  1CS1 A;  1AKA A;  4JE5 A;  2CY8 A;  1AKB A;  2BIE A;  5M4B A;  1MLY A;  2VLH A;  5BJ3 A;  1V2D A;  3GZD C;  1X28 A;  4E77 A;  1AHE A;  4IX8 A;  3TQX A;  1C4K A;  4HVK A;  1M4N A;  2BI1 A;  2PB0 A;  2CJG A;  3ZRR A;  2QMA A;  2X8U A;  1GC4 A;  4RM1 A;  2R0T A;  1BJN A;  3BWN C;  2D5Y A;  1S06 A;  5E5I A;  3H9X A;  4DQ6 A;  2D7Y A;  3LG0 A;  3LV2 A;  2VMN A;  4TN4 A;  1BJW A;  4DGT A;  4RAE A;  4WB0 A;  2VMT A;  2ZY4 A;  3DZZ A;  5FT8 A;  1TAT A;  3MBB A;  2FQ6 A;  2C7T A;  5KTB A;  1BT4 A;  3AEN B;  3PDB A;  4IXS A;  4TV7 A;  4XK1 A;  1DJU A;  2DGK A;  2R5E A;  3USF A;  1OAT A;  1C7O A;  3PPL A;  3VOM A;  4DBC A;  4KXK A;  5G4J A;  1FG7 A;  4AO9 A;  4ZAH A;  4JF0 A;  3N4R A;  3N5M A;  2ZJG A;  3QPG A;  4F5L A;  1MLZ A;  3FZ6 A;  4GEB A;  5G09 A;  4EMY A;  4B9B A;  1AIA A;  2Q7W A;  3ZZJ A;  2O0R A;  3BB8 A;  4E3Q A;  3DXV A;  1IVR A;  3FDB A;  2CJH A;  2VGT A;  1CL2 A;  1RVY A;  2YOB A;  2VMP A;  2CAN A;  1Z7D A;  3AEP A;  2YHK A;  3PIU A;  3MEB A;  4ADC A;  1IX8 A;  2BI9 A;  2BIA A;  5EAV A;  1UKJ A;  2YCT A;  2ZYJ A;  2WKA A;  4WYC A;  4A0H A;  1N8P A;  2ZY2 A;  1DKA A;  3Q8N A;  2X3L A;  4AO4 A;  2YKX A;  1QIS A;  4EFF A;  3NDN A;  1GD9 A;  2Z20 A;  1SZK A;  4J5U A;  3EUC A;  3PA9 A;  3E2F A;  2AY5 A;  2TPL A;  5DB5 A;  4MQR A;  2Z61 A;  3DC1 A;  3L44 A;  2W8W A;  2Z1Y A;  1AIB A;  2VMU A;  4RJY A;  3B1D A;  3F9T A;  3NTJ A;  3DR4 A;  3FZ8 A;  4WXF A;  4UHO A;  3I4J A;  2R5C B;  3EIA A;  4ZDO A;  1AMS A;  1BQA A;  3E6G A;  4H63 Q;  1IJI A;  1S09 A;  3FVS A;  3AEJ C;  2NMP A;  2Z9U A;  2X5F A;  1WKH A;  3ISL A;  5G0A A;  1O4S A;  4WD2 A;  1BJO A;  2W8U A;  4M2M A;  3NUI A;  3A9X A;  2GMS A;  3A9Z A;  3NNK A;  3JWB A;  4XJL A;  1C7N A;  1AMR A;  2FM1 A;  1Z3Z A;  1AJS B;  4IXO A;  2W7K A;  2JJH A;  3NU7 A;  1TOE A;  1AIC A;  4AOA A;  4BHD A;  2D63 A;  4PFN A;  1ASN A;  1WYV B;  4IW7 A;  3ATH A;  1ORD A;  2VMZ A;  2W7D A;  5HXX A;  3LVK A;  1ELU A;  1JF9 A;  