5HY2A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
378
structure length
337
Chain Sequence
ARYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALCWSNDASALGVAVALGEVKRDLLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNSGPPGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 96
structure length 337
sequence length 378
chains with identical sequence B
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy2A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy2A01
5HY0A 5HY1A 5HXZA 4BVSA 5HWEA 5HXUA 5HY2A 4BVRA 4BVQA 4NQ3A 4BVTA 5HY4A
chains in the Genus database with same CATH superfamily
2Q1XA 3WPXA 3K0TA 2VGMA 5HXUA 1S72F 3EORA 2HVYD 2ZODA 5G4VC 4LNUA 4TV9B 3RYHB 3P4EA 3S0WA 5HY4A 3VIUA 3J7AR 3CC2F 1YJ9F 3JALA 2OZBA 2UYJA 1COMA 1DT9A 3E1YA 4BY9D 5J2TA 1VQVA 4NWOB 5KMGA 4G4YA 5LP6A 1VQ9F 3NK7A 5JH7B 5ITZB 1W59A 1IV4A 1KD1H 5CB4B 4ZHVA 4YJ2A 2JNBA 3RA5A 1GZ0A 2UYNA 5LOVB 1SDSA 2FGYA 2VGNA 1UFYA 3N4ZA 2OTJF 1T0AA 1XV2A 4RQOA 5CA0B 4TUYB 4ZOLA 1W581 3JAKB 2LBWA 4ZHWA 3S0HA 5MN6A 1YI2F 2HP0A 3JARB 1IPAA 3SIVA 2HP3A 2QA4F 3CPWF 3L7QA 5EYPA 1X7OA 2BTOA 5FJ4C 3M1XA 4ZHYB 3F0FA 1QD9A 4I55A 3J80M 3F0DA 4C8EA 1H7MA 2CZWA 5JCOA 5JQGA 3JVHA 5EZYA 5LXTA 3M84A 2FC3A 1RA4A 3N2GB 4I50A 1ZWZA 5DCVA 1H47A 3LWOC 1RLUA 1JY8A 4O4IB 2Z1EA 3P10A 3IEQA 4B5CA 1VQMF 3PAFA 1YQNA 5JVDA 2GVIA 4X1IB 1ONIA 3TD4A 1VQPF 3KIZA 4O4HB 3CCMF 2H8CA 2KTUA 1JN1A 5KX5A 4BT6A 5GINC 4DRXA 4G88A 1W5AA 2HQSC 3WGKA 1SA0A 3FPIA 3I7TA 3CCSF 1KC8H 5MN4A 1TVKB 2G9IA 4IHJA 3HKCA 4I4TA 4PWTA 3K14A 3HKDA 4WBNA 3RYIB 3JCMM 3FFMA 3IKEA 2PHNA 3JATB 5KMGB 1RLGA 1W5FA 3CMAF 2AIFA 3OBWA 2HS3A 3KJKA 3WGJA 3NVKE 4B45A 3CMEF 2VXYA 1JFFA 3QHDA 2VAWA 4DXDA 3RA6A 2YXZA 2UYNB 2KG4A 3C9SA 1TUBA 1U3LA 4O4JA 3UT5B 2ZVYA 3JAWA 3VYUC 2QI2A 4KWEA 5HXZA 4ZOLB 1M90H 3IR9A 3GTZA 3VYTC 3WGNA 5LYJB 2R6R1 1K8AH 3VI6A 2KTVA 4IIJB 5EO3A 3WGMA 4EB6A 3I56F 5HP7A 5EYPB 2H8EA 1OAPA 1YJNF 4RHAA 4FFBA 4B46A 3CCUF 3WJPA 4X20A 5C8YA 4I55B 3CD6F 1VHAA 3R0PA 3LWVC 3WPWA 4X1YA 1VQOF 5HY1A 