5HY9A

Glycosylated, disulfide-linked knob-into-hole fc fragment
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural differences between glycosylated, disulfide-linked heterodimeric Knob-into-Hole Fc fragment and its homodimeric Knob-Knob and Hole-Hole side products.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hy9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hy9A01
2JCCE 4JDTH 4ACPA 4WUKL 3DUUA 5SWSB 1K8DB 4AEIL 2VABA 4NQUA 4UQ2B 1NCDH 3S36H 3MA9H 4R97B 4IJ3B 4U0RB 5ELIA 3VFOA 4PB0L 1ORQB 1W72H 2YPLD 3LEYH 1J9CT 1ZA6A 3KJ4C 1HYSD 2YOCA 4HLZH 4FQ1H 4AG4H 1MHEA 2GY7B 2JCCF 4F7EA 3CH1B 1AGDA 1VGEH 2VISA 5BXFB 3NA4A 3FQUA 3MC0A 4EDXA 5GGSA 1AXTH 5KVMC 2FO4A 5J57B 3TJHC 1JGUL 5FYLH 2A6JB 4HDIB 1W8OA 3ZYZA 3EOBB 1I7RB 1HQRB 4XCFH 4YHZL 4FTVA 5I30H 1D3CA 4OF7A 4RAUA 2Q1EA 3GRWL 1FJ1A 1FL5B 1IGTB 3T0EE 1QVOA 4Z7VB 4EN3D 2XXMB 5HYEA 3TIDA 3GNML 4UQ3B 5KW9H 1EZVX 3KWWB 3M1BA 3ARDC 5IB2B 4ZXBB 3S35H 5D1ZC 5F1NB 3O2DA 2ZCLH 1AXSB 1OAQL 4XP4H 3CU1A 2ERJB 4P49A 5IW3A 1KG0B 1D9KD 2FATL 4YHPB 1DQLL 1NUDA 4U6YA 4ZQKA 1J1XH 3SDYH 1BLNA 3UTZB 4J3OC 4G6MH 3RNKB 1J8HD 2VITA 4TVPE 5LQBH 4RWYL 3ESUF 1QLRB 4QHMB 1V7ML 2YD1A 1SHMA 1Q9KB 4HWBL 4LRNH 3JTTB 2BDNL 4R4BA 4MCYA 4H1LB 1EGJH 4K3JL 2P44B 4M6NH 1XF2A 3D85B 4APQC 2YPLA 1F4WL 2A74A 3LQAH 3MUY1 5I1HL 4GSDH 1PY4A 3DI2B 4UIKH 5CFHA 5F3BA 4ZAKD 1ZK9A 4UDTB 3MRPB 3O2WH 4JFFB 5FGCB 3MLRH 4XB8A 3SKJL 2EYTA 3DJ9A 5C2BL 1L7TL 1LVEA 1MCQA 4OCYH 4PFEA 4RMSA 1V8HA 5EIIB 1NL0H 3P4MB 4RRPA 4WO4D 3K7UA 1CGVA 1CDGA 2NY6C 5MEQB 4XPAH 2EH7L 3DYPA 2UV3A 4ZNEA 3FO0L 4EN3A 2X1PA 2XXCB 4G80B 1D5ZA 5KTEL 3U0TA 4F7CB 1CE1L 2APVA 4MHHG 1EFXD 3D9AL 2DOCA 2A38A 4QRSB 2Q8BH 3T4AA 1LEGA 3MNZA 4HIJA 3Q5YA 4QTIH 3C5ZB 1D9KA 3VFMA 2NY0C 1RJZA 4NM4H 2YRLA 2BVTA 5E7BA 3MXWL 1RUQL 1A6WH 5HYSG 3WLWD 4X6CE 5CHNA 2BC4B 3UZEA 1LO4H 2LQRA 3I9GL 1Y6MR 1BVKA 4LRIC 3VFNB 4P4RA 3RWJB 3TM6A 2VIRB 2PW1A 1TJGL 2L4OA 4HV8B 4LPTA 3QAZB 3OXRB 4NWTL 4P5TB 1S9YB 4PJGA 1L6ZA 5DJ6B 3TYGL 4ZUTA 3PHOA 1DBKH 3MRDB 4X6CF 1FL3B 1ZHNB 4ZAKA 2YMXL 2D4FA 4LQ1A 1DQJB 4WWID 3ZYOA 1Z5LB 5ADPL 3FRPG 2J7LA 4DVBB 1WICA 4D3CL 3JBG7 4YDJA 4DQOH 4Y88A 4LEXH 4JKMA 4S1DC 3RY5A 5EU7E 2G75B 5E8NA 2EE6A 4FQLH 4U1MA 2O5XH 3HZMA 3DROA 3V6BR 4EQ3A 2HKFL 1PGRB 1FNFA 2ZOKA 5JW4Q 4HKXB 5CIPB 2EXYD 1JGVH 3B9KA 4LVNC 1OSPL 3MCLL 2EC9U 1ACYH 3QFJE 2WV3A 4QHUA 4KTEL 1X7QB 5C09E 1J05A 1EFXA 2P5WB 5DJYB 4ONGL 1QZ1A 5DJAB 2Y25A 3ARGC 3P4LA 1LE9A 4X4XB 2E7CA 1FCCA 3ZDZE 1OB1B 5I17B 1EX0A 3MUGA 4Z7WB 1LMKA 4Z8FH 4FFZH 4W6XB 4AEEA 1VEMA 3HRZB 4ENED 3OKEA 3K0WA 3I85A 1T20B 3BN9D 3HB3D 3T0EA 5F97E 1AR1D 3CUPA 3IGAA 1MCDA 2P24B 3Q6GL 3B5GA 3SCMD 1GGIH 3ZDZF 3CMGA 3KLHC 2XICA 3GMQB 3HI6H 3DV6A 4JANA 4M48H 5DA4A 4RGMC 1BMGA 1T83A 3HE6C 2A73B 3TBVB 3D25A 4OZFG 5DFTA 3NPSB 3T3PE 1DUYB 5IFJA 5HHXH 2BXZA 3WIIL 1I1YB 5ESAA 1UH2A 3C60C 4JR9H 2YSSA 4M62L 1OQXA 4XRCB 2ZOLB 4GRWE 4KDTC 3IDMA 4ZFGH 2YN5A 5LGJA 5DRXB 3DARA 3M45A 3CAFA 1KNOA 2BVOB 4ODVL 5LAXB 2NY2B 1HDMA 3QFDB 4Y2OA 5HGGS 1MOEA 3SDDD 4UT7H 3U46B 2BHYA 3QP3A 4P3CL 2C1PB 1VPOH 3T3PF 3RWDA 3SDCB 2BP3A 4GRWF 5L8JB 5GS1A 1M7IB 4HF5L 3RVXC 2VZOA 5B39G 1E0OB 5C71A 1OGAE 2CJUL 2IPKB 3DO7A 2DD8L 3QG7L 3ARFC 4RBPK 5FCUH 3ULVD 5T1KD 1N2RB 1T66C 3WJJA 1U8KA 4FQHA 3G9AB 5J12B 4F9PA 4ZNCD 2VDQH 4LLUA 5E8OA 3G5ZA 3WD5L 5I18H 2V6HA 1I1RA 4NBZB 5A3ID 4J3TA 3HR6A 3BHBB 4HUWA 2YN3A 4AIXA 4IMLA 1MRDH 5LBSL 3SCMA 3QJHA 3QFJD 3U4EB 1U8MB 3RWIA 5C09D 3ZTNL 2V5TA 2W1NA 1GC1C 5JIHA 2HLAA 3MRLB 5D1XB 3VU2A 1JYNA 1MCLA 4HX1B 2LE9A 1CXFA 1JWUA 2V7NA 2PTTB 1AE6L 4KK8C 2R2EB 2XOTA 1A6VL 3PWLB 4PGCA 4LSPL 4P2CG 2EDWA 5EORH 4X6CA 2BNRE 1RZJC 1PKQE 4XMLH 2Z93A 3SDDA 1A6TB 1YY8B 4GAGL 1I8MA 4NQCB 3MLUH 3HFMH 1QO3A 5IEHA 1L7IL 2EE3A 1OWRM 4MAYB 5B22A 1BOYA 4WI6A 1MFDL 4JGMA 3BSZH 1PW3A 2QQKL 1G7MA 1G6RB 3T2QA 3C6SB 4OIBA 2PR4L 1U8NA 1RUPL 5CCKH 3SKNB 4U49A 5JW5A 2ZCHL 5T1KA 1XFPA 3SE9H 3RX7A 5HYIA 2XKUA 2AJZA 4KKCC 1QFWL 4QHKJ 3REWA 4TRPH 