2EO5 A;  1N2T A;  3PGY A;  2ORD A;  3ACZ A;  4UQV A;  4F5J A;  1LC8 A;  1CQ6 A;  3COG A;  3M5U A;  2W8J A;  4ITG A;  2AY1 A;  1OHY A;  3NYT A;  3FRK A;  5F8V A;  2HOZ A;  1LW4 A;  1VP4 A;  3N75 A;  4RIZ A;  1GC0 A;  3MAF A;  3GJU A;  1EJI A;  4B98 A;  2Z9V A;  4F4E A;  3BS8 A;  1M7Y A;  1AMQ A;  3IHJ A;  3CQ4 A;  1W3U A;  2W7I A;  4CBS A;  1BW0 A;  1RVU A;  4WYG A;  2D66 A;  2FYF A;  1E5E A;  4P7Y A;  3FSL A;  4CVQ A;  3ZRP A;  4Q76 A;  1DFO A;  4ZM4 A;  3FQA A;  2ZY5 A;  4OCA A;  1I43 A;  3PJ0 A;  1M0P A;  1O61 A;  1KMK A;  2DKB A;  2VMR A;  1YIZ A;  4F5F A;  4OMA A;  1TOI A;  2D64 A;  3CBF A;  4P3M A;  4LNJ A;  4LC3 A;  3B1E A;  1TOG A;  1GEX A;  4WBT A;  4WLH A;  4ZWM A;  1J04 A;  2VMW A;  1H1C A;  2BYJ A;  3ASA A;  2RFV A;  3WGC A;  1CQ7 A;  2W7J A;  2HOY A;  4W91 A;  1ASD A;  2X5D A;  1X0M A;  3FQ7 A;  1DTY A;  3GWP A;  3G0T A;  1ASL A;  1H0C A;  3ECD A;  5J8Q A;  1X29 A;  2AY8 A;  2W7G A;  1BS0 A;  4UOY A;  4GSA A;  3CQ5 A;  3H7F A;  2HOX A;  3RBL A;  3P1T A;  2EZ1 A;  1S0A A;  2DOU A;  3RCH B;  3OKS A;  1AHF A;  2AY7 A;  1G4V A;  3E9K A;  2BWN A;  5M4D A;  1DJ9 A;  1BQD A;  2AY9 A;  2PO3 A;  2ZP7 A;  5K8B A;  3LVJ A;  3E2Z B;  3RQ1 A;  1IX6 A;  3JTX A;  4XEW A;  2GQN A;  3FDD A;  2VI8 A;  2E7I A;  2XH1 A;  1AKC A;  3DR7 A;  4HF8 A;  2WK9 A;  4JF1 A;  2CST A;  3UWC A;  4F5H A;  1I41 A;  1MDZ A;  4K2I A;  2D65 A;  3PDX A;  1QIR A;  3JW9 A;  5EUD A;  3DOD A;  4JEW A;  3WCO A;  5F9S A;  1ASG A;  3EIB A;  5M46 A;  2VIB A;  3MAU A;  1DGE A;  1W7M A;  1ZC9 A;  3QM2 A;  4XJM A;  2ZY3 A;  2FN6 A;  2W8V A;  2W7E A;  3A9Y A;  1C9C A;  2F8J A;  2CTZ A;  4ATP A;  3E2Y A;  3PD6 A;  3ELP A;  1YJY A;  2HP2 A;  4GE7 A;  4AH3 A;  3VAX A;  4UHM A;  2VGZ A;  1LC7 A;  2VMV A;  4EU1 A;  5IWQ A;  2HOR A;  2BI2 A;  4CXQ A;  1MAQ A;  3AEN A;  3MC6 A;  4I8A A;  4RIT A;  3HBX A;  1TPL A;  3WX9 A;  1W7L A;  1AY8 A;  1AJR A;  2JGT A;  5EUE A;  4BA5 A;  1IAX A;  1AY4 A;  4MQQ A;  