2OTLF 1E7KA 2Q1YA 1FNJA 3ZP4A 3IEWA 1U40A 2OHWA 3NK6A 3CCRF 2B33A 2H6LA 3I55F 5JCOC 3LWRC 5GIOC 1Q86H 3S0YA 4X1KA 4G4XA 5JVDB 5BMVA 3LWQC 2OTMA 3WJQA 1FNKA 4TV8A 5EAZA 2HRYA 2RHJA 2WALA 3D54A 1Q82H 4X3MA 4ZI7B 3QTYA 5A2QM 2QTPA 3RYCA 1CN7A 3CCLF 3E22B 2LCAA 3VOAA 3ZP7A 1YIJF 4ZHQB 1QVGF 2ZOVA 3K2XA 5IJ9A 3K12A 1W5BA 1IV2A 3MDOA 5GONA 3RYFB 1GO1A 3HKBB 5J2UA 3HTNA 4HNAA 5GANK 5FLXM 3PLAC 2KGWA 2AMTA 3CPQA 4C81A 2EWCA 3IKFA 2CW4A 1JFFB 1W57A 1Q7YH 4BT3A 1IV1A 5LA6B 3U0OA 5HY2A 3N2KB 4O2AA 1CLIA 1RQ7A 1W40A 4O4JB 5EB1B 3ESJA 5GAPK 1KQSF 5CA1B 2HRUA 1X7PA 2VAMA 3JAMM 1VH8A 3C9UA 4G4WA 1Q81H 3MQWA 4YJ3A 2I6DA 1KNJA 5IYZB 1J7HA 5EIBD 2I6RA 4EB6B 3VYSC 3HWUA 2GLZA 1KNKA 3G6EF 4TV9A 3RYHA 2HS4A 3GYQA 5EWRA 4BVQA 1W42A 4X1YB 1YGYA 1IV3A 4LNUB 2DYYA 1VQLF 4EI7A 3JALB 3P0ZA 2ZVZA 3CC4F 2P6YA 5J2TB 2MQEA 4TZZA 1W3EX 3CCVF 3KHNA 2W8BC 3CG6A 4ERHA 4R40B 3NVIB 4BVSA 5LP6B 3SIUA 5CB4A 3QUWA 1YHQF 4C8IA 4G4ZA 3CYPB 2V9YA 1JJ2F 3VOBA 2NMUA 3AGKA 5LOVA 1CK2A 3BYQA 4YJ2B 3OW2F 3O85A 4TV8B 3VO8A 3F6MA 5LP6C 5CA0A 1U43A 1RQ2A 4TUYA 2QEXF 3JAKA 1OFUA 4BT4A 1VQ7F 3JARA 1NQ3A 2R751 3M4SA 1UI9A 3LFOA 1T0KB 5IJ9B 3IMPA 4EI9A 1N8RH 3OBYA 2HP0B 2VAPA 2Z1UA 1NJIH 3TD3A 2ZAUA 1VQ8F 3KE1A 2YYEA 3G71F 3T80A 2BTUA 2IQQA 5IJ0A 3B6NA 5JQGB 2PMPA 5EZYB 5LXTB 2ZF8A 3FD5A 3LYBA 4O4IA 3I3FA 3DC2A 4I50B 2CSLA 4NUTA 4O2AB 2LBXA 3TD5A 3N4YA 4X1IA 2AIZP 1X52A 4BVRA 4C82A 2Z01A 4O4HA 3MCAB 5GIPC 2LBTA 1XRGA 3CYQA 4BT2A 2GZLA 1FFXA 1VQKF 3JASA 5KX5B 1TVKA 3C9RA 2IG8A 4DRXB 1X25A 1H48A 4F6RA 1SA0B 4B62A 2ALEA 3RYIA 4IHJB 4E6EA 1YITF 3HKCB 4U3JA 3OONA 4ZK7A 3ZOPA 4I4TB 2UYPA 3JATA 5EIBC 3HJWC 4M8IA 3HKDB 4WBNB 4NQ3A 1K9MH 3CXCF 5HWEA 2Z1FA 3KJJA 3J81M 1M1KH 4C4WC 1QAHA 4G4VA 1PXWA 3HKEA 3F0GA 2RHLA 1U3PA 3FBAA 1Z5VA 3D01A 3C9TA 2CWJA 5HP8A 4BT7A 4O4LA 2UZHA 3UT5A 3LWPC 1JD1A 3ELCA 1VQ5F 1R1MA 3HAXD 5IT9M 5FNVA 1TUBB 5LYJA 1NMUB 1W2BF 5B8FA 3JAWB 4IIJA 3GHZA 1Z5WA 2RHOA 3WXMB 4O2BA 1GX1A 1W41A 3VTIC 3ERNA 3CCJF 3C8LA 1VQ6F 3D00A 1VK3A 3Q8HA 4FFBB 2UYKA 3CCEF 4X20B 3V3TA 