4OD3L 2AEQL 4M43L 1EBAA 4DZBA 5I1LB 1IGIH 4L9LA 3MODH 4BSVA 4L8CB 1MAML 3IF1B 2NY5L 4I77L 4NC0B 2YD9A 3QFJA 3QPXH 4JDVB 5SV3A 5TDPA 5JPNB 5C09A 1OGAD 4HWEL 1PAMA 5SX4H 3RIAK 2EXWC 2A9ML 1I8KA 4IOIA 3VMOA 2XFXA 3C6LC 4OZFH 1P4BH 3O9WD 5C0AE 5CGYD 1NDGA 2R1XA 2X44D 4NHCH 2WUCH 4ZOBA 5E5RB 4LSRH 3CX2A 2J8HA 3TBTB 4FQQB 4L1DA 1RD6A 1HHKB 3DX7B 5D6DC 4BJLA 1CR9L 1MRCL 4F3FB 1LEIA 2CKBL 2IAMD 4HGKC 3VFWA 2XTJC 3KYMB 3MTRA 5I16B 1BBDL 4M5ZL 4FQIL 3RWFB 3CGTA 1PG7X 2DQEL 4LCWB 3VGBA 1S7VA 5L6YL 1A1NA 4RISL 5EA0H 1N4XH 2I26N 2WM0A 1CD0A 1F6AA 4XZUB 3SDXE 5DJ2B 4E5XA 3TJEH 4DEPB 3BP4B 1LP9E 1X5ZA 4KI5C 1P7KA 2BNRD 2QSCH 1WLHA 4XPBL 3NFPB 3TBSB 4I48B 1HHHB 3Q1SL 3IKKA 1KJMB 1BOGB 1S7XB 3B83A 3MO1B 3CFKB 4ZS7H 5CSZA 5IBLD 3SDXF 5ANME 5BS0B 5EH1A 1P7QB 3UZVB 4GW4A 1LP9F 5EU6E 2CD0A 3MV8E 2F5BL 4HKJA 5FDYA 3RL2A 5AD0B 3GUTB 4QF1B 4H26B 1OGAA 2EIBA 2OL3H 5FEBA 4OUUB 5B38B 3NCJH 1K2DB 4ZUVA 1ES0A 3F7YB 1JGDB 3IU4L 3O9WA 1JGLH 2DWDA 3L3OB 4GQ9H 1XGTA 3EYQD 4JFOA 4OM1L 1AGFB 4LLDA 5IMLA 2Q8AH 5IB5B 4I18C 4TVPL 4CAGA 3FJTA 3RL1A 3MFFB 4UUJB 5LJYH 5CJOL 5DEZA 4MX7A 4YR6A 4C56E 1KPUA 5JZ7D 2QSTA 3QCTH 1HH6B 4U6HA 2DL9A 2IAMA 3FO9B 2X9WA 2ZUUA 3UBXB 3O3DB 4NDMB 4UV4L 4O2FA 1P6AB 5C0AD 5DTFA 2FBJH 4WWKC 3GDBA 1T7VA 4RSVA 3CLEH 2FSEB 3KPQB 4Y5VA 2JE8A 5GSRA 1YMHA 1P2CA 2R56H 4OLUH 3VGEA 3DECA 1UXWB 4PYHA 2HT2C 4ODXA 1OCWL 3KPNB 4JFDB 4B41A 1ZOXA 1HEZA 2BNRA 2QLVB 3IDXH 1QFWI 3EOTL 1PKQA 2ED9A 2N56A 5HHQB 4HKZB 4S1DD 4NRXB 4PJFE 3SJVE 1DLFH 3CCHB 4WV1B 3O6KL 1TQCB 4Q6YA 2WLYA 3K81A 4JREC 5K9OB 5DUML 2EH8H 1N0LA 5F9AC 3FQRA 5FYJE 3QB7C 3VWKB 2Z31C 4FABH 3F62A 4U1SA 5DRZA 4NYLB 4HS3B 3UTSB 1E4WL 4H25A 2K1MA 4LAQH 3ROOB 2E7LC 1T1YB 3TNNB 3U1SH 1A1OA 4NJ9H 4HCRL 4OM0H 4PJHE 2OJZH 3MBEB 1DLHA 4Z9KB 4AH2B 4PJFF 1H3PL 2W0PA 5E5UB 3MJGX 1KB5H 2VDMH 2CDEB 1F3JA 2GITA 1JZ3A 2GHWB 3K80A 3HI1B 3C5JA 3F65A 4S1RL 3A0OA 4PJHF 1AHWA 5BRZB 2NX5E 1FNSL 5EU6D 2B5IB 3S34H 4I0PB 3MV8D 1UFUA 3MRCA 3WFDH 4JFPA 3DSNA 1NDMA 2EDHA 1JV5B 5IMMA 1I4FA 3P4NA 4JPVL 5C0FA 3PGCA 4Y16C 3GHBL 5C0AA 4PJXA 3UJJH 3VMNA 3ZDXE 1OQOA 4W68A 4CVZB 5FGBC 5CINH 5AZEL 1TDQA 5FUCE 4D94A 3ULUE 3HZVB 1AD9B 1RFDH 5BVJA 2X4RA 5T1LB 3GKWL 3IDGA 1G7JB 5T33H 4C56D 5J56B 2VH5L 4KK6D 3RGVB 3SY0A 1SBBA 1QSFB 4TVSa 3B4NA 2KQMA 3ZDXF 2V5MA 2VDNH 1IAKB 1G0YR 4LHJB 3GSRB 2DS4A 2FEEL 2AV7A 4XC3H 3TPUA 3V4PH 2VDPL 4JB9L 3ULUF 5TDNB 1P4IL 2RHEA 3BT2H 2HG5A 3MBXL 3RVXD 3SDXA 3VG0H 2AEWA 4QRRD 3QCVL 5TPWH 4ORZC 2PYED 3P11H 1LP9A 1JPFA 5CEZH 4HIIB 5I75B 2R8SL 4HS8H 5FDWB 1MQKH 2VMFA 2YWZA 3CFBB 1FBIH 4MNQB 4TULH 3OKMB 3Q3GB 3SJVD 1FO0H 3VXQA 3MA7B 5DHVB 1RHHB 3BZ4B 5FYJD 3L3JA 4IM8A 5ANMA 4AYFA 1ZHKA 3MLVL 3WJLA 3L5WA 4HJ0D 5EU6A 2GSGB 4M6ML 3MV8A 3T65A 3MZTA 4UNVA 5ESQB 2Q7YB 1PLGL 1EA9C 3PUCA 3MV7E 3HI5H 2IGFL 3FN3A 3GSQA 2A0LD 3U4BL 4XVTH 3WIHA 2ORBL 1N8ZB 1AO7B 4O51A 5D70L 1CK0H 3KR3L 3AREB 1MUJA 2BVPA 4IHOB 1QSEB 1AQDA 3O8XD 4QHLA 1HXYA 5DEGB 2CUHA 3B6SA 1Q72H 1MCIA 3QEQE 5HGHA 2OZ4L 1R5WA 4C56A 3MLYL 4I5BB 4PLKD 4ETQA 4P23B 1G7QB 1S7QA 5K33A 1MFAH 3IXTB 2P7TB 2HN7A 2ADJB 1NLBH 1I3UA 1KB9K 2A6DB 1C08B 4ELME 5DVMA 3RUGE 2B0SH 5CP7B 1OAUH 4CADB 2NMSA 5MEPB 3X11A 4XI5C 5EUKA 4JRXB 3CDYA 3S5LB 1YNKH 3F12B 25C8L 2QHRL 5C07D 2PYEA 4UTBH 4XPTH 1L9NA 2YRZA 3DUSB 1KIRA 1QQDB 1N6UA 4ELMF 1IARB 1I1AB 5CEYA 1DP0A 4G9DA 1NBVL 4PJFA 3SJVA 3RUGF 1MF2H 3NN8A 4DW2H 2FJGA 1YEJL 4O2EB 4G6JL 2R4SH 5H35A 4Y7MA 2YK1L 3BWAB 1DQMH 2NLJB 5F7UA 5LGKA 2UUDK 3IJSB 5GZOD 1A7RL 2NY1B 2BCKA 5F7WC 4LLAA 4PJHA 4KAQH 3ALXA 3TWCH 2EXWD 1AQKH 4NSKB 2WK2A 4P99A 4UMGA 1WITA 3JZ7A 4Z7VE 1K9TA 3O8XA 1WCBB 4OLEA 1RJLB 4K94L 4OGAC 4S1SH 4R7NA 4Q0XL 4CN1A 3HNVL 3IETB 3KXFB 3OAYK 2NX5A 4NNPH 1FFOA 2FEEI 4WU7A 3OHXB 1TCMA 3ZTJH 4AK1A 5EOCJ 1DVFD 3MV7D 1KB9J 1P9MC 3BGFB 4Z7VF 2VXQL 3K2MC 3U7YH 2V2XB 2NXYD 4N1CA 3FQNB 1F3RB 1KBGH 1INEL 1WGOA 2M26A 5H37G 5C92A 3STZB 1UC6A 2ZUXA 2NR6C 5HYSB 4F57L 4WI3A 3DETC 4GBXC 5DFWH 5F7NC 3QEQD 1VGKB 5IJVB 2NY5C 