4E1O A;  1PFF A;  3NYU A;  1SF2 A;  4K2B A;  3BWO A;  1D2F A;  3HT4 A;  4L0O A;  2CFB A;  2AEU A;  2JIS A;  4LNM A;  3GZD A;  3KGW A;  1SFF A;  2HP1 A;  2V1P A;  3FVU A;  2DKJ A;  2W7M A;  1ARH A;  1TAS A;  2VGS A;  2Z9X A;  3B46 A;  2ZSL A;  2OKK A;  5DJ9 A;  5EIG A;  2EH6 A;  1CJ0 A;  3TAT A;  3WGB A;  1X2A A;  1CZC A;  3NU8 A;  2W7H A;  1B5P A;  3G7Q A;  2KFP A;  3BWN A;  4W5K A;  4ZDP A;  1GC2 A;  4GRX A;  1GEY A;  5FT5 A;  3DU4 A;  1GEW A;  1RV4 A;  3K40 A;  3LY1 A;  2D61 A;  4NOG A;  1WKG A;  3VK4 A;  1MAP A;  1G7W A;  2C81 A;  4TMR A;  2CIN A;  2QLR A;  4MSO A;  3LVL B;  1BJ4 A;  3RI6 A;  3NUB A;  1M6S A;  4M2K A;  1TOK A;  2G6W A;  3DYD A;  3KE3 A;  3P6K A;  1ASA A;  1LS3 A;  4Q75 A;  4U1T A;  4A6U A;  3AEO A;  3WLX A;  4ZWV A;  1AAW A;  2EPJ A;  1MDO A;  1N31 A;  2ZSM A;  1LC5 A;  3H14 A;  4WXG A;  5EAA A;  2VYC A;  2D7Z A;  2YKU A;  1AX4 A;  3AEM C;  1IX7 A;  1WYU A;  1Y4I A;  3RUY A;  4Q6R A;  1CL1 A;  3FFR A;  2VMO A;  3BCX A;  2OAT A;  3QI6 A;  1SPA A;  2R5C A;  4A6T A;  1AHX A;  1OXP A;  5D5S A;  5DX5 A;  2BHX A;  4N0B A;  2AY4 A;  3TCM A;  1ZOD A;  4MGR A;  1YAA A;  2YCN A;  2Z9W A;  2HUF A;  4Y0H A;  3BCB A;  1V2E A;  1PMO A;  2AAT A;  2GMU A;  5TF5 A;  4ATQ A;  1FG3 A;  1GDE A;  1D7S A;  2DGM A;  3G8M A;  3WCN A;  3GBX A;  3DRD A;  1OXO A;  4ZM3 A;  2JJF A;  2VI9 A;  2WK8 A;  4K2M A;  1JS3 A;  1V72 A;  1AJS A;  2DR1 A;  4Y0I A;  4J8L A;  1FC4 A;  1MGV A;  2EZ2 A;  3MAD A;  3QHX A;  3WY7 A;  9AAT A;  2CH2 A;  4GE9 A;  1WYV A;  5I92 A;  2AY3 A;  3CAI A;  3B1C A;  5E3K A;  1B8G A;  2YKV A;  1GCK A;  3PAA A;  4FFC A;  4F5M A;  1AMA A;  2QB2 A;  3HLM A;  5AX8 A;  1W23 A;  1YJS A;  1GC3 A;  1YNU A;  3EI8 A;  2Z1Z A;  3MKJ A;  1O62 A;  3JWA A;  4W1V A;  1V2F A;  3LVM A;  4R5F A;  3T32 A;  1EQB A;  4IYO B;  3UAK A;  1M0Q A;  4RKC A;  3AEJ A;  2VGV A;  2BI3 A;  3IF2 A;  3N7N A;  4LW2 A;  3JZL A;  3HVY A;  3TFU A;  2YCP A;  1G7X A;  1GBN A;  1JS6 A;  3EI5 