5C8YB 4XCQA 5IJ0B 3V7QA 4C8GA 2DT4A 1QU9A 1W5EA 3F0EA 4LCKA 1PF5A 3CCQF 5JH7A 5ITZA 2K1SA 4X1KB 2HX0A 1K73H 5BMVB 2CHTA 3LDTA 3MCQA 2L26A 1FFXB 3S06A 3V7EA 5EB0A 4ZI7A 3JASB 5HY0A 3E22A 3WJRA 4F6RB 4ZHQA 2RHHA 1W55A 3RYCB 2CHSA 3RYFA 3VMFB 2BTQB 4U3JB 3NMUC 3FD6A 2F9ZC 3S03A 1DBFA 3HKBA 5AVMA 3DDNA 4BW0B 3MBMA 1Q8RA 1GO0A 2BO1A 3V4DA 3S02A 5GONB 1SZQA 1QVFF 3CB2A 5J2UB 2Z1TA 1VQNF 1ODEA 4U39A 3RE3A 2RB9A 3ZO8A 2HS0A 4HNAB 3HKEB 5LA6A 4BT5A 4EI8A 3N2GA 4BVTA 3N2KA 4O4LB 3WGLA 3LMEA 3G4SF 1YJWF 5CA1A 3CC7F 5FNVB 2N48A 3ON1A 4X3LA 5IYZA 1XBIA 3VCZA 1FSZA 2IAFA 1XHOA 2CVLA 1VQ4F 3E20B 5G4UC 4YJ3B 4O2BB 5MN5A
chains in the Genus database with same CATH topology
2GLZA 3CMEF 3G6EF 5HXUA 2VGMA 1S72F 2HVYD 3GYQA 5G4VC 5EWRA 4BVQA 3J7AR 5HY4A 3RA6A 3CC2F 1W42A 1YJ9F 2OZBA 2KG4A 1VQLF 3LWPC 4BY9D 1DT9A 3E1YA 4EI7A 1VQ5F 3HAXD 5IT9M 3CC4F 1NMUB 2QI2A 5HXZA 1W2BF 1M90H 3IR9A 4TZZA 1W3EX 3CCVF 1K8AH 3CG6A 3VI6A 2KTVA 1VQ9F 5EO3A 3NVIB 4BVSA 3SIUA 3WXMB 3I56F 1YHQF 3NK7A 1W41A 3CCJF 1JJ2F 1YJNF 1KD1H 3CCUF 2JNBA 3RA5A 1GZ0A 3D00A 3AGKA 1VQ6F 3CD6F 1CK2A 3OW2F 3O85A 3LWVC 3CCEF 3V3TA 1VQOF 4XCQA 5HY1A 1SDSA 2OTLF 1E7KA 2FGYA 2VGNA 3V7QA 3N4ZA 2OTJF 2QEXF 2OHWA 3NK6A 1VQ7F 3CCRF 2LBWA 3I55F 3LFOA 3LWRC 5GIOC 1YI2F 1T0KB 1IPAA 1Q86H 3SIVA 4EI9A 4LCKA 1N8RH 3OBYA 3CPWF 2QA4F 3CCQF 1X7OA 5FJ4C 1NJIH 1K73H 3LWQC 1VQ8F 3J80M 3G71F 1H7MA 2CZWA 3V7EA 2WALA 1Q82H 2FC3A 1RA4A 4X3MA 5HY0A 5A2QM 1ZWZA 5DCVA 1CN7A 3CCLF 1YIJF 3LWOC 4NUTA 2LBXA 1QVGF 3N4YA 3VMFB 1VQMF 3NMUC 1X52A 4BVRA 3PAFA 2F9ZC 4BW0B 3MCAB 1GO0A 2BO1A 1VQPF 3CCMF 1GO1A 5GIPC 2KTUA 1QVFF 5GANK 5GINC 1VQKF 1VQNF 5FLXM 3PLAC 3CPQA 4EI8A 3CCSF 1KC8H 4BVTA 1Q7YH 3G4SF 2ALEA 5HY2A 1YJWF 1YITF 1W40A 5GAPK 3JCMM 1KQSF 3CC7F 3HJWC 3ON1A 3FFMA 1X7PA 4X3LA 1XBIA 4NQ3A 1K9MH 3CXCF 3JAMM 1RLGA 3CMAF 2AIFA 1Q81H 5HWEA 2I6DA 3OBWA 3J81M 1M1KH 3E20B 1VQ4F 3NVKE 5G4UC 4C4WC 1PXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HY0 A;  5HY1 A;  5HXZ A;  4BVS A;  5HWE A;  5HXU A;  5HY2 A;  4BVR A;  4BVQ A;  4NQ3 A;  4BVT A;  5HY4 A; 