1N5AA 2ZNWA 1SYVA 1Y18A 4U6TA 3VJ6A 1M05A 1Q0XH 4MXQC 4RAVB 4X5WB 5IKCB 2DJ4A 3NFSH 3OKOA 4J1UA 4M8QB 4OSUL 3KPTA 5KSBB 1ITBB 1VFBB 3UTTB 3QUXD 3S3PA 5C1MB 5F1OB 1DBML 2HWZH 1CD1A 2R2BB 3LSOA 4IDJH 1XGPB 4EI6A 4OV5B 3OJDA 5I74C 4XBGA 3DMMC 5EBMA 4JKPH 2AJXL 3HMXL 5FYKE 4BFGA 1IM3A 4X9FA 2JF1A 4JN2A 4DKFL 2AJSH 4W6WB 2WIIA 1HH9B 2E5EA 5IM7A 2CRMA 5CUSL 43CAB 4U1HB 3FMGH 2NY4C 5HGDB 1S7WA 1BVLA 3V2AR 1TVBB 3GSVB 5F7YC 4MMXC 2KZWA 1FFPA 4HK0A 1DVFA 3MV7A 3HTLX 4JRYE 5A2JH 2W65B 2Y7QA 3E8UL 1FIGL 1I7UA 1QD0A 2F8OA 2AEPL 1R3IH 1F90L 5HYQB 4J3SA 4OT1H 1S9KC 2OTPA 3TO4A 1H3TA 5CD5D 5JNYA 4XH2A 5ETUA 5AAWA 1B2WH 1KGCE 1YYML 3QHFH 3VG9B 2AXFB 3QEQA 2IFGA 5ICZA 3F7VB 4JG0H 5EO1A 1T22B 1ZS8B 2FZ3B 5DMGD 2WBKA 4OFVA 4YHNA 1JFQH 5AWNH 2E9BA 3HAEB 1QBMH 3QJFA 4PV8A 3ZLQC 2W91A 1IAOA 3QUXA 1WK0A 3NVQA 5GRXG 2V2WB 4ELMA 4Y5YC 5F9OH 2HLFC 3VFTB 3RUGA 1KV3A 2IFFH 5ID0A 3D0LA 5C6TH 5EU3B 3WS6C 1BD2E 4N68A 5FHBL 3S3SA 1A5FH 1S7TB 3LN9A 4HWBA 1EJ6A 2ZNXA 1OT1A 4Y2DD 3CPLB 3C2AH 4ZUWB 1GHFH 2ZUTA 3WLBA 1OW0C 2CUIA 3TH2T 3CH1A 5B39B 3AGVA 5E8PB 3AVEA 5D7SL 4LPXA 2P5WE 3BO8A 3KPPB 4WTXA 1F5WA 5E9DE 1A6UL 1JL8A 2WBJD 1U6AL 5ITFA 1YUHA 5DJCB 4U1GB 4KFZC 3JUYA 4PJIE 3VH8A 4K7PX 3A67L 3ARZA 3G6JE 4BA8A 5FYKD 3WNOA 1FL5A 2DM7A 1IGTA 2PXYC 1OHQA 3CVHB 1WFOA 4Z7VA 2DM3A 4X99B 1UWEL 4NOFA 5D7LE 3VXRE 2Y1VA 1CU4L 3H9SB 5T1MB 3RY6A 4XBEH 5GS0L 3B2UD 2G5BA 1VERA 2PN5A 5C2UB 4PJIF 4F15C 4O4YL 1DZBA 2G60H 1B0WA 5F1NA 4DKDC 1AXSA 1C16B 3G6JF 4QYOB 4XNMB 4WIQA 5IESL 4JRYD 5F89A 4I8DA 1A7OL 2R4RH 3MJ8B 2J5LC 4M7JL 3AY4C 4KKNA 5EULV 2MKLC 3AAZA 4D0BB 1JNJA 3HMWL 3RNKA 4R26L 1CGTA 4NQDE 3O41B 4WFEE 4U4BA 5D72L 4P4KC 2EDDA 2YUZA 4BFBD 1INQA 1KGCD 3QZWB 3EYUL 3RGHA 2OJEA 2B4CL 4IEFB 5JO5B 3HLAA 4Y2DA 2DI7A 5CWSB 5GIRA 4X5LA 4J12A 2YKLL 3Q5OA 4XNXH 3VXSB 1KJVA 2MOVA 3MRPA 2IWGA 4POYA 3NAAL 3CZFB 3HPJA 2X4QA 4G7VH 1D5MA 1JYXA 1I3GH 3HE7C 2WBJA 3PWVB 1E27A 4U1NB 3O3BB 5IT2L 3BQUC 2JJSA 1GC1H 3PWUB 4PREB 4MCZB 3LH2L 1IQWL 1BD2D 2FHBA 4KMQA 3P4MA 1I9JL 3F5WA 3BI9X 4S11A 1CT8A 1A7PL 4MLIA 4R4ND 4Q9RH 3ZYIA 4YDKL 1HKLH 1SMAA 4KUZL 3MLZH 2MTPA 3UCRA 3MLWH 4G80A 1UB6B 3FTGB 3V95A 1RZJH 4N0RA 2J1KA 3CIQA 3TT3L 5DLMH 5TE4H 4P2RD 5E9DD 4PRAB 3MLSH 3LS4H 5HI5D 1EERB 1PZ5B 3X3GL 4JRYA 1F4HA 1XZ0A 4O00A 4MNGB 1QP1A 3JWNC 1S7UA 1WFTA 3K3QA 3ALWA 5BOZG 4MLSA 4WFHE 3QWQB 1Q9LA 2FRGP 1J0KA 5I1GL 5IR1A 4L8SB 3VXRD 5D7LD 4PJEB 4I4WB 5I2IB 3V6ZB 2A9NL 4ZODA 4LOUD 2X9XA 4P5TA 4QRQA 3V4UH 1MCSA 5KVDH 5DJ6A 1MCPH 3H3PL 4NIKB 1JN6B 2GJZA 3FT3A 4NC1C 4GAYB 3MRDA 1KENH 1QOKA 1YPZB 3BKJH 1MSPA 5MI0B 4FFWD 1DBJH 5F72S 5I1DB 1CFVL 4NQDD 1K8IA 1QFHA 4YLQT 2L0DA 2WZPD 3GK8L 4WFED 3CXHK 1MNUL 5ICXB 3NTCH 3OR7B 2ADGA 1A02N 4GRLD 3SO5A 1BD2A 4PY7B 4G8EA 4AEIH 3KAAA 4JGUA 4PB0H 2Y4SA 3QIWB 3T0AA 1AGCA 5DHXB 2R29L 3KPRE 3ZKMD 4HEPG 1TENA 4CUCA 3T8XA 1X7QA 2JELL 4XBPA 2X7LA 3U36B 1U92B 4QT5A 4P2RA 5TE7L 4FQXC 4XCEA 5E9DA 3UPCA 1U8IA 4YDLB 4PRIB 4Q6IB 4JG1L 4HT1L 4RGNC 4PJIA 5BV7B 2CK2A 1JGUH 1FAIL 2J6EH 1FZKB 1E6JL 4YHZH 3G6JA 1OAKL 1G7HB 4GXUM 1H5BB 2P46B 2AGJL 1JHLL 3HUJB 3QULB 4LGPB 3RIFK 3GRWH 3EGSB 3VXRA 5D7LA 2LAAA 5IB4A 2A6IB 1GIGL 2ZUYA 3QT2A 2FL5B 1XGRB 1RU9L 3GNMH 3MGAA 4PJCB 4ZTOL 3BN3B 4LCWE 1IL1A 3TBVA 1YDPB 4L3AA 3GMLB 5F7DB 2UVEA 1OAQH 3QUMB 5DZLA 1UCBL 2DJUA 3BZFB 5IOPB 3U83A 2VKWA 1ZA3B 1NCNA 1RUKL 2FATH 1DQLH 2YBRB 4XRCA 3P77A 3CXHJ 1SJEB 4N0UB 4WFHD 4NQDA 3WYRA 3RWGB 2BVOA 4LLVB 3C5SB 3DIFB 4RWYH 4K94C 3U46A 4YWGL 4GRLA 2XZAL 3RI5F 1V7MH 4HS6B 1QA9B 3ZKXB 5CSBA 5D7KE 1HCVA 1YEHL 2BDNH 4K9EL 4K3JH 1NSNH 2AQ3A 4HIEB 4OUOA 4YDIH 4NN6B 5DJZA 4U1JB 4LEOA 3F7RA 1F4WH 5AUMB 5DVLA 5I1HH 4ELKA 1QSZA 4KKAC 2NY4D 3QUZD 2JKXA 3UAJC 4JKWA 3N9GL 1HINL 1KJ3L 3UPRB 1N2RA 4G8GB 1B9ZA 5EOQL 3SKJH 4QNPE 4Q2ZB 1R3LB 5C2BH 5DS8B 1L7TH 2Q76B 3THML 3G6DL 4GO6B 4G8IB 4L8DA 3RWEB 3IXAA 4LKXA 3KPRD 2YPKA 2EH7H 3OJ2C 3SQBA 3FO0H 4QNPF 2ZG2A 3BD4A 5T5NG 5KTEH 3AXLB 4YFLF 1CE1H 3MRJA 4XNYL 1UADC 4HX1A 3FHQA 