A;  4JEZ A;  3WKS A;  2JJE A;  1O69 A;  3QN6 A;  4A0F A;  2YKY A;  1ART A;  2C0R A;  4AZJ A;  4ADB A;  4H51 A;  1ARI A;  1P3W A;  4F5G A;  4IXZ A;  4EB5 A;  2AY6 A;  2O1B A;  2VMX A;  4ISY A;  4CBR A;  4WYE A;  4JE5 D;  1IBJ A;  2E54 A;  2JJG A;  3ZZK A;  2R2N A;  3N4X A;  7AAT A;  5LHA A;  2VGU A;  4N0W A;  3CQ6 A;  1C0N A;  4Q31 A;  4O6Z A;  1D7U A;  4RJ0 A;  1W7N A;  3W1J A;  1WYT A;  2GSA A;  3GET A;  3N0L A;  4M2J A;  5HDM A;  1RV3 A;  3VK2 A;  1QJ3 A;  3D6K A;  2V0Y A;  4MQP A;  4WB0 B;  1DGD A;  4XQ2 A;  1B9H A;  4KYO A; 
#chains in the Genus database with same CATH homology
 3FFH A;  3K28 A;  2CJD A;  4OTL A;  4OBU A;  1T3I A;  2VLF A;  3AOV A;  3PDB B;  4PVF A;  4BQ0 A;  1I48 A;  2WB6 A;  2VMS A;  2A1V A;  3VK3 A;  1WST A;  1UU2 A;  1KKJ A;  2HUI A;  3JU7 A;  5FT6 A;  3UE8 A;  1PG8 A;  1ASF A;  4F5K A;  4EB7 A;  3AV7 A;  1M0O A;  4ZAS A;  4WLJ A;  1U08 A;  2OGA A;  3RCH A;  5G4I A;  3PD6 B;  5M49 A;  4WYA A;  5DJ1 A;  3LWS A;  1BKG A;  3HL2 A;  3OP7 A;  1LKC A;  1QGN A;  3EZ1 A;  4A0G A;  4JEY A;  4R2N A;  3E2Z A;  4XAU A;  1YOO A;  2OGE A;  1DJE A;  1AHY A;  2WK7 A;  3FQ8 A;  4GE4 A;  1KL1 A;  3FZ7 A;  3FVX A;  1QIT A;  4WYF A;  1J32 A;  1IUG A;  3WZF A;  1ASC A;  1LW5 A;  1SZS A;  2HZP A;  5FT4 A;  3A2B A;  4W8I A;  1AAM A;  4ZDL A;  3FCR A;  4RKD A;  5EIG B;  3FTB A;  3W1I A;  5EQC A;  1TOJ A;  4Y0D A;  1ASB A;  1XI9 A;  2VMY A;  2VIA A;  4WP0 A;  2GB3 A;  4A00 A;  1D7R A;  2QSR A;  4LW4 A;  4OC9 A;  1VJO A;  3DXW A;  3GSB A;  1OHW A;  5HHY A;  3RBF A;  2C44 A;  2VMQ A;  1ASE A;  3WKR A;  4W1X A;  2FNI A;  1AHG A;  3EZS A;  5C6U A;  4OT8 A;  2BWO A;  1QZ9 A;  2VGW A;  3K7Y A;  3BC8 A;  4R5Z A;  3QGU A;  4E3R A;  4ADE A;  3AAT A;  5JAY A;  1ARG A;  3BCA A;  2AY2 A;  2CH1 A;  1BJO B;  1ZOB A;  4JEX A;  1QJ5 A;  3W1H A;  4GDY A;  2YRR A;  5E4Z A;  3ZRQ A;  1B5O A;  4JEV A;  4ZSW A;  5D95 A;  2E7J A;  3F6T A;  1D7V A;  1WYU B;  4BA4 A;  1M0N A;  3II0 