#chains in the Genus database with same CATH topology
 2Q1X A;  3WPX A;  3K0T A;  2VGM A;  5HXU A;  1S72 F;  3EOR A;  2HVY D;  2ZOD A;  5G4V C;  4LNU A;  4TV9 B;  3RYH B;  3P4E A;  3S0W A;  5HY4 A;  3VIU A;  3J7A R;  3CC2 F;  1YJ9 F;  3JAL A;  2OZB A;  2UYJ A;  1COM A;  1DT9 A;  3E1Y A;  4BY9 D;  5J2T A;  1VQV A;  4NWO B;  5KMG A;  4G4Y A;  5LP6 A;  1VQ9 F;  3NK7 A;  5JH7 B;  5ITZ B;  1W59 A;  1IV4 A;  1KD1 H;  5CB4 B;  4ZHV A;  4YJ2 A;  2JNB A;  3RA5 A;  1GZ0 A;  2UYN A;  5LOV B;  1SDS A;  2FGY A;  2VGN A;  1UFY A;  3N4Z A;  2OTJ F;  1T0A A;  1XV2 A;  4RQO A;  5CA0 B;  4TUY B;  4ZOL A;  1W58 1;  3JAK B;  2LBW A;  4ZHW A;  3S0H A;  5MN6 A;  1YI2 F;  2HP0 A;  3JAR B;  1IPA A;  3SIV A;  2HP3 A;  2QA4 F;  3CPW F;  3L7Q A;  5EYP A;  1X7O A;  2BTO A;  5FJ4 C;  3M1X A;  4ZHY B;  3F0F A;  1QD9 A;  4I55 A;  3J80 M;  3F0D A;  4C8E A;  1H7M A;  2CZW A;  5JCO A;  5JQG A;  3JVH A;  5EZY A;  5LXT A;  3M84 A;  2FC3 A;  1RA4 A;  3N2G B;  4I50 A;  1ZWZ A;  5DCV A;  1H47 A;  3LWO C;  1RLU A;  1JY8 A;  4O4I B;  2Z1E A;  3P10 A;  3IEQ A;  4B5C A;  1VQM F;  3PAF A;  1YQN A;  5JVD A;  2GVI A;  4X1I B;  1ONI A;  3TD4 A;  1VQP F;  3KIZ A;  4O4H B;  3CCM F;  2H8C A;  2KTU A;  1JN1 A;  5KX5 A;  4BT6 A;  5GIN C;  4DRX A;  4G88 A;  1W5A A;  2HQS C;  3WGK A;  1SA0 A;  3FPI A;  3I7T A;  3CCS F;  1KC8 H;  5MN4 A;  1TVK B;  2G9I A;  4IHJ A;  3HKC A;  4I4T A;  4PWT A;  3K14 A;  3HKD A;  4WBN A;  3RYI B;  3JCM M;  3FFM A;  3IKE A;  2PHN A;  3JAT B;  5KMG B;  1RLG A;  1W5F A;  3CMA F;  2AIF A;  3OBW A;  2HS3 A;  3KJK A;  3WGJ A;  3NVK E;  4B45 A;  3CME F;  2VXY A;  1JFF A;  3QHD A;  2VAW A;  4DXD A;  3RA6 A;  2YXZ A;  2UYN B;  2KG4 A;  3C9S A;  1TUB A;  1U3L A;  4O4J A;  3UT5 B;  2ZVY A;  3JAW A;  3VYU C;  2QI2 A;  4KWE A;  5HXZ A;  4ZOL B;  1M90 H;  3IR9 A;  3GTZ A;  3VYT C;  3WGN A;  5LYJ B;  2R6R 1;  1K8A H;  3VI6 A;  2KTV A;  4IIJ B;  5EO3 A;  3WGM A;  4EB6 A;  3I56 F;  5HP7 A;  5EYP B;  2H8E A;  1OAP A;  1YJN