5DXWA 1U8HA 3D9AH 3IU3B 3D3VB 1XH3B 2XPGB 5F6IB 2HTLD 4BH8A 4GXVL 3IFNL 3BPNC 2GTWB 1JPGA 1BJMA 3GMRB 4WI5A 3MXWH 3WO4B 1KTDA 4D9QD 1NGWA 1YC8A 2XKSA 1SJVA 1B0GB 1A6TA 1NFIB 3I9GH 1HE7A 1KLUB 4KJPC 3B9AA 4LGRB 1JWSB 4XCCL 2F8VA 5HJ3A 1TJGH 4NWTH 4JM2C 2XWTB 2ARJQ 3TYGH 2HT4C 5I71C 4POZC 3DVNB 4OZHB 1G6RA 4ZFOA 2VAJA 1V3LA 2ITDA 3O3EB 1RZIA 2VLKB 4X80L 4TNWK 2PCPB 2YMXH 4K2UH 2Y6SD 3QUZA 1UA6L 2IQAB 4X4YA 1NAMB 5ADPH 5GS2D 4OAWB 4D3CH 1OP3K 1TPXB 3T0XA 4DN4L 1DCLA 1T80A 4KC3B 1VESA 4W4OA 2DAVA 1H3XA 5H8DA 5I1LA 4I2XA 2HKFH 2JK5B 2A6KB 4FXGA 3IF1A 5IVNA 2OXGA 3KPRA 1OSPH 1ETZB 3MCLH 5JPNA 2OSLB 3BP5A 1UZ6E 2CDFB 4KTEH 1I3RB 4LVOC 3BVNB 3GJFB 4MD5A 4ONGH 3SHSA 5HGBA 3PDDA 4X7DC 3OF6D 1CBVL 1A21A 2EZ0D 5JOPE 4HK3N 3JVGC 3NCBB 1C8PA 1UZ6F 1B4JL 1HXMA 5KN5B 4HD9A 1BZQK 5I1AB 5E1AB 2FJFB 3CDGA 4LSUL 5GGRB 3KYMA 1A3LL 3GMOB 5D2LB 3Q6GH 5LKNA 1RUAL 5IVZA 1DEEB 1R3KA 1V3JA 3GO1L 2H26B 3RWFA 3PV6A 4K7PL 1NBQA 4LCWA 1BJ1J 4Q9QL 3RBGA 1CLOL 3FB7A 2DKUA 5EO0B 3GIVA 3WIIH 3BEWB 3V5HA 3NCCB 4M62H 4ZSOA 3AUVA 1ND0B 5GS0C 4KPHL 4M1CD 4KZEL 5I73C 2BY1A 3NFPA 4ODVH 5EN2A 3MREA 4JO4L 3TA3C 3ARUA 5T3ZE 2CXKA 2JTDA 3MO1A 4P3CH 3VWKD 5DD6B 4OFKA 2WMPA 5DUBB 2QTEA 1ZT7B 4WVRA 3U9UB 5IQ9B 4J4PC 3TVMB 1JNNL 2R9HD 3SQOL 3QI9C 4QOKB 1QLEL 3GUTA 4QF1A 4XPFL 4HF5H 1P53A 2ICEB 1PD6A 1MHCB 2CJUH 1EZVY 1AO7E 1H15B 4FMKA 2BOCB 2DD8H 4OF8A 5HHNA 3QG7H 1XAUA 4PJ9D 3LV3B 1NPUA 1A3QA 3OF6A 1QSEE 2B4CC 1KXTB 2FECL 4EUPB 3EYVA 1CFBA 3AY4A 5AG9A 3MUZ1 3WD5H 3VFPB 3PP3K 4ODWA 4LCIL 4NN5C 4PGBB 3HPLB 1YEIL 5C0DB 3FZUC 5LBSH 1M1SA 1MCWM 2DI9A 2NY3B 3BKML 3VFRB 3BZEA 3WNLA 2PTVA 2NW3B 3ZTNH 5E2UL 1N3NB 4MNHA 3WN5C 4WW2B 1JI2A 1B3JA 3TV3L 1AE6H 4K55A 4RMQA 5J13C 3EYSL 3KPMB 5JOPD 4N90E 3PWJA 4P46B 4U3XA 4Q74A 1UKQA 4QGTA 2HVKA 5GRWA 4LSPH 2AXGA 3IFPB 1T4KA 1ROWA 4HBQA 3OJVC 4RDQF 4G6KL 3Q6FA 1UQSB 4M1DL 3UTPE 4FP8H 3VWKA 2ZKHL 4NRZA 1S7SB 4AIZA 1L7IH 3L1OL 1BPVA 4LLWB 2RR3A 1FVEA 2JJWA 5DC4B 1MFDH 4RMTA 3TNNA 1FZMA 2QQKH 1A14L 3QQ9D 2VLLB 4AH2A 1YN6A 1ZVHA 3IT8D 3BH9B 2PR4H 4OBSA 1I8LA 1SEQL 5HY9A 1G84A 4PJ9A 2E3VA 2ZCHH 1QHOA 1OP3H 2CDEA 1CQYA 4IMKC 2QQNL 4JFYA 4JPIB 4Y4KB 4X6BA 5T3ZD 3HI1A 1V7NL 1G9ML 1IC7L 4ODHL 1QFWH 5JXED 4ZS6D 4I3SL 4I0PA 2MQ0A 4M43H 3RDTB 3P0GB 2X1OA 3QO0A 1A6ZA 4WJ5A 3MJ7B 2FO1A 2YD7A 1MAMH 4JFXB 5CBEB 4I77H 2NY5H 5CP3A 5JHDD 2VWEC 3H9HB 4HWEH 1AO7D 3TC9A 5I66A 3P0VL 2A9MH 3GJEB 4ZDHA 5D96B 2JIXB 5D6CB 1NCTA 1QSED 1F4XL 3OKKB 1ZT4A 4F9LA 4M61B 3UJTL 1T0NA 1T04B 5E2WL 4DAGH 1HHGA 5D2NB 5T1LA 5JDSA 2GTZB 2J8UE 4N9GB 4LVHB 3VRIA 1CR9H 3U6RA 3I50L 1UACL 5HHPB 2LTQB 1T89C 5CSGA 2CKBH 1HN1A 4P9ML 2PO6B 1KJ2B 1MHHA 4URTB 1BBDH 3FQWA 4Z6AT 4M5ZH 5DRNA 3GSNB 1RZGA 4FQIH 4JQIL 4OKVB 2H3NA 2DQEH 5C0BE 5L6YH 2J8UF 4RISH 5TF1H 3DRTA 5M95B 4N90D 1ONQB 3VXUE 1GRWA 1NFDE 4OLYL 1DANT 3W0WE 5ESVB 1KIPA 1C7TA 4R97C 4U0RC 3VFUB 2NYYC 4CVXB 5T3XL 4XPBH 5JORB 2VN4A 1QEWA 3Q1SH 3OAUL 5JHLL 3UTPD 3MJ6A 4OQTL 4OLVL 4PJDB 5DJ8A 3GGWB 4AMKL 5D7JB 5HYFA 3WUWG 5JXEA 2GAZB 3EDKA 3B8YA 2GSGA 3RA7L 4DTGL 4K8RL 1NFDF 5ESQA 4Y4FD 5TJWK 1IGFL 1L4IA 2NXZB 3LKQA 5JHDA 5IHUL 1MJ8L 1AO7A 4OCLC 4NKOA 2WBWB 5ENWA 3RHWF 4PP1D 3BP7B 5C0EA 2DQTH 4AM0A 4K9EC 1QSEA 1QTYT 4IRZL 4U1LB 3ZT6A 3PIQA 3QIBD 3BJ91 5KVGL 4TVPH 1EAPB 1I7TB 5DDHB 1EEYB 2QADC 5CJOH 2V9TA 4FFYL 4I5BA 3PP3H 4ZXBC 4P23A 1G7QA 2ICWB 3DX6A 3I2CL 1R3JB 4RA0C 5B8CB 1F13A 1C08A 3I3BA 1L0YA 1CZ8L 3BUYB 1WIOA 4UV4H 4KRPD 2IPUK 1HNFA 5EZJB 4M7KH 2Z4QA 4HMCA 2E6PA 2VDLL 3MRNB 4CN6A 5FO8A 2FWOB 1R6VA 5AZ2L 3INUL 3C09B 4JY4A 4J3WA 5D4QA 1UM4L 1OCWH 3DUSA 3CD4A 4KGLA 1QQDA 3ARSA 3W81A 1KIQA 3SGKC 4HULB 3SKMA 1N0XL 3EOTH 3O81A 5SWQA 2VDKL 2X4TB 3DLQR 4ONHA 2FD6L 5DMIL 1JTPA 3GB7B 3O6KH 5IWLA 1N5YL 2J3SA 1BZ9B 5DUMH 1UYWL 1OD9A 3PGDA 3QDGB 3H3KA 5C0BD 3IJSA 1E4WH 4Y4FA 3H2WA 4J23A 3N1MC 2EKSA 2IPUG 3VXUD 3WFEL 3LQZB 4HCRH 1AJ7L 5DC9B 3GBNL 3W0WD 1H3PH 2HFFA 4JFQB 3PABA 3H9SE 4BUGA 3TLRA 3I6GB 3E3QE 3LY6A 1TZIA 3QIBA 2ATKB 1A1MA 