A;  3I16 A;  3ELE A;  2DGL A;  3E77 A;  2Z67 A;  1UU1 A;  3HQT A;  1S07 A;  3AOW A;  1SZU A;  1AY5 A;  3VP6 A;  1JG8 A;  1VEF A;  1XEY A;  5LH9 A;  2O7C A;  3EI9 A;  3R4T A;  3HDO A;  3L8A A;  3AEL A;  4AZK A;  4MY5 A;  4BMK A;  1LK9 A;  3MAF B;  2W7L A;  8AAT A;  3NRA A;  4MKJ A;  1B9I A;  3ASB A;  2FNU A;  3QBO A;  4XJO A;  3R9A A;  2HUU A;  2PB2 A;  1UU0 A;  5EFS A;  3A8U X;  3FD0 A;  4ZSY A;  1C7G A;  4CXR A;  2G7J A;  3B8X A;  4UHN A;  1SVV A;  1KMJ A;  2JG2 A;  4ITX A;  2XBN A;  3HMU A;  5G2Q A;  1I29 A;  3FKD A;  1OHV A;  2CB1 A;  4WYD A;  3KGX A;  2EGY A;  4ADD A;  1ARS A;  1B4X A;  3TFT A;  2AEV A;  2ZC0 A;  4A6R A;  1ECX A;  3EI6 A;  1S08 A;  3GZC A;  4RLG A;  4PIW A;  1YIY A;  4F5I A;  4XJP A;  3GR9 A;  2W8T A;  1G4X A;  2FKI A;  2EYQ A;  4R8D A;  1CZE A;  5BJ4 A;  1ELQ A;  4LNL A;  2E7U A;  4WXB A;  3I5T A;  4A0R A;  3EI7 A;  2BIG A;  2OQX A;  1TAR A;  1YJZ A;  3BN1 A;  2ZUK A;  2QB3 A;  3AEM A;  2BWP A;  4U2H A;  1KKP A;  1ASM A;  2QA3 A;  4OYT A;  2BKW A;  4IY7 A;  1IAY A;  4FL0 A;  4OBV A;  2QBT A;  1E5F A;  3BV0 A;  1WYT B;  3F0H A;  2BYL A;  2BI5 A;  2OKJ A;  4K05 A;  1KL2 A;  1MDX A;  4IYO A;  4MKK A;  5EUN A;  4ZLV A;  1CQ8 A;  4A72 A;  3N4S A;  3NX3 A;  5G2P A;  3NYS A;  1M32 A;  3MC6 C;  4W1W A;  1EG5 A;  3KKI A;  1PMM A;  2YRI A;  4KAM A;  2W7F A;  4QGR A;  4PFF A;  1CS1 A;  1AKA A;  4JE5 A;  2CY8 A;  1AKB A;  2BIE A;  5M4B A;  1MLY A;  2VLH A;  5BJ3 A;  1V2D A;  3GZD C;  1X28 A;  4E77 A;  1AHE A;  4IX8 A;  3TQX A;  1C4K A;  4HVK A;  1M4N A;  2BI1 A;  2PB0 A;  2CJG A;  3ZRR A;  2QMA A;  2X8U A;  1GC4 A;  4RM1 A;  2R0T A;  1BJN A;  3BWN C;  2D5Y A;  1S06 A;  5E5I A;  3H9X A;  4DQ6 A;  2D7Y A;  3LG0 A;  3LV2 A;  2VMN A;  4TN4 A;  1BJW A;  4DGT A;  4RAE A;  4WB0 A;  2VMT A;  2ZY4 A;  3DZZ A;  5FT8 A;  1TAT A;  3MBB A;  2FQ6 A;  2C7T A;  5KTB A;  1BT4 A;  3AEN B;  3PDB A;  4IXS A;  4TV7 A;  4XK1 A;  1DJU A;  2DGK A;  2R5E A;  3USF A;  1OAT A;  