5HY2A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
378
structure length
337
Chain Sequence
ARYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALCWSNDASALGVAVALGEVKRDLLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNSGPPGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 96
structure length 337
sequence length 378
chains with identical sequence B
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy2A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy2A01
5HWEA 4BVSA 5HXZA 5HY0A 5HY4A 5HY1A 4BVRA 4NQ3A 4BVQA 5HXUA 5HY2A 4BVTA
chains in the Genus database with same CATH superfamily
3WJPA 1JJ2F 5MN4A 2R6R1 5HXZA 5IJ0B 5KMGB 1GO1A 1U40A 2YYEA 3HKEA 4BT7A 3CD6F 2KTUA 4C8GA 4EB6A 4B5CA 5LP6B 3S02A 2LBTA 1XV2A 3C9SA 3CYPB 5GONB 5IYZA 3G6EF 4O4IB 1VQNF 2DT4A 5G4VC 4IIJA 1VQ6F 3L7QA 3CCVF 4HNAA 5GANK 3P10A 1UI9A 1Q86H 5LXTB 1QVFF 3N2KB 3CCQF 4WBNA 3WGJA 4BT5A 3I56F 3CPQA 2HVYD 3K2XA 5EYPB 4RQOA 1W2BF 1VQOF 3MBMA 2RB9A 4O4JB 3NMUC 3WGNA 3WGLA 5IJ9A 1M90H 1W581 4ZK7A 5EB0A 3BYQA 3HKBA 1KNJA 2ZOVA 3CPWF 1JFFA 3RE3A 3JVHA 3HTNA 1COMA 3Q8HA 1IV3A 2RHOA 3CYQA 2RHLA 3M1XA 4NUTA 2CVLA 5B8FA 2Z1UA 3I3FA 2Q1XA 5EIBC 5IJ0A 5KMGA 5GIPC 5IT9M 1QAHA 2LBXA 4BVTA 2QTPA 3M4SA 2BTOA 3ELCA 5KX5B 5LP6A 1GZ0A 3SIVA 4O4LB 1W59A 2VXYA 3VOBA 5EWRA 5HP8A 4DXDA 1RLUA 1U3PA 4LNUB 4X1KB 4O4IA 3KE1A 4X1IB 4ZOLA 1YJNF 4BW0B 4C81A 1IV2A 1IV4A 1VQ4F 3WPWA 5C8YA 4U39A 3LWOC 4X20B 3E22B 5LXTA 3IMPA 3N2KA 4BT4A 2Q1YA 2HP0B 2H8EA 4TV8B 1H48A 4EI9A 3ZO8A 4XCQA 4O4JA 1W3EX 2GLZA 5LYJB 4I50B 3T80A 5EB1B 5A2QM 3CMEF 3D00A 1XRGA 3O85A 5GIOC 5JCOC 5JQGB 3UT5B 3MDOA 3NVIB 3F6MA 2OTJF 2EWCA 3B6NA 3HKCB 1X52A 4E6EA 5HY4A 3OW2F 2KTVA 2Z1TA 3F0EA 1VQVA 1CK2A 3K14A 5KX5A 3CCUF 3RYCB 5CA0B 4U3JA 4O4LA 3CMAF 2CHSA 3WJRA 4ERHA 3JAKA 1K73H 3FPIA 3FD6A 3JASA 3PAFA 2H6LA 3GYQA 4X1KA 3VYTC 4TUYB 3GTZA 1H47A 1K9MH 1OAPA 4X1IA 1YJWF 4ZHVA 2Z1FA 5EIBD 4C82A 1CN7A 2KGWA 3WGKA 3E22A 5CB4B 3VIUA 3CB2A 2ALEA 1Z5VA 3CXCF 1H7MA 2HP0A 3CCRF 3ZP7A 2FGYA 1RQ7A 1GO0A 