F;  4RHA A;  4FFB A;  4B46 A;  3CCU F;  3WJP A;  4X20 A;  5C8Y A;  4I55 B;  3CD6 F;  1VHA A;  3R0P A;  3LWV C;  3WPW A;  4X1Y A;  1VQO F;  5HY1 A;  2OTL F;  1E7K A;  2Q1Y A;  1FNJ A;  3ZP4 A;  3IEW A;  1U40 A;  2OHW A;  3NK6 A;  3CCR F;  2B33 A;  2H6L A;  3I55 F;  5JCO C;  3LWR C;  5GIO C;  1Q86 H;  3S0Y A;  4X1K A;  4G4X A;  5JVD B;  5BMV A;  3LWQ C;  2OTM A;  3WJQ A;  1FNK A;  4TV8 A;  5EAZ A;  2HRY A;  2RHJ A;  2WAL A;  3D54 A;  1Q82 H;  4X3M A;  4ZI7 B;  3QTY A;  5A2Q M;  2QTP A;  3RYC A;  1CN7 A;  3CCL F;  3E22 B;  2LCA A;  3VOA A;  3ZP7 A;  1YIJ F;  4ZHQ B;  1QVG F;  2ZOV A;  3K2X A;  5IJ9 A;  3K12 A;  1W5B A;  1IV2 A;  3MDO A;  5GON A;  3RYF B;  1GO1 A;  3HKB B;  5J2U A;  3HTN A;  4HNA A;  5GAN K;  5FLX M;  3PLA C;  2KGW A;  2AMT A;  3CPQ A;  4C81 A;  2EWC A;  3IKF A;  2CW4 A;  1JFF B;  1W57 A;  1Q7Y H;  4BT3 A;  1IV1 A;  5LA6 B;  3U0O A;  5HY2 A;  3N2K B;  4O2A A;  1CLI A;  1RQ7 A;  1W40 A;  4O4J B;  5EB1 B;  3ESJ A;  5GAP K;  1KQS F;  5CA1 B;  2HRU A;  1X7P A;  2VAM A;  3JAM M;  1VH8 A;  3C9U A;  4G4W A;  1Q81 H;  3MQW A;  4YJ3 A;  2I6D A;  1KNJ A;  5IYZ B;  1J7H A;  5EIB D;  2I6R A;  4EB6 B;  3VYS C;  3HWU A;  2GLZ A;  1KNK A;  3G6E F;  4TV9 A;  3RYH A;  2HS4 A;  3GYQ A;  5EWR A;  4BVQ A;  1W42 A;  4X1Y B;  1YGY A;  1IV3 A;  4LNU B;  2DYY A;  1VQL F;  4EI7 A;  3JAL B;  3P0Z A;  2ZVZ A;  3CC4 F;  2P6Y A;  5J2T B;  2MQE A;  4TZZ A;  1W3E X;  3CCV F;  3KHN A;  2W8B C;  3CG6 A;  4ERH A;  4R40 B;  3NVI B;  4BVS A;  5LP6 B;  3SIU A;  5CB4 A;  3QUW A;  1YHQ F;  4C8I A;  4G4Z A;  3CYP B;  2V9Y A;  1JJ2 F;  3VOB A;  2NMU A;  3AGK A;  5LOV A;  1CK2 A;  3BYQ A;  4YJ2 B;  3OW2 F;  3O85 A;  4TV8 B;  3VO8 A;  3F6M A;  5LP6 C;  5CA0 A;  1U43 A;  1RQ2 A;  4TUY A;  2QEX F;  3JAK A;  1OFU A;  4BT4 A;  1VQ7 F;  3JAR A;  1NQ3 A;  2R75 1;  3M4S A;  1UI9 A;  3LFO A;  1T0K B;  5IJ9 B;  3IMP A;  4EI9 A;  1N8R H;  3OBY A;  2HP0 B;  2VAP A;  2Z1U A;  1NJI H;  3TD3 A;  2ZAU A;  1VQ8 F;  3KE1 A;  2YYE A;  3G71 F;  3T80 A;  2BTU A;  2IQQ A;  5IJ0 A;  3B6N A;  5JQG B;  2PMP A;  5EZY B;  5LXT B;  2ZF8 A;  3FD5 A;  3LYB A;  4O4I A;  3I3F A;  3DC2 A;  4I50 B;  2CSL A;  4NUT A;  4O2A B;  2LBX A;  3TD5 A;  3N4Y A;  4X1I A;  2AIZ P;  1X52 A;  4BVR A;  4C82 A;  2Z01 A;  4O4H A;  3MCA B;  5GIP C;  2LBT A;  1XRG A;  3CYQ A;  4BT2 A;  2GZL A;  1FFX A;  1VQK F;  3JAS A;  5KX5 B;  1TVK A;  3C9R A;  2IG8 A;  4DRX B;  1X25 A;  1H48 A;  4F6R A;  1SA0 B;  4B62 A;  2ALE A;  3RYI A;  4IHJ B;  4E6E A;  1YIT F;  3HKC B;  4U3J A;  3OON A;  4ZK7 A;  3ZOP A;  4I4T B;  2UYP A;  3JAT A;  5EIB C;  3HJW C;  4M8I A;  3HKD B;  4WBN B;  4NQ3 A;  1K9M H;  3CXC F;  5HWE A;  2Z1F A;  3KJJ A;  3J81 M;  1M1K H;  4C4W C;  1QAH A;  4G4V A;  1PXW A;  3HKE A;  3F0G A;  2RHL A;  1U3P A;  3FBA A;  1Z5V A;  3D01 A;  3C9T A;  2CWJ A;  5HP8 A;  4BT7 A;  4O4L A;  2UZH A;  3UT5 A;  3LWP C;  1JD1 A;  3ELC A;  1VQ5 F;  1R1M A;  3HAX D;  5IT9 M;  5FNV A;  1TUB B;  5LYJ A;  1NMU B;  1W2B F;  5B8F A;  3JAW B;  4IIJ A;  3GHZ A;  1Z5W A;  2RHO A;  3WXM B;  4O2B A;  1GX1 A;  1W41 A;  3VTI C;  3ERN A;  3CCJ F;  3C8L A;  1VQ6 F;  3D00 A;  1VK3 A;  3Q8H A;  4FFB B;  2UYK A;  3CCE F;  4X20 B;  3V3T A;  5C8Y B;  4XCQ A;  5IJ0 B;  3V7Q A;  4C8G A;  2DT4 A;  1QU9 A;  1W5E A;  3F0E A;  4LCK A;  1PF5 A;  3CCQ F;  5JH7 A;  5ITZ A;  2K1S A;  4X1K B;  2HX0 A;  1K73 H;  5BMV B;  2CHT A;  3LDT A;  3MCQ A;  2L26 A;  1FFX B;  3S06 A;  3V7E A;  5EB0 A;  4ZI7 A;  3JAS B;  5HY0 A;  3E22 A;  3WJR A;  4F6R B;  4ZHQ A;  2RHH A;  1W55 A;  3RYC B;  2CHS A;  3RYF A;  3VMF B;  2BTQ B;  4U3J B;  3NMU C;  3FD6 A;  2F9Z C;  3S03 A;  1DBF A;  3HKB A;  5AVM A;  3DDN A;  4BW0 B;  3MBM A;  1Q8R A;  1GO0 A;  2BO1 A;  3V4D A;  3S02 A;  5GON B;  1SZQ A;  1QVF F;  3CB2 A;  5J2U B;  2Z1T A;  1VQN F;  1ODE A;  4U39 A;  3RE3 A;  2RB9 A;  3ZO8 A;  2HS0 A;  4HNA B;  3HKE B;  5LA6 A;  4BT5 A;  4EI8 A;  3N2G A;  4BVT A;  3N2K A;  4O4L B;  3WGL A;  3LME A;  3G4S F;  1YJW F;  5CA1 A;  3CC7 F;  5FNV B;  2N48 A;  3ON1 A;  4X3L A;  5IYZ A;  1XBI A;  3VCZ A;  1FSZ A;  2IAF A;  1XHO A;  2CVL A;  1VQ4 F;  3E20 B;  5G4U C;  4YJ3 B;  4O2B B;  5MN5 A; 