1C7O A;  3PPL A;  3VOM A;  4DBC A;  4KXK A;  5G4J A;  1FG7 A;  4AO9 A;  4ZAH A;  4JF0 A;  3N4R A;  3N5M A;  2ZJG A;  3QPG A;  4F5L A;  1MLZ A;  3FZ6 A;  4GEB A;  5G09 A;  4EMY A;  4B9B A;  1AIA A;  2Q7W A;  3ZZJ A;  2O0R A;  3BB8 A;  4E3Q A;  3DXV A;  1IVR A;  3FDB A;  2CJH A;  2VGT A;  1CL2 A;  1RVY A;  2YOB A;  2VMP A;  2CAN A;  1Z7D A;  3AEP A;  2YHK A;  3PIU A;  3MEB A;  4ADC A;  1IX8 A;  2BI9 A;  2BIA A;  5EAV A;  1UKJ A;  2YCT A;  2ZYJ A;  2WKA A;  4WYC A;  4A0H A;  1N8P A;  2ZY2 A;  1DKA A;  3Q8N A;  2X3L A;  4AO4 A;  2YKX A;  1QIS A;  4EFF A;  3NDN A;  1GD9 A;  2Z20 A;  1SZK A;  4J5U A;  3EUC A;  3PA9 A;  3E2F A;  2AY5 A;  2TPL A;  5DB5 A;  4MQR A;  2Z61 A;  3DC1 A;  3L44 A;  2W8W A;  2Z1Y A;  1AIB A;  2VMU A;  4RJY A;  3B1D A;  3F9T A;  3NTJ A;  3DR4 A;  3FZ8 A;  4WXF A;  4UHO A;  3I4J A;  2R5C B;  3EIA A;  4ZDO A;  1AMS A;  1BQA A;  3E6G A;  4H63 Q;  1IJI A;  1S09 A;  3FVS A;  3AEJ C;  2NMP A;  2Z9U A;  2X5F A;  1WKH A;  3ISL A;  5G0A A;  1O4S A;  4WD2 A;  1BJO A;  2W8U A;  4M2M A;  3NUI A;  3A9X A;  2GMS A;  3A9Z A;  3NNK A;  3JWB A;  4XJL A;  1C7N A;  1AMR A;  2FM1 A;  1Z3Z A;  1AJS B;  4IXO A;  2W7K A;  2JJH A;  3NU7 A;  1TOE A;  1AIC A;  4AOA A;  4BHD A;  2D63 A;  4PFN A;  1ASN A;  1WYV B;  4IW7 A;  3ATH A;  1ORD A;  2VMZ A;  2W7D A;  5HXX A;  3LVK A;  1ELU A;  1JF9 A;  2EO5 A;  1N2T A;  3PGY A;  2ORD A;  3ACZ A;  4UQV A;  4F5J A;  1LC8 A;  1CQ6 A;  3COG A;  3M5U A;  2W8J A;  4ITG A;  2AY1 A;  1OHY A;  3NYT A;  3FRK A;  5F8V A;  2HOZ A;  1LW4 A;  1VP4 A;  3N75 A;  4RIZ A;  1GC0 A;  3MAF A;  3GJU A;  1EJI A;  4B98 A;  2Z9V A;  4F4E A;  3BS8 A;  1M7Y A;  1AMQ A;  3IHJ A;  3CQ4 A;  1W3U A;  2W7I A;  4CBS A;  1BW0 A;  1RVU A;  4WYG A;  2D66 A;  2FYF A;  1E5E A;  4P7Y A;  3FSL A;  4CVQ A;  3ZRP A;  4Q76 A;  1DFO A;  4ZM4 A;  3FQA A;  2ZY5 A;  4OCA A;  1I43 A;  3PJ0 A;  1M0P A;  1O61 A;  1KMK A;  2DKB A;  2VMR A;  1YIZ A;  4F5F A;  4OMA A;  1TOI A;  