2B33A 4G88A 3F0FA 4BT6A 5EZYB 2H8CA 4BT3A 2QA4F 5FNVA 2CW4A 1S72F 1SDSA 4I50A 2I6RA 2P6YA 1X7PA 2I6DA 5EAZA 1OFUA 1DBFA 3GHZA 1W5AA 5JVDB 2UYNB 1KC8H 1QVGF 1T0KB 5JQGA 1J7HA 4G4VA 3CG6A 5HXUA 3K12A 3OBYA 3HKCA 3NK6A 3P4EA 3IR9A 3J7AR 1YQNA 3N2GB 1RA4A 3CCSF 1Z5WA 2HS4A 3V4DA 4YJ2B 3QHDA 3V7QA 1CLIA 4O4HB 4I4TB 3WJQA 3VOAA 1TUBB 3RA5A 2IAFA 3RYCA 2WALA 5J2UA 3SIUA 3LWQC 2V9YA 4X3MA 1VQ5F 4TUYA 4IHJB 2CSLA 3FD5A 2NMUA 1VQ7F 1VQ9F 2FC3A 3R0PA 4TZZA 1U43A 4TV9B 4ZHYB 1M1KH 2RHHA 5ITZB 1FNJA 5J2TB 1Q82H 5CB4A 3RYFB 1FFXB 3WPXA 1IV1A 3OONA 5GINC 1VQPF 3N4ZA 1XHOA 4YJ3B 2GZLA 2HP3A 3LWRC 3KHNA 1Q81H 4FFBB 3FFMA 3JATB 4G4WA 5DCVA 2LCAA 3I7TA 2ZODA 5GONA 5JVDA 2OTLF 1RLGA 2ZF8A 4I55B 5EO3A 1IPAA 3RA6A 3PLAC 1YITF 3AGKA 2PHNA 3N2GA 2CZWA 3LYBA 2HRYA 3IEWA 1VQKF 4YJ2A 1PXWA 4O4HA 4I4TA 1FNKA 1GX1A 2AIZP 2CHTA 3TD3A 3M84A 4ZI7B 2RHJA 5EYPA 4BVQA 2DYYA 4O2BB 4ZHQB 3G71F 2UYPA 3IKFA 2VGNA 3F0DA 3QTYA 2IG8A 4IHJA 1KD1H 1SA0B 3RYHB 4B62A 3U0OA 5CA1B 1NQ3A 4TV9A 2W8BC 1U3LA 3HKDB 3ZP4A 3S0WA 3HWUA 5J2TA 3S0YA 4C8EA 4BY9D 1VK3A 5HP7A 1FFXA 2Z01A 2PMPA 2MQEA 3QUWA 1KNKA 1FSZA 4X1YB 2BO1A 5LOVB 1N8RH 5MN6A 5G4UC 3MCQA 4FFBA 1KQSF 3JATA 1E7KA 2N48A 3VO8A 3K0TA 3LMEA 2HS0A 2YXZA 4LNUA 5GAPK 4IIJB 3EORA 3VYSC 1W42A 2BTUA 3JCMM 1X7OA 2HS3A 2VGMA 3C9RA 2OZBA 4BT2A 5JCOA 4X20A 4WBNB 3JAWB 1YI2F 3HAXD 4TV8A 2KG4A 1PF5A 2R751 4ZI7A 3DC2A 4BVRA 4ZHQA 4PWTA 4O2BA 3IKEA 4ZHWA 5IJ9B 3JARB 5LYJA 3WGMA 3V3TA 5HY2A 3C9TA 3TD4A 1R1MA 1JY8A 5BMVB 3RYHA 4BVSA 3C9UA 5CA1A 3UT5A 2VAWA 3HKDA 4B45A 3IEQA 3WXMB 5MN5A 2ZVYA 4G4XA 4DRXB 1TVKB 3MCAB 3KJJA 4X1YA 3LWVC 2HRUA 5LOVA 5CA0A 3P0ZA 4C8IA 3I55F 3LWPC 4G4YA 5AVMA 3RYIB 2AMTA 2QEXF 4ZOLB 3TD5A 3KJKA 3CC2F 1DT9A 3S0HA 4NWOB 5C8YB 3MQWA 1W5EA 1QU9A 4KWEA 3VYUC 4EI7A 4F6RB 5FLXM 3JAWA 5LP6C 1VHAA 3ON1A 1W40A 4RHAA 3CCJF 1X25A 3J80M 3DDNA 2UYKA 3D01A 5LA6B 5EZYA 4O2AB 3S06A 1ZWZA 3JARA 1ODEA 2LBWA 4LCKA 4M8IA 3HJWC 4NQ3A 3NVKE 3E20B 5BMVA 2UYNA 5HWEA 4R40B 2HX0A 5HY0A 3CCLF 2OTMA 1NJIH 3VI6A 2Z1EA 3CCMF 4X3LA 2K1SA 