#chains in the Genus database with same CATH homology
 2GLZ A;  3CME F;  3G6E F;  5HXU A;  2VGM A;  1S72 F;  2HVY D;  3GYQ A;  5G4V C;  5EWR A;  4BVQ A;  3J7A R;  5HY4 A;  3RA6 A;  3CC2 F;  1W42 A;  1YJ9 F;  2OZB A;  2KG4 A;  1VQL F;  3LWP C;  4BY9 D;  1DT9 A;  3E1Y A;  4EI7 A;  1VQ5 F;  3HAX D;  5IT9 M;  3CC4 F;  1NMU B;  2QI2 A;  5HXZ A;  1W2B F;  1M90 H;  3IR9 A;  4TZZ A;  1W3E X;  3CCV F;  1K8A H;  3CG6 A;  3VI6 A;  2KTV A;  1VQ9 F;  5EO3 A;  3NVI B;  4BVS A;  3SIU A;  3WXM B;  3I56 F;  1YHQ F;  3NK7 A;  1W41 A;  3CCJ F;  1JJ2 F;  1YJN F;  1KD1 H;  3CCU F;  2JNB A;  3RA5 A;  1GZ0 A;  3D00 A;  3AGK A;  1VQ6 F;  3CD6 F;  1CK2 A;  3OW2 F;  3O85 A;  3LWV C;  3CCE F;  3V3T A;  1VQO F;  4XCQ A;  5HY1 A;  1SDS A;  2OTL F;  1E7K A;  2FGY A;  2VGN A;  3V7Q A;  3N4Z A;  2OTJ F;  2QEX F;  2OHW A;  3NK6 A;  1VQ7 F;  3CCR F;  2LBW A;  3I55 F;  3LFO A;  3LWR C;  5GIO C;  1YI2 F;  1T0K B;  1IPA A;  1Q86 H;  3SIV A;  4EI9 A;  4LCK A;  1N8R H;  3OBY A;  3CPW F;  2QA4 F;  3CCQ F;  1X7O A;  5FJ4 C;  1NJI H;  1K73 H;  3LWQ C;  1VQ8 F;  3J80 M;  3G71 F;  1H7M A;  2CZW A;  3V7E A;  2WAL A;  1Q82 H;  2FC3 A;  1RA4 A;  4X3M A;  5HY0 A;  5A2Q M;  1ZWZ A;  5DCV A;  1CN7 A;  3CCL F;  1YIJ F;  3LWO C;  4NUT A;  2LBX A;  1QVG F;  3N4Y A;  3VMF B;  1VQM F;  3NMU C;  1X52 A;  4BVR A;  3PAF A;  2F9Z C;  4BW0 B;  3MCA B;  1GO0 A;  2BO1 A;  1VQP F;  3CCM F;  1GO1 A;  5GIP C;  2KTU A;  1QVF F;  5GAN K;  5GIN C;  1VQK F;  1VQN F;  5FLX M;  3PLA C;  3CPQ A;  4EI8 A;  3CCS F;  1KC8 H;  4BVT A;  1Q7Y H;  3G4S F;  2ALE A;  5HY2 A;  1YJW F;  1YIT F;  1W40 A;  5GAP K;  3JCM M;  1KQS F;  3CC7 F;  3HJW C;  3ON1 A;  3FFM A;  1X7P A;  4X3L A;  1XBI A;  4NQ3 A;  1K9M H;  3CXC F;  3JAM M;  1RLG A;  3CMA F;  2AIF A;  1Q81 H;  5HWE A;  2I6D A;  3OBW A;  3J81 M;  1M1K H;  3E20 B;  1VQ4 F;  3NVK E;  5G4U C;  4C4W C;  1PXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...