4EBQL 3IETA 5DVOA 1FL6A 4S1RH 4G6FB 3HHRB 3OHXA 2Y9RT 1FNSH 1A7NL 4KJYA 4UU9B 2E7MA 3CFEB 4GKZB 4KROD 4Y4HD 2V2XA 4X7SL 3C5ZC 1YEEH 4IIQB 2OCFD 2UVFA 1U8OB 1AGBB 1BECA 5B3NA 3GHBH 1VA9A 5CZVL 5L2KE 2HTKC 5FV1L 2CK0L 1FFNA 3PDOB 5ICYB 5A43C 4HIXL 5AZEH 3H0TB 4DGVH 4K3EL 3ZHDA 1QFOA 5FB8A 3R8QA 2J8UA 4GMSL 1AC0A 5SV4A 2NPLX 3QAZC 3GKWH 1A6AB 5IKCA 15C8H 5F1IA 4M8QA 1MJJB 2APWA 2VH5H 3KYKL 4DGYL 2P5EE 3P9LA 4UBDD 1G0DA 3VXSE 3FQXB 4P5KB 4ETYA 1SEBA 5HVHB 7FABH 3LCYA 4Y5XB 3O2WL 2VDPH 1XGPA 2L7JA 5C0BA 3VWJB 4JB9H 3WKNA 2FNBA 4D9LH 1P4IH 1MLCA 3MLRL 4C55A 3VXUA 2CLVB 3MBXH 1YY9C 3QCVH 1NFDA 1EBPA 1J0HA 3QO1A 3W0WA 4JZNA 5C0JB 5CEXA 1U3HD 3OXSA 2IH3A 2R8SH 4JKLA 2VLRD 1WWBX 3BP6A 5EG6C 1DQQA 3EHBC 1J88A 1NKRA 1ZMYA 5HGDA 1FYTB 4U6XA 1TVBA 4XVUC 1MELA 1GGCL 1BF2A 3VFGL 3ZE1E 2DLEA 2PW2B 3ZSSA 1DDHA 3DX9A 4NZDA 4DWHA 4M6MH 4MJIE 4MNGE 4QRPB 1PLGH 4Y4HA 4U0QB 5J0BA 2IGFH 5J06A 3BEVB 3PHQB 3S4SG 3U4BH 3DVFA 3BUTA 2HH0H 2ORBH 4U6VL 4J8RB 2EICA 2YD6A 5D70H 1UM6L 3IDYB 5F7FA 3MZGB 5JIPA 3RPKA 4NNYB 3KR3H 3H9SD 5GGQL 4XVSL 3ZE1F 1A6WL 5F8RC 4BFEA 4QY8B 1P5VA 4JQVA 1JHKL 5LVEA 3F7VA 4KJQD 1ZS8A 4DUVA 3VGAB 1HILB 1JF5A 2OZ4H 4ZFFB 5C0IA 3MLYH 4LMQE 4V1DB 2OR7A 4LQFL 2DTML 4MQSB 1A6PA 3NPSC 3ABZA 3IDIA 2C26A 3L95B 3M17B 3UBXI 3X13A 1FG2A 3FFCD 4MA7L 4ISVA 1IRAY 5HHMB 3MNWB 3QXDA 5L2KD 1WZ1L 3SDAC 1XCQB 2NY2C 4NZUL 4BK5A 4YFDB 2QHRH 4UOW1 3QA3B 5IEKA 1EUTA 4WFFE 1B6UA 4XNQB 3O4OB 5GXBB 1UVQA 3EAKA 3DUUB 2XZZA 3AROA 3TO2A 3SDCC 2VABB 2DQFB 1U3HA 4ZUWA 1GGUA 2P5ED 3VFOB 1NBVH 3B3IA 4W70A 3RZCB 1ACYL 43C9A 1QLFA 4P57B 1ZA6B 2Z8WC 4F7PB 4G6JH 5CGTA 3WL9A 2YK1H 4XNZC 4PRNA 4MB3A 4F7EB 4ODUA 4Z76A 1AGDB 5I9QB 2VISB 1A7RH 4ZYKA 3FQUB 4EDXB 3ZDYE 3IRPX 5GGSB 1JZ7A 3K8LA 1RJCA 2FO4B 5JIKA 3K8MA 1UEYA 5J12C 1CXEA 5FA4A 1BIIA 2XN9E 3NFNA 1IEHA 4FTVB 3H9SA 2R2CA 1FFRA 4RAUB 2R0KL 1FJ1B 1AXIB 3MV01 1LK2A 1Z9OA 3J7HA 4MGXA 1QVOB 4K94H 4XP9H 4NKMA 4Q58C 3ZDYF 4Q0XH 1C16A 3HNVH 2B7DT 5GSVB 1PDKA 3TIDB 1SVCP 3HI6L 3IB4A 3M1BB 4MJID 4OIIL 1I1CA 3JV6A 3L5JA 3O6ML 1SY6A 4PP2A 4D0BA 2VXQH 1PQZB 3FFCA 5BW7A 1NMCB 5EO9A 4R2GB 4U6YB 5L2KA 1INEH 4ZQKB 3C08L 5DHYA 1BLNB 1G9MC 1O7SA 2EDNA 3V6OC 2NNAA 2VXSL 2VITB 3HA0A 4F57H 4BZ1L 2Y07L 1VFUA 1C7SA 1A4KA 2CR6A 3PE9A 4LSTL 4M93B 4Z95L 3B9VA 5SWZE 2RB8A 2P5EA 4MAYC 2NYYD 1XF2B 3NA9L 1G7LA 4OSUH 2YPLB 4PTTA 3CZFA 2BY0A 2YD5A 2W0LA 2A74B 3U2SB 3O45A 4N8CL 3UZQA 5JOEA 5F3BB 1DBMH 3IAPA 1MJUL 4U1NA 3QDJE 3FKUS 3PWUA 1F2QA 1K4CB 2CGRL 4PREA 4K3DL 4ZO7A 3RPIA 3PGFL 3WHXB 2EYTB 1CXHA 4WFFD 4KRNA 1MWAH 1MCRA 1WIUA 5CKGA 2AJXH 3HMXH 4QKXB 2CIKA 4DKFH 5BJTA 3MRGA 1EPFA 5CUSH 1PG7H 3EUUA 5FAAA 3IYLW 1RSFA 1HSBB 4HC1L 1KOAA 4N1EA 4D9RE 4NP4H 2X4OA 1KPVA 2X41A 1FLTX 2JB6A 2MHAA 5KJRL 4CVWA 3D3VE 4MJIA 4KXZI 4MNGA 1DBAL 1U42A 2UYLA 4Z7UE 1C5BL 3T4AB 1LEGB 3MNZB 3PV7A 1E4JA 1FIGH 5GRJL 4HUVA 3E1F1 2XN9D 4CVUA 3QPQC 1RULL 3VFMB 1RJZB 1F90H 4BUHA 2VDRL 2FHFA 1J8HB 2DQUL 4WRLA 1YYMH 2GFBA 4JO1H 4U3CA 5HYJE 1OTSD 4K8RC 3CMOL 1FORL 3FO1A 4Z7UF 4P4RB 2QQLL 5EZLA 2PW1B 4OZHE 2H32A 4K23L 4IBLT 4HPYL 1S78D 3VXME 3BSZL 5E6YA 5I1DA 5GHWL 4PRBA 1O7VA 4ZUTB 2V2TB 5F88A 2AJ3A 4AEHL 2MPAL 1I7ZA 1WC7A 2AW2A 3U7WL 4DEPC 4JO3L 3KYOA 2YWYA 4RIRA 4MS8C 3TFKD 3CJJA 3O6LL 4OZHF 2W59A 4YDJB 2XI9A 1PJ9A 5FHBH 2CR3A 5TF0A 1W8NA 5FHAL 1MREL 3L3KB 5GJTL 5E8NB 3S37L 4U2ZA 5SWZD 4U1MB 3HZMB 1BFTA 3F6IA 3DROB 1ADQL 4WO4B 2ZOKB 5ITBL 3U36A 2AK1H 2ED8A 1UWXK 1S9XA 5DMKA 3ARVA 5L7XL 5D7SH 4RGOL 3KNBB 2M2DA 3QDJD 1A6UH 3LPFA 1U6AH 1J05B 1EFXB 1BQLL 1NC2B 5E99L 2OL3B 3MRRA 1LE9B 2I25N 2XN9A 3MUGB 2R0WL 2V7HA 2EO1A 1UWEH 5FKAA 3OKEB 1T03L 1CU4H 4RCAA 3EYOA 7CGTA 5GS0H 3CUPB 3IGAB 1T1WA 4O4YH 3L3IA 4JPKL 1MQ8A 3KLAB 1RY7B 4MHHI 5E6ID 5IHBA 4M5YL 3D3VD 1XGQB 3SGJA 5K9JL 3DV6B 1MCWW 3BZFA 5IOPA 2OI9B 2HFGL 4PRPE 1A7OH 4KZDL 3D25B 4M7JH 5IFJB 1QPPA 3HMWH 4CW1B 2VUYA 2YSSB 1AD0A 1IC5L 4MXVE 2ADIA 3IDMB 4XPGL 4KKBD 4F37F 3RWHA 5JPMA 3U0PB 2QSCL 5DZOA 3EJYC 4Z78B 3EYUH 5BZDA 4YBQC 3K4ZA 1ZLVH 5HYJD 1HDMB 4FZEL 3QIUD 3CVHL 2DLTA 3EO1A 4BQCA 4WV1C 4GAFB 1TQCC 1JF1A 1BIHA 4ZS7L 2B4CH 5SWZA 3RWDB 4NQVA 4QOKE 3VXMD 3V0AC 5CAYB 4MXVF 1RIUL 5EC2A 3EHBD 2YKLH 5C0NC 4OD1L 3NAAH 3MBEC 3QDJA 4XHJD 3DO7B 2QJDA 5GRZA 5IT2H 4N8VA 4Q2ZA 2ILLA 5DS8A 1G6VK 2Q76A 4AL8L 3LH2H 1IQWH 4ZPVA 5BVPL 2AXHA 1AKJD 2E9IA 5FOBA 1I9JH 4FQHB 5EBLA 3IDNA 1S9VB 1A7PH 1GGYA 3RVTC 1N64L 4LLUB 3BZDA 4KJWD 4YDKH 3G5ZB 2I07B 5HTSA 3RWCA 4HAFA 4KUZH 3ARBD 3T08A 3ULUH 5DD3L 2DQCH 4IMLB 1IC1A 3SCMB 3QJHB 3TT3H 1JMZA 2IANE 4OTXH 3RWIB 5E6IA 3D3VA 1XH3A 3ETBF 1MRFL 3RVVD 3X3GH 5I1IL 1KEGL 2HLAB 2QKIA 4JAMA 3TF7C 3BGMB 4Z7UA 4EXKA 1JWUB 2V7NB 2GTWA 2R56L 1RHFA 4CDHA 1R3HA 3GMRA 4NFBA 1X5LA 3ZE0E 2DIJA 5I1GH 2A77L 4H0HB 3HZYA 4UAOB 5E4EB 4PGCB 4X7FC 3MRFB 4OZIA 4FFVC 1T1ZA 1JWSA 4WW2F 4QRTB 3RGVC 3VDCA 2A9NH 5IBUB 5HYJA 1XR9A 3QIUA 2Z93B 1DLFL 4JQXA 3SDDB 1NQBA 1I8MB 3H3PH 2FHCA 4OZHA 4FG6D 1YQ2A 1QO3B 3ZE0F 5IEHB 3VXMA 4DUXA 4NN7B 4PRPD 4MYWB 1WBZB 3WS3A 2PCPA 1T6VN 2IQAA 4OCSL 1G7MB 2R1YA 3RKDD 1E28A 1CFVH 3GK8H 1MNUH 5F1SA 1U8NB 3CXDL 5GGTL 2H9GA 5I75C 3DHJA 1CQKA 5JW5B 2CRYA 2VDML 1HOCB 5L88L 5DYOB 4PG2A 3KDMA 1AKJA 2DLHA 2XTLA 3TVMD 2AJZB 4M3JA 4NCC1 3OMZA 3IJYB 3ARBA 2OSLA 1RQ5A 4DZBB 3OJMB 4X9BA 3SOBL 4BSVB 2JELH 1UWXH 4KU1A 3QFJB 5TE7H 3G9VA 1NGZB 3V0VA 1BFOA 5C09B 1I8KB 4IOIB 4HT1H 4JG1H 3AREC 1F3DJ 2E27L 1RZ8A 1FAIH 2EEBA 1E6JH 2Q3ZA 5D2NE 2OR9L 2EDBA 5EIQA 2R1XB 1OAKH 4L3EB 5FKPB 5KN5A 2AGJH 5FO7A 1JHLH 2DM4A 3MYJB 4TNVF 1F11B 3MPCA 2MWCA 5EFIA 5M7QA 2NY3D 1GIGH 5I1JL 3LKNB 3T4YA 5DRWA 1LEIB 1CDHA 4OJFL 1RU9H 5CLTA 4TOYL 3MACL 2IAND 5JQ6L 4ZTOH 4LSSL 5EO0A 4GT7A 2H1PL 3AB0B 4HZAA 4PRPA 1UCBH 4PJ7B 1S7VB 1A1NB 1RUKH 5CZXC 4LPWA 1ND0A 1F6AB 1DBBL 1X6LA 3P11L 3KJ4B 4GRWB 5HI3D 5BV7L 1EAJA 4G5ZL 5E56A 4E5XB 2YD4A 5DO2C 4YWGH 4O5LL 1P7KB 2C1OA 4QRUB 1NMAL 1CE6B 3SO3B 3D39E 4WGWB 3KJ6L 4K7PY 1I1AC 3IS1X 1YEHH 4H0IA 4XNUL 4K9EH 1DUZA 3DURA 3TVMA 1ZV5A 4OIAA 5IW6A 4H8WL 4C54A 3MJ9A 1LO2H 2NY1C 5DUPL 4QCIA 4GW4B 4UIMA 4K3HA 3RL2B 5JA8B 3LV3A 1OGAB 1FVCB 1HINH 1KJ3H 1MAKA 5FYLE 4ZUVB 5HHOD 3GMMA 5EOQH 5FF6A 3O9WB 4EUPA 2DWDB 3VRJA 3THMH 3VD5A 3G6DH 1XGTB 4JFOB 3DVGB 2Z9TA 4LLDB 5IMLB 1HNGA 1FQ9C 3P0YL 2XY1A 2O5ZL 3NPZB 4NO2B 4PGBA 3I75A 4NZRL 3V6OA 5TQ2L 4MX7B 1WWAX 4YR6B 1BZ7A 4H1LH 1KPUB 2YPVL 4U6HB 2IANA 4XNYH 1JJUA 2DICA 4WW2A 4O2FB 5J4MA 5EWIL 1OL0A 4P46A 2KL6A 1JIBA 3BPLC 3MRMA 1I8IB 4UT9L 4GXVH 3EJZD 4Y5VB 3IFNH 1YMHB 4ODXB 1AGEB 2N7AA 3DOSA 3K8KA 2BNRB 2PO6D 2IQ9L 3RRQA 1PKQB 4XCCH 3WEXA 2E8ZA 4LLWA 4PUBL 5IROC 3WUZA 1AP2A 1DQML 3FQRB 1GAFL 1TETL 2ZCKL 4A6YA 3ALPA 4U1SB 2W0KA 3EKCA 4H25B 4XVJL 4RNRB 4DKEL 1WTLA 1UA6H 4CDGC 1J1PH 1A1OB 2IH1A 1DLHB 5H2BA 4PJBE 1BP3B 1H3GA 4DN4H 2P49B 3D39D 5F96L 1IGJB 3FT4A 2GITB 3LB6C 5F1KC 1JZ5A 3TN0D 3BW9B 3C5JB 3PF2A 4JFXA 4M03A 4R0LA 1DSFL 4PJBF 3S96A 4JFPB 1NDMB 3GJEA 1N7ML 3E2HC 1JWMA 5IMMB 1I4FB 3OQ3B 5FYLD 3P4NB 5C0FB 1RK0A 3PGCB 3NACL 4WHYG 1ORSA 3HKFA 5C0AB 1MVUA 1CBVH 4PJXB 1T04A 1NAML 3G08A 5E8EA 1TLKA 4KK9D 1AY1L 2GTZA 4O9HL 3VG9C 4HH9A 2I9LA 4KDWA 4MD0A 1ZT1A 1W0WA 2X4SA 2AKRA 5BVJB 2X4RB 2BSTB 3T77A 4Z77A 2PO6A 1KJ2A 1A3LH 3IDGB 3LMJH 1HK6A 1NCBL 3SY0B 1RUAH 3GO1H 1JRHH 4PJ8C 1WVZA 4K7PH 5CIPH 3MGOA 5CJXC 2AV7B 4YO0B 2I5YL 1CLOH 3TPUB 1T0MA 4FQCL 3TIEA 3HG1D 3L3HB 1F97A 4NO3A 3Q48A 2XWJA 4TTDC 3F7QA 3SDXB 1PFCA 1JPFB 1MVFA 1BQHB 4DCQB 3N1GC 4JO4H 3D39A 4N0CC 1FYTE 3FAXA 1A22B 3GGWA 2ZSVA 3VXOA 5JTWA 2BVQA 1MCCA 1W72A 1A7QL 3GI9L 1FSKC 3TN0A 5DT1L 1HQ4B 1E4KA 2OQJB 1JNNH 5FV2A 1P1ZA 1ZHKB 4KK5D 3L5WB 4XPFH 1CICD 4U1GC 5EU6B 5F70A 5DEFB 4YJZL 3RI5K 2DQDL 3JXAA 3D5OF 1NGPL 4OLWL 3GSQB 1JUFA 4QXUL 3BISA 4C83A 3KPSE 2GYSA 4U1LA 1BAFL 4HMDA 3QUKA 3REVA 1MUJB 4M00A 1XF5A 4WY7L 3QXAB 1AQDB 1EEYA 4QHLB 1C5DA 1HXYB 4GH7B 1MEXL 3D2UD 3B6SB 3CSGA 2ICWA 3K2UH 4LCIH 4V1DE 1JFQL 1Z9SA 2EDXA 2VN7A 3C8DA 1R5WB 2XV6B 4C56B 1U8PA 3OZ9L 3BKMH 5JQHC 3SPVA 3X14A 4ETQB 3N50A 5EU5A 3LEVH 1S7QB 