3D54A 1UFYA 2G9IA 4DRXA 1TVKA 1JN1A 1YGYA 1YJ9F 1RQ2A 3ERNA 4U3JB 3F0GA 5FJ4C 1T0AA 1TUBA 1YIJF 3JAKB 1W55A 2OHWA 3VMFB 3VCZA 4C4WC 3JASB 2GVIA 3JALB 3V7EA 4G4ZA 3RYIA 1K8AH 1NMUB 5JH7B 3E1YA 3S03A 4B46A 1VQLF 1W5FA 3G4SF 2BTQB 3LFOA 3J81M 4F6RA 5ITZA 2QI2A 3RYFA 3HKEB 3LDTA 3JAMM 3NK7A 3FBAA 3CC7F 3VTIC 4EB6B 4YJ3A 5LA6A 1VQMF 1QD9A 5FNVB 2CWJA 4O2AA 3N4YA 3OBWA 5IYZB 3ZOPA 2UYJA 1Q8RA 1SZQA 1W5BA 4HNAB 4I55A 2UZHA 1YHQF 1JD1A 2L26A 5HY1A 1VQ8F 1VH8A 2ZVZA 2VAMA 4EI8A 1ONIA 2IQQA 2JNBA 5J2UB 2HQSC 1W57A 1W41A 3JALA 3KIZA 2VAPA 3CC4F 2ZAUA 1XBIA 3HKBB 3CCEF 1Q7YH 1SA0A 5JH7A 3ESJA 1JFFB 2F9ZC 2AIFA 3C8LA
chains in the Genus database with same CATH topology
4EI7A 1JJ2F 1YITF 5FLXM 5HXZA 3AGKA 1GO1A 5HY4A 3OW2F 3ON1A 2CZWA 1W40A 3CCJF 3CD6F 2KTVA 1CK2A 2KTUA 1VQKF 3J80M 1PXWA 3CCUF 4BVQA 3CMAF 1K73H 3G71F 1ZWZA 2LBWA 4LCKA 2VGNA 3PAFA 4NQ3A 3HJWC 3NVKE 3GYQA 3E20B 3G6EF 1KD1H 1K9MH 1YJWF 1VQNF 5HWEA 5HY0A 3CCLF 5G4VC 1NJIH 1VQ6F 3VI6A 3CCVF 1CN7A 3CCMF 4X3LA 5GANK 1Q86H 1QVFF 4BY9D 2ALEA 3CCQF 3CXCF 1H7MA 3CCRF 2FGYA 3I56F 1YJ9F 1GO0A 3CPQA 2HVYD 5FJ4C 2BO1A 1YIJF 1W2BF 1VQOF 1N8RH 2OHWA 3VMFB 2QA4F 5G4UC 3RA6A 1S72F 1KQSF 1E7KA 1SDSA 3NMUC 4C4WC 3V7EA 1X7PA 1M90H 2I6DA 1K8AH 1KC8H 1T0KB 1NMUB 1QVGF 5GAPK 3CPWF 3E1YA 3CG6A 1W42A 5HXUA 1VQLF 4NUTA 3JCMM 3OBYA 1X7OA 3NK6A 3G4SF 2VGMA 3LFOA 3J81M 2OZBA 5GIPC 3IR9A 2QI2A 3J7AR 5IT9M 1RA4A 3CCSF 2LBXA 4BVTA 3JAMM 1YI2F 3HAXD 3NK7A 3V7QA 2KG4A 3CC7F 3RA5A 4BVRA 1GZ0A 2WALA 3SIVA 1VQMF 3SIUA 3LWQC 4X3MA 5EWRA 3N4YA 3OBWA 3V3TA 5HY2A 1VQ5F 1YJNF 4BVSA 4BW0B 1VQ7F 1VQ9F 2FC3A 4TZZA 1VQ4F 1M1KH 3LWOC 3WXMB 1YHQF 1Q82H 5HY1A 1VQ8F 5GINC 1VQPF 4EI8A 4EI9A 3MCAB 3N4ZA 3LWVC 2JNBA 4XCQA 3I55F 3LWRC 3LWPC 1W3EX 1Q81H 2GLZA 3FFMA 1W41A 5DCVA 3CC4F 5A2QM 3CMEF 3D00A 2OTLF 2QEXF 1XBIA 3CCEF 1Q7YH 1RLGA 3CC2F 3O85A 1DT9A 5GIOC 3NVIB 2OTJF 5EO3A 2F9ZC 1IPAA 2AIFA 1X52A 3PLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWE A;  4BVS A;  5HXZ A;  5HY0 A;  5HY4 A;  5HY1 A;  4BVR A;  4NQ3 A;  4BVQ A;  5HXU A;  5HY2 A;  4BVT A; 