2D64 A;  3CBF A;  4P3M A;  4LNJ A;  4LC3 A;  3B1E A;  1TOG A;  1GEX A;  4WBT A;  4WLH A;  4ZWM A;  1J04 A;  2VMW A;  1H1C A;  2BYJ A;  3ASA A;  2RFV A;  3WGC A;  1CQ7 A;  2W7J A;  2HOY A;  4W91 A;  1ASD A;  2X5D A;  1X0M A;  3FQ7 A;  1DTY A;  3GWP A;  3G0T A;  1ASL A;  1H0C A;  3ECD A;  5J8Q A;  1X29 A;  2AY8 A;  2W7G A;  1BS0 A;  4UOY A;  4GSA A;  3CQ5 A;  3H7F A;  2HOX A;  3RBL A;  3P1T A;  2EZ1 A;  1S0A A;  2DOU A;  3RCH B;  3OKS A;  1AHF A;  2AY7 A;  1G4V A;  3E9K A;  2BWN A;  5M4D A;  1DJ9 A;  1BQD A;  2AY9 A;  2PO3 A;  2ZP7 A;  5K8B A;  3LVJ A;  3E2Z B;  3RQ1 A;  1IX6 A;  3JTX A;  4XEW A;  2GQN A;  3FDD A;  2VI8 A;  2E7I A;  2XH1 A;  1AKC A;  3DR7 A;  4HF8 A;  2WK9 A;  4JF1 A;  2CST A;  3UWC A;  4F5H A;  1I41 A;  1MDZ A;  4K2I A;  2D65 A;  3PDX A;  1QIR A;  3JW9 A;  5EUD A;  3DOD A;  4JEW A;  3WCO A;  5F9S A;  1ASG A;  3EIB A;  5M46 A;  2VIB A;  3MAU A;  1DGE A;  1W7M A;  1ZC9 A;  3QM2 A;  4XJM A;  2ZY3 A;  2FN6 A;  2W8V A;  2W7E A;  3A9Y A;  1C9C A;  2F8J A;  2CTZ A;  4ATP A;  3E2Y A;  3PD6 A;  3ELP A;  1YJY A;  2HP2 A;  4GE7 A;  4AH3 A;  3VAX A;  4UHM A;  2VGZ A;  1LC7 A;  2VMV A;  4EU1 A;  5IWQ A;  2HOR A;  2BI2 A;  4CXQ A;  1MAQ A;  3AEN A;  3MC6 A;  4I8A A;  4RIT A;  3HBX A;  1TPL A;  3WX9 A;  1W7L A;  1AY8 A;  1AJR A;  2JGT A;  5EUE A;  4BA5 A;  1IAX A;  1AY4 A;  4MQQ A;  4E1O A;  1PFF A;  3NYU A;  1SF2 A;  4K2B A;  3BWO A;  1D2F A;  3HT4 A;  4L0O A;  2CFB A;  2AEU A;  2JIS A;  4LNM A;  3GZD A;  3KGW A;  1SFF A;  2HP1 A;  2V1P A;  3FVU A;  2DKJ A;  2W7M A;  1ARH A;  1TAS A;  2VGS A;  2Z9X A;  3B46 A;  2ZSL A;  2OKK A;  5DJ9 A;  5EIG A;  2EH6 A;  1CJ0 A;  3TAT A;  3WGB A;  1X2A A;  1CZC A;  3NU8 A;  2W7H A;  1B5P A;  3G7Q A;  2KFP A;  3BWN A;  4W5K A;  4ZDP A;  1GC2 A;  4GRX A;  1GEY A;  5FT5 A;  3DU4 A;  1GEW A;  1RV4 A;  3K40 A;  3LY1 A;  2D61 A;  4NOG A;  1WKG A;  3VK4 A;  1MAP A;  1G7W A;  2C81 A;  4TMR A;  2CIN A;  2QLR A;  4MSO A;  3LVL B;  1BJ4 