5EOCL 5E2UH 1TZHA 3ELAT 2HN7B 2FJHB 2RBLA 1D5BA 2WNGA 3BXNA 3FOMA 1DR9A 3TV3H 1I1FA 2HMID 3T2PA 3HG1A 3EYSH 2LU3A 3WKML 5EUKB 4QRRB 2PYEB 5HPOA 2CKNA 4AT6A 1KIRB 1XT5A 2NCMA 4G6KH 1EGJA 1KN2L 2BY2A 4M1DH 1U8QA 5CEYB 4PJFB 4G9DB 3SJVB 1IFHL 2ZKHH 3NN8B 3QR2A 5DI8B 4F33A 2G9HA 2JJTA 3SE4A 5CZKA 3L1OH 2X1XR 2RFXB 4R4FL 1P6FA 1KUMA 4LFHD 1MCFA 3H7BA 4XCNB 3QISA 4XX1G 1MCJA 1CICA 1A14H 1ZKAA 2BNUA 4PJHB 1SEQH 1LILA 4HUNB 4PJBA 5KANI 4UDUB 4LCCC 3LD8B 1JTTA 4NT6A 2QQNH 5KS9E 2N7BA 4OB5H 2BNQE 1V7NH 1IC7H 2I60L 4ODHH 3OGCA 1NAKL 3QUYD 2RJMA 3QCUL 2VAAA 3L3GB 2EYSB 1FFOB 4WU7B 3GFUA 3UBXG 5KS9F 2N4IA 5I8EA 3P0VH 3WCYA 2XRAL 3KPSD 4KVNL 5ALBL 4KVCL 2P43B 3PDOA 5ICYA 2KKQA 4L8SC 1F4XH 4Y0GA 4QHNB 2EEAA 3UJTH 5E2WH 3DTXA 2GCYA 1J11A 5C07B 1A6AA 1RJYB 4GXUN 3I50H 1UACH 3LDBB 1C5CL 1N5AB 3FQXA 4P5KA 1SYVB 1EUUA 1Y18B 4PY8I 3VJ6B 4FZ8L 1WBXA 4WHCA 3OKOB 4J1UB 2H2PC 2Y36L 1CFQB 4JQIH 1OWWA 4ONFL 3PL6C 5DFVC 1CD1B 4OI9A 3LSOB 5KZCD 2VKXA 3RTQD 4EI6B 4YDVB 4XBGB 4OLYH 1YEDA 3NIGE 5C0JA 2V17L 2EDKA 5EBMB 3G04A 4WENB 1IAMA 5T3XH 1IM3B 3RZCD 4JN2B 1FYTA 3QIWC 3OAUH 1WZMA 1RAMA 2JJUA 5JHLH 4OQTH 4OLVH 5T5FH 4AMKH 1XGUB 3IJHA 3QUYA 3RA7H 1BVLB 4DTGH 4K8RH 3NIGF 1H3VA 4YDLC 4Q6IC 1IGFH 3GSNL 3RNQA 1FFPB 4XP1L 5BV7C 3IS0X 4OCRL 4QTHA 5IHUH 1DVFB 3MV7B 5DWUL 1MJ8H 4NHUB 2Y7QB 4MB4A 1NUNB 3MRIA 5HD8C 3VCLA 3F7PC 3TZVC 1H5BC 3DGGA 3KPSA 2NXYB 3ZT7A 1KTKE 4ZD3L 1J8HE 3JWDL 4NGHL 2AJYH 4IRZH 4QY8A 2BNQD 4K7FB 1W0YT 2HFTA 4H8WC 4XH2B 5ETUB 4WGVB 2VQTA 1HILA 1OM3L 3DNKA 3QEQB 4LSDA 3K4DA 4FFYH 4JFHE 5ICZB 4OLZL 1A47A 5KBNC 1J1OL 4C59B 1EIBA 3I2CH 4YHNB 3BKJL 3QJFB 4PV8B 4YHOL 2WP3T 5E03A 4MVBD 1CZ8H 3GHEL 4WCYL 1IKNA 2YD8A 1YMMB 1VFMA 3NABL 4CNIB 2DL2A 4X6FB 2CUMA 2VDLH 1ZWIB 2ARJA 4I1NB 5AZ2H 3INUH 3H9ZA 3RTQA 3LN4B 3ZKXC 4Y1AE 1ZVSA 1UM4H 4WHDA 1CFTA 5J8OA 4GLRI 3WO3B 2DQFA 5ADOL 4Y19E 4HZLB 1N0XH 3JV0A 3RZCA 2VDKH 4LLMB 5DA0B 4AZ8A 5CLWA 2W60A 2FX8L 1A9BA 2AAVA 4U7MA 2FD6H 2W0FA 3EFDL 5DMIH 4P57A 4F7PA 4M6AA 1N5YH 3LHPL 3CFJA 2YC1A 1UYWH 3WLBB 3ARYA 3OPZL 1IEBA 3BO8B 4OCXH 5HI4C 1LQSR 5ITFB 1IEAA 2F58L 3WFEH 1YUHB 2J6EL 1AJ7H 3GBNH 5ERWA 3VH8B 5F7HA 1UJ3A 2FIRT 2ZP0T 1H3WM 4XWGL 1CIUA 1RV6X 3QEGL 4LCUA 2O5YL 1V05A 5KS9A 3MUJA 2BNQA 3Q2CA 1JMXA 2FH8A 4EBQH 5GSVA 2ARWA 3MYZA 2YEZB 2G5BB 5F6HI 1A7NH 3M07A 2QSQA 4IRJD 3V0WL 3ARRA 1PQZA 4H20L 5F6IC 1M7XA 4EI5C 4X7SH 4L29B 4YAQA 5F89B 3W39A 4PJ8D 3HS0A 2MQ3A 5CZVH 3AAZB 1LE5A 5DGRA 3WO4C 2CK0H 3FRPA 4ODTL 3ROLB 1F8TL 5DD0L 4HIXH 3OKYA 3S5LG 2J2ZA 5JW4R 1INQB 4K3EH 5DQ9B 5I15L 2QR0B 2D2OA 4GMSH 3V7MA 1NSNL 4P3DB 2ID5A 4JFHD 2OJEB 5JXAL 4YDIL 2MCG1 3KYKH 4DGYH 3N85L 4NFCA 3I02A 3HLAB 2SEBA 2HJLA 4Y2DB 3U2SA 2D7PA 3ARPA 3QHTC 3ZHKA 5GIRB 3NIDE 3QXTA 1LEKB 3RX5A 1KJVB 3DWTA 1K4CA 4TSBL 4M1GL 3HPJB 2X4QB 1UKTA 5D5ME 1D5MB 3MX0A 1TPXC 1WIPA 3WHXA 2B1HL 2WBJB 3D1MC 1E27B 4DKAA 1Q8MA 1X44A 3OR6A 4Y1AD 8FABA 5E2VL 1RMFL 5C86A 5KSVA 4S1QL 1KCSL 4Y19D 4FNLL 5KVFL 3P40A 5D8JL 3NIDF 3F5WB 3R4DA 1CT8B 1LNUB 5D5MF 1HSBA 3OKDA 2DLGA 3OKLB 3E6HA 2C3WA 4NKIL 1GGCH 3VFGH 5D7IE 5C70A 4KTDL 2GT9A 1NC2D 4IRJA 2L7UA 4S2SB 2Q87A 4JRYB 4LNVA 1XZ0B 4OZFA 3K4AA 4P2OD 4PJ8A 4AENA 1S7UB 4U6VH 3T0BA 2OXHA 1UM6H 3MOBH 8CGTA 2GJ6B 1J8HA 1Q9LB 3HC0A 4XVSH 5GGQH 3WE6B 4GG6A 5D7IF 1T3FA 5IR1B 1ERNA 4L8BA 4CL7A 1X5GA 1JHKH 5HVGB 5FK9A 4KKLD 4ORGA 3RIAF 4QRQB 1R24B 2ICWI 1F58L 2AVGA 5DHVH 4LDOB 2V2TA 4LQFH 1Q9OB 2DTMH 2GJZB 5C0RL 3FT3B 2GQHA 4JHWL 4HFWB 4MA7H 4K2UL 4XCYB 3RJQB 1CGWA 4KXZH 1X5IA 1OGTA 2EKJA 3V52L 5C8JA 1K8IB 4D0DA 1S3KL 1T1XB 1WZ1H 3ULVE 4NZUH 1MFNA 2ADGB 4X98A 4Y1AA 3L3KA 4HHAA 5CEZE 4QWWD 1BD2B 2UWEE 1JPTL 4G8EB 4Y19A 1WT5C 4P48A 4JJ5B 4WO4A 1Y6NR 2F19L 4UNUA 1SBSH 2BERA 4C4KT 5BQ7A 5IHLB 1AGCB 1X5YA 3L9RA 1TMCB 2EO9A 3KNBA 4MWFB 3ULVF 3SGEI 1ZLUK 3T8XB 2IPTL 3O6FD 4XBPB 2X7LB 1NC2A 5IV2A 4QT5B 4P2RB 2UWEF 3AFLA 3SE8L 3JV5A 4XCEB 5E9DB 1U8IB 1V5JA 2OL3A 3GMNA 4YPGB 3V5KA 1EFQA 4L3EE 4PJIB 3EOAA 5F9WB 4P2OA 4OLXL 4YIQA 