#chains in the Genus database with same CATH topology
 3WJP A;  1JJ2 F;  5MN4 A;  2R6R 1;  5HXZ A;  5IJ0 B;  5KMG B;  1GO1 A;  1U40 A;  2YYE A;  3HKE A;  4BT7 A;  3CD6 F;  2KTU A;  4C8G A;  4EB6 A;  4B5C A;  5LP6 B;  3S02 A;  2LBT A;  1XV2 A;  3C9S A;  3CYP B;  5GON B;  5IYZ A;  3G6E F;  4O4I B;  1VQN F;  2DT4 A;  5G4V C;  4IIJ A;  1VQ6 F;  3L7Q A;  3CCV F;  4HNA A;  5GAN K;  3P10 A;  1UI9 A;  1Q86 H;  5LXT B;  1QVF F;  3N2K B;  3CCQ F;  4WBN A;  3WGJ A;  4BT5 A;  3I56 F;  3CPQ A;  2HVY D;  3K2X A;  5EYP B;  4RQO A;  1W2B F;  1VQO F;  3MBM A;  2RB9 A;  4O4J B;  3NMU C;  3WGN A;  3WGL A;  5IJ9 A;  1M90 H;  1W58 1;  4ZK7 A;  5EB0 A;  3BYQ A;  3HKB A;  1KNJ A;  2ZOV A;  3CPW F;  1JFF A;  3RE3 A;  3JVH A;  3HTN A;  1COM A;  3Q8H A;  1IV3 A;  2RHO A;  3CYQ A;  2RHL A;  3M1X A;  4NUT A;  2CVL A;  5B8F A;  2Z1U A;  3I3F A;  2Q1X A;  5EIB C;  5IJ0 A;  5KMG A;  5GIP C;  5IT9 M;  1QAH A;  2LBX A;  4BVT A;  2QTP A;  3M4S A;  2BTO A;  3ELC A;  5KX5 B;  5LP6 A;  1GZ0 A;  3SIV A;  4O4L B;  1W59 A;  2VXY A;  3VOB A;  5EWR A;  5HP8 A;  4DXD A;  1RLU A;  1U3P A;  4LNU B;  4X1K B;  4O4I A;  3KE1 A;  4X1I B;  4ZOL A;  1YJN F;  4BW0 B;  4C81 A;  1IV2 A;  1IV4 A;  1VQ4 F;  3WPW A;  5C8Y A;  4U39 A;  3LWO C;  4X20 B;  3E22 B;  5LXT A;  3IMP A;  3N2K A;  4BT4 A;  2Q1Y A;  2HP0 B;  2H8E A;  4TV8 B;  1H48 A;  4EI9 A;  3ZO8 A;  4XCQ A;  4O4J A;  1W3E X;  2GLZ A;  5LYJ B;  4I50 B;  3T80 A;  5EB1 B;  5A2Q M;  3CME F;  3D00 A;  1XRG A;  3O85 A;  5GIO C;  5JCO C;  5JQG B;  3UT5 B;  3MDO A;  3NVI B;  3F6M A;  2OTJ F;  2EWC A;  3B6N A;  3HKC B;  1X52 A;  4E6E A;  5HY4 A;  3OW2 F;  2KTV A;  2Z1T A;  3F0E A;  1VQV A;  1CK2 A;  3K14 A;  5KX5 A;  3CCU F;  3RYC B;  5CA0 B;  4U3J A;  4O4L A;  3CMA F;  2CHS A;  3WJR A;  4ERH A;  3JAK A;  1K73 H;  3FPI A;  3FD6 A;  3JAS A;  3PAF A;  2H6L A;  3GYQ A;  4X1K A;  3VYT C;  4TUY B;  3GTZ A;  1H47 A;  1K9M H;  1OAP A;  4X1I A;  1YJW F;  4ZHV A;  2Z1F A;  5EIB D;  4C82 A;  1CN7 