A;  3RI6 A;  3NUB A;  1M6S A;  4M2K A;  1TOK A;  2G6W A;  3DYD A;  3KE3 A;  3P6K A;  1ASA A;  1LS3 A;  4Q75 A;  4U1T A;  4A6U A;  3AEO A;  3WLX A;  4ZWV A;  1AAW A;  2EPJ A;  1MDO A;  1N31 A;  2ZSM A;  1LC5 A;  3H14 A;  4WXG A;  5EAA A;  2VYC A;  2D7Z A;  2YKU A;  1AX4 A;  3AEM C;  1IX7 A;  1WYU A;  1Y4I A;  3RUY A;  4Q6R A;  1CL1 A;  3FFR A;  2VMO A;  3BCX A;  2OAT A;  3QI6 A;  1SPA A;  2R5C A;  4A6T A;  1AHX A;  1OXP A;  5D5S A;  5DX5 A;  2BHX A;  4N0B A;  2AY4 A;  3TCM A;  1ZOD A;  4MGR A;  1YAA A;  2YCN A;  2Z9W A;  2HUF A;  4Y0H A;  3BCB A;  1V2E A;  1PMO A;  2AAT A;  2GMU A;  5TF5 A;  4ATQ A;  1FG3 A;  1GDE A;  1D7S A;  2DGM A;  3G8M A;  3WCN A;  3GBX A;  3DRD A;  1OXO A;  4ZM3 A;  2JJF A;  2VI9 A;  2WK8 A;  4K2M A;  1JS3 A;  1V72 A;  1AJS A;  2DR1 A;  4Y0I A;  4J8L A;  1FC4 A;  1MGV A;  2EZ2 A;  3MAD A;  3QHX A;  3WY7 A;  9AAT A;  2CH2 A;  4GE9 A;  1WYV A;  5I92 A;  2AY3 A;  3CAI A;  3B1C A;  5E3K A;  1B8G A;  2YKV A;  1GCK A;  3PAA A;  4FFC A;  4F5M A;  1AMA A;  2QB2 A;  3HLM A;  5AX8 A;  1W23 A;  1YJS A;  1GC3 A;  1YNU A;  3EI8 A;  2Z1Z A;  3MKJ A;  1O62 A;  3JWA A;  4W1V A;  1V2F A;  3LVM A;  4R5F A;  3T32 A;  1EQB A;  4IYO B;  3UAK A;  1M0Q A;  4RKC A;  3AEJ A;  2VGV A;  2BI3 A;  3IF2 A;  3N7N A;  4LW2 A;  3JZL A;  3HVY A;  3TFU A;  2YCP A;  1G7X A;  1GBN A;  1JS6 A;  3EI5 A;  4JEZ A;  3WKS A;  2JJE A;  1O69 A;  3QN6 A;  4A0F A;  2YKY A;  1ART A;  2C0R A;  4AZJ A;  4ADB A;  4H51 A;  1ARI A;  1P3W A;  4F5G A;  4IXZ A;  4EB5 A;  2AY6 A;  2O1B A;  2VMX A;  4ISY A;  4CBR A;  4WYE A;  4JE5 D;  1IBJ A;  2E54 A;  2JJG A;  3ZZK A;  2R2N A;  3N4X A;  7AAT A;  5LHA A;  2VGU A;  4N0W A;  3CQ6 A;  1C0N A;  4Q31 A;  4O6Z A;  1D7U A;  4RJ0 A;  1W7N A;  3W1J A;  1WYT A;  2GSA A;  3GET A;  3N0L A;  4M2J A;  5HDM A;  1RV3 A;  3VK2 A;  1QJ3 A;  3D6K A;  2V0Y A;  4MQP A;  4WB0 B;  1DGD A;  4XQ2 A;  1B9H A;  4KYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...