3Q5TA 3G6JB 5HVFB 4PB9H 5GRUH 4P5MA 2R0KH 4W4NA 2OMNA 3VXRB 5D7LB 3ILQD 1RURL 3WHE1 3RAJL 1XF3A 2CLRA 5IB4B 3P9WB 3KLAA 3NZHL 4JZJC 1XGQA 1U36A 1GSMA 1DFBL 4TN9A 1CG9B 4OIIH 3HAEG 5IK3B 5E7FA 1IL1B 3O6MH 1B90A 4PJ7E 5B4MD 3BMVA 3DRQA 4PLJC 2Z0BA 4ZO6A 4CW1A 2H6PA 3P77B 4R96A 3C08H 4NQDB 3U0PA 3MRHA 4WHTA 4Z78A 3AC0A 5LGHL 2VXSH 1HCFX 4DN3L 4BZ1H 2Y07H 3AM8A 3JUZA 4GRLB 2XNAA 4PJ7F 4LSTH 1NCCL 1IGCL 4Z95H 1NEZA 1OARH 3F58L 2H8PB 4ZPTA 3NA9H 4PR5A 2EDLA 5DJZB 4LEOB 2UY7A 2W9EL 4ELKB 3O6FA 5E95B 4N8CH 1MJUH 4OF3A 5D5MA 5F7EL 3O2DL 2CGRH 4XB7A 4K3DH 4LBEA 3PGFH 4Y4KC 4M9PA 5CEZD 2VDOL 4CMHB 2EC8A 1S9VA 3GM8A 5IFAL 1KB5A 4R90L 1BWWA 4FXLA 2I07A 4JE4B 5DD1L 4L8DB 3L7FA 3IXAB 4LKXB 3RDTC 5I0ZA 1A7BA 3C8KA 3C9NA 5KSAD 4HC1H 2YPKB 5D7IA 1NUGA 1KT2A 5KJRH 4GBXB 5EB9A 35C8L 3BGMA 3MRJB 5D96C 3WDHA 1U8HB 1U95B 1DBAH 3MFGB 4NM8L 12E8L 1IAIM 4G8FB 4L3ED 1C5BH 1HZHL 1BWMA 1U8JA 3BE1H 4IOFC 4U7KA 4MDIA 1XGYL 5GRJH 5HGAA 4BH8B 5D2NC 1RULH 4LLQA 1TIUA 2BZDA 3MRFA 4QGYA 3QRFM 4OZ4B 5EZOL 2K7QA 1JPGB 3BKCL 1U2CA 2VDRH 3QXUA 4LVHC 1UT9A 2OTWA 3QNXA 4QRTA 2DQUH 1KTDB 3QZWG 1NGWB 3V6FB 2LTQC 1JVKA 1YYLH 1FYHB 2X1QA 3CMOH 4YK4C 1FORH 4FP8L 2QQLH 5IW1B 5E8DL 5HJ3B 1JGEB 4K23H 4HPYH 1WBZA 3HC4L 3FQTA 5GHWH 4ZFOB 3CK0L 1MH5A 1FNEA 2ITDB 2VR4A 4AEHH 3JWDC 2AJVL 1RZIB 1W0VA 3EBAA 2AQ2A 4EQ2A 2MPAH 2NY4B 4O58L 3U7WH 3QUZB 4H0GA 4JO3H 1KCUL 4X4YB 2FR4B 1YECH 4IS6A 3BIAX 1HOCA 1QKZL 3O6LH 5DYOA 2E6JA 1FP5A 3TJHD 5FECA 4XMKH 5FHAH 1KC5L 2UWEA 1MREH 1NGYA 1M6OA 3PG2A 5GJTH 1FVDB 3S37H 4I3GA 5D7JC 2ZSWA 3IJYA 4X7TA 1FO0A 3SBWA 1ADQH 4I2XB 3QH3A 2VB5A 1EHNA 5ITBH 3ZKNC 4FXGB 3TEUA 2NXZC 5KSAA 3KPRB 1NGZA 1WEJL 5L7XH 2R1WA 3BP5B 3HAEH 4RGOH 1ZLUH 2R69L 3ARDD 1U91B 2GK0A 3NZ8B 5D1ZD 1BQLH 4PJXE 4MD5B 4TSCH 5HGBB 4L3EA 5FKPA 5E99H 3FL7A 3JV4A 3MR9A 4LIQL 5AYUL 4DAGL 2R0LL 5FFLA 3BIBX 3MYJA 4X7CC 1F11A 2R0WH 2Q6WA 2JB5L 4OD2A 1FZOA 4Y5YB 1T03H 3BD3A 1ZSDA 4DFHA 1HXMB 3S9DB 3LKNA 1TTUA 1TJIL 1BQSA 3EW3B 3CDGB 4PJXF 5B8CC 1M4KA 2AV1B 4KHTL 3U9PL 4UOJA 1DN2A 2APTA 4JPKH 4M6OL 5IVZB 3QEHA 1R3KB 5I1KL 4M5YH 3PV6B 5A2LH 5F21B 1QPXA 5K9JH 1G9EA 1HHJA 2HFGH 4PJ7A 4APQD 5TF1L 4KZDH 3FB7B 5L8KB 3SN6N 3GIVB 1MCOL 3F8UB 3V5HB 1Q0YL 2HRPL 1IC5H 4ZSOB 3LN5A 5DJDA 4QRUA 4XPGH 1CE6A 3QNYA 2DBJA 1OTTC 5JOFA 5EN2B 4U7SA 5CBAA 3MREB 4FZEH 3CVHH 4IRSC 3D18A 4M7LT 5KG9A 4E41E 4R7DA 4M4PA 1X5FA 4PYGA 1RIUH 2NY6D 3IKCB 4Q9BA 4OD1H 2F54D 2ED7A 1FVCA 4RZCB 4RX4D 5LCVL 2AQ1A 3ARDA 5FUOL 3O4LD 5D1ZA 1JBJA 3MXVL 2DQTL 5HHNB 4AL8H 4RBPH 5C7XL 4CMMA 5BVPH 3DVGA 3QQNA 4DUWA 1CDJA 1WFNA 2NY0D 3ISWA 3EYVB 4NO2A 4PV9A 3EFFA 3DUHA 3CFCL 1N64H 4MQXC 1KYOK 1D6EA 4N0YL 5FM5M 4GG8A 4ODWB 1FE8L 4Q97A 5DD3H 2HJFA 2X1WL 1PKOA 4IIQC 3BZEB 3SE3C 2C7UA 3K1DA 1MRFH 3I3DA 1TTFA 5I1IH 1KEGH 4M7KL 2BX5A 4APQA 3BAEL 4MNHB 1I8IA 4G7YL 2IALA 4KQ4L 4YBLB 1X4YA 4OCWL 4QRRE 1AI1L 1AGEA 3PWJB 3A6CL 2A77H 2PYEE 2Y06L 3U7AA 4LSVL 2H2SC 1MHPL 1I75A 2HVKB 2IADB 1PBYA 5E00A 2AXGB 1T4KB 5C0GA 1QHPA 3HE7B 3S3JA 1RUML 3CSPA 3W11C 1KCVL 2WIMA 2AEIT 5ALCL 4YUEL 1MIML 2H45A 3Q6FB 4X6EA 5K9KA 4ZG1A 5HVHC 4Y5XC 4NRZB 2X4PA 2ZPKL 4AIZB 3VWJC 1VHPA 4RNRA 1FVEB 1EMTL 2FEDC 4XP6L 2IJ0C 1FZMB 4OCSH 4RMUA 1JK8A 2IBZX 4BH7A 4RX4A 1YN6B 5DK2B 3O4LA 3G5VA 1F2XK 5D1QC 5HY9B 3CXDH 5GGTH 4PLOB 3ARGD 4PJ9B 3WSQL 4FQ2L 4Z5RA 1IGJA 2MCPL 5L88H 3W9DA 4JFYB 4BM7A 4X6BB 2ADFL 4E41D 3BW9A 1KYOJ 5ACZB 2XZCL 4LSQL 5MERB 3B8SA 1HI6A 4G6AC 5TE6L 4OFPA 1TCRB 1LGVA 3NBNA 4XTRC 1I9IL 3DO3A 1F6LL 3QO0B 2V5RA 1A6ZB 4WJ5B 3SOBH 3ZL4L 4LRIA 3H3BC 1YEEL 2WQRA 3BRGC 3KLHD 3TYFB 2VERN 5I66B 4LF3B 3IDYC 3BH8B 3MGTA 2BK8A 1VKXA 4ZDHB 1OP5K 2E27H 3HE6D 5EC1A 4UINL 4M9OA 4LP4A 1TQBB 1JNHA 2K9UA 2OR9H 1B4RA 2WWMC 1ZT4B 5C07E 4DGVL 4PG9B 3C60D 1T0NB 1HHGB 3WXWL 4MA1C 2BSTA 5JDSB 3VGFA 15C8L 5F93C 3VRIB 3Q0HA 5I1JH 3U6RB 5DQDL 1J12A 2ZUVA 4OJFH 1CDYA 4NO5A 4TOYH 5E2TL 3MACH 5JQ6H 1MHHB 2BSSB 3OB0K 3FQWB 3CC5A 4YO0A 7FABL 5DRNB 4LSSH 1RZGB 3R1GL 5HPMB 2H1PH 4GW5A 2H3