A;  2KGW A;  3WGK A;  3E22 A;  5CB4 B;  3VIU A;  3CB2 A;  2ALE A;  1Z5V A;  3CXC F;  1H7M A;  2HP0 A;  3CCR F;  3ZP7 A;  2FGY A;  1RQ7 A;  1GO0 A;  2B33 A;  4G88 A;  3F0F A;  4BT6 A;  5EZY B;  2H8C A;  4BT3 A;  2QA4 F;  5FNV A;  2CW4 A;  1S72 F;  1SDS A;  4I50 A;  2I6R A;  2P6Y A;  1X7P A;  2I6D A;  5EAZ A;  1OFU A;  1DBF A;  3GHZ A;  1W5A A;  5JVD B;  2UYN B;  1KC8 H;  1QVG F;  1T0K B;  5JQG A;  1J7H A;  4G4V A;  3CG6 A;  5HXU A;  3K12 A;  3OBY A;  3HKC A;  3NK6 A;  3P4E A;  3IR9 A;  3J7A R;  1YQN A;  3N2G B;  1RA4 A;  3CCS F;  1Z5W A;  2HS4 A;  3V4D A;  4YJ2 B;  3QHD A;  3V7Q A;  1CLI A;  4O4H B;  4I4T B;  3WJQ A;  3VOA A;  1TUB B;  3RA5 A;  2IAF A;  3RYC A;  2WAL A;  5J2U A;  3SIU A;  3LWQ C;  2V9Y A;  4X3M A;  1VQ5 F;  4TUY A;  4IHJ B;  2CSL A;  3FD5 A;  2NMU A;  1VQ7 F;  1VQ9 F;  2FC3 A;  3R0P A;  4TZZ A;  1U43 A;  4TV9 B;  4ZHY B;  1M1K H;  2RHH A;  5ITZ B;  1FNJ A;  5J2T B;  1Q82 H;  5CB4 A;  3RYF B;  1FFX B;  3WPX A;  1IV1 A;  3OON A;  5GIN C;  1VQP F;  3N4Z A;  1XHO A;  4YJ3 B;  2GZL A;  2HP3 A;  3LWR C;  3KHN A;  1Q81 H;  4FFB B;  3FFM A;  3JAT B;  4G4W A;  5DCV A;  2LCA A;  3I7T A;  2ZOD A;  5GON A;  5JVD A;  2OTL F;  1RLG A;  2ZF8 A;  4I55 B;  5EO3 A;  1IPA A;  3RA6 A;  3PLA C;  1YIT F;  3AGK A;  2PHN A;  3N2G A;  2CZW A;  3LYB A;  2HRY A;  3IEW A;  1VQK F;  4YJ2 A;  1PXW A;  4O4H A;  4I4T A;  1FNK A;  1GX1 A;  2AIZ P;  2CHT A;  3TD3 A;  3M84 A;  4ZI7 B;  2RHJ A;  5EYP A;  4BVQ A;  2DYY A;  4O2B B;  4ZHQ B;  3G71 F;  2UYP A;  3IKF A;  2VGN A;  3F0D A;  3QTY A;  2IG8 A;  4IHJ A;  1KD1 H;  1SA0 B;  3RYH B;  4B62 A;  3U0O A;  5CA1 B;  1NQ3 A;  4TV9 A;  2W8B C;  1U3L A;  3HKD B;  3ZP4 A;  3S0W A;  3HWU A;  5J2T A;  3S0Y A;  4C8E A;  4BY9 D;  1VK3 A;  5HP7 A;  1FFX A;  2Z01 A;  2PMP A;  2MQE A;  3QUW A;  1KNK A;  1FSZ A;  4X1Y B;  2BO1 A;  5LOV B;  1N8R H;  5MN6 A;  5G4U C;  3MCQ A;  4FFB A;  1KQS F;  3JAT A;  1E7K A;  2N48 A;  3VO8 A;  3K0T A;  3LME A;  2HS0 A;  2YXZ A;  4LNU A;  5GAP K;  4IIJ B;  3EOR A;  3VYS C;  1W42 A;  2BTU A;  3JCM M;  1X7O A;  2HS3 A;  2VGM A;  3C9R A;  2OZB A;  4BT2 A;  5JCO A;  4X20 A;  4WBN B;  3JAW B;  1YI2 F;  3HAX D;  4TV8 A;  2KG4 A;  1PF5 A;  2R75 1;  4ZI7 A;  3DC2 A;  4BVR A;  4ZHQ A;  4PWT A;  4O2B A;  3IKE A;  4ZHW A;  5IJ9 B;  3JAR B;  5LYJ A;  3WGM A;  3V3T A;  5HY2 A;  3C9T A;  3TD4 A;  1R1M A;  1JY8 A;  5BMV B;  3RYH A;  4BVS A;  3C9U A;  5CA1 A;  3UT5 A;  2VAW A;  3HKD A;  4B45 A;  3IEQ A;  3WXM B;  5MN5 A;  2ZVY A;  4G4X A;  4DRX B;  1TVK B;  3MCA B;  3KJJ A;  4X1Y A;  3LWV C;  2HRU A;  5LOV A;  5CA0 A;  3P0Z A;  4C8I A;  3I55 F;  3LWP C;  4G4Y A;  5AVM A;  3RYI B;  2AMT A;  2QEX F;  4ZOL B;  3TD5 A;  3KJK A;  3CC2 F;  1DT9 A;  3S0H A;  4NWO B;  5C8Y B;  3MQW A;  1W5E A;  1QU9 A;  4KWE A;  3VYU C;  4EI7 A;  4F6R B;  5FLX M;  3JAW A;  5LP6 C;  1VHA A;  3ON1 A;  1W40 A;  4RHA A;  3CCJ F;  1X25 A;  3J80 M;  3DDN A;  2UYK A;  3D01 A;  5LA6 B;  5EZY A;  4O2A B;  3S06 A;  1ZWZ A;  3JAR A;  1ODE A;  2LBW A;  4LCK A;  4M8I A;  3HJW C;  4NQ3 A;  3NVK E;  3E20 B;  5BMV A;  2UYN A;  5HWE A;  4R40 B;  2HX0 A;  5HY0 A;  3CCL F;  2OTM A;  1NJI H;  3VI6 A;  2Z1E A;  3CCM F;  4X3L A;  2K1S A;  3D54 A;  1UFY A;  2G9I A;  4DRX A;  1TVK A;  1JN1 A;  1YGY A;  1YJ9 F;  1RQ2 A;  3ERN A;  4U3J B;  3F0G A;  5FJ4 C;  1T0A A;  1TUB A;  1YIJ F;  3JAK B;  1W55 A;  2OHW A;  3VMF B;  3VCZ A;  4C4W C;  3JAS B;  2GVI A;  3JAL B;  3V7E A;  4G4Z A;  3RYI A;  1K8A H;  1NMU B;  5JH7 B;  3E1Y A;  3S03 A;  4B46 A;  1VQL F;  1W5F A;  3G4S F;  2BTQ B;  3LFO A;  3J81 M;  4F6R A;  5ITZ A;  2QI2 A;  3RYF A;  3HKE B;  3LDT A;  3JAM M;  3NK7 A;  3FBA A;  3CC7 F;  3VTI C;  4EB6 B;  4YJ3 A;  5LA6 A;  1VQM F;  1QD9 A;  5FNV B;  2CWJ A;  4O2A A;  3N4Y A;  3OBW A;  5IYZ B;  3ZOP A;  2UYJ A;  1Q8R A;  1SZQ A;  1W5B A;  4HNA B;  4I55 A;  2UZH A;  1YHQ F;  1JD1 A;  2L26 A;  5HY1 A;  1VQ8 F;  1VH8 A;  2ZVZ A;  2VAM A;  4EI8 A;  1ONI A;  2IQQ A;  2JNB A;  5J2U B;  2HQS C;  1W57 A;  1W41 A;  3JAL A;  3KIZ A;  2VAP A;  3CC4 F;  2ZAU A;  1XBI A;  3HKB B;  3CCE F;  1Q7Y H;  1SA0 A;  5JH7 A;  3ESJ A;  1JFF B;  2F9Z C;  2AIF A;  3C8L A; 
#chains in the Genus database with same CATH homology
 4EI7 A;  1JJ2 F;  1YIT F;  5FLX M;  5HXZ A;  3AGK A;  1GO1 A;  5HY4 A;  3OW2 F;  3ON1 A;  2CZW A;  1W40 A;  3CCJ F;  3CD6 F;  2KTV A;  1CK2 A;  2KTU A;  1VQK F;  3J80 M;  1PXW A;  3CCU F;  4BVQ A;  3CMA F;  1K73 H;  3G71 F;  1ZWZ A;  2LBW A;  4LCK A;  2VGN A;  3PAF A;  4NQ3 A;  3HJW C;  3NVK E;  3GYQ A;  3E20 B;  3G6E F;  1KD1 H;  1K9M H;  1YJW F;  1VQN F;  5HWE A;  5HY0 A;  3CCL F;  5G4V C;  1NJI H;  1VQ6 F;  3VI6 A;  3CCV F;  1CN7 A;  3CCM F;  4X3L A;  5GAN K;  1Q86 H;  1QVF F;  4BY9 D;  2ALE A;  3CCQ F;  3CXC F;  1H7M A;  3CCR F;  2FGY A;  3I56 F;  1YJ9 F;  1GO0 A;  3CPQ A;  2HVY D;  5FJ4 C;  2BO1 A;  1YIJ F;  1W2B F;  1VQO F;  1N8R H;  2OHW A;  3VMF B;  2QA4 F;  5G4U C;  3RA6 A;  1S72 F;  1KQS F;  1E7K A;  1SDS A;  3NMU C;  4C4W C;  3V7E A;  1X7P A;  1M90 H;  2I6D A;  1K8A H;  1KC8 H;  1T0K B;  1NMU B;  1QVG F;  5GAP K;  3CPW F;  3E1Y A;  3CG6 A;  1W42 A;  5HXU A;  1VQL F;  4NUT A;  3JCM M;  3OBY A;  1X7O A;  3NK6 A;  3G4S F;  2VGM A;  3LFO A;  3J81 M;  2OZB A;  5GIP C;  3IR9 A;  2QI2 A;  3J7A R;  5IT9 M;  1RA4 A;  3CCS F;  2LBX A;  4BVT A;  3JAM M;  1YI2 F;  3HAX D;  3NK7 A;  3V7Q A;  2KG4 A;  3CC7 F;  3RA5 A;  4BVR A;  1GZ0 A;  2WAL A;  3SIV A;  1VQM F;  3SIU A;  3LWQ C;  4X3M A;  5EWR A;  3N4Y A;  3OBW A;  3V3T A;  5HY2 A;  1VQ5 F;  1YJN F;  4BVS A;  4BW0 B;  1VQ7 F;  1VQ9 F;  2FC3 A;  4TZZ A;  1VQ4 F;  1M1K H;  3LWO C;  3WXM B;  1YHQ F;  1Q82 H;  5HY1 A;  1VQ8 F;  5GIN C;  1VQP F;  4EI8 A;  4EI9 A;  3MCA B;  3N4Z A;  3LWV C;  2JNB A;  4XCQ A;  3I55 F;  3LWR C;  3LWP C;  1W3E X;  1Q81 H;  2GLZ A;  3FFM A;  1W41 A;  5DCV A;  3CC4 F;  5A2Q M;  3CME F;  3D00 A;  2OTL F;  2QEX F;  1XBI A;  3CCE F;  1Q7Y H;  1RLG A;  3CC2 F;  3O85 A;  1DT9 A;  5GIO C;  3NVI B;  2OTJ F;  5EO3 A;  2F9Z C;  1IPA A;  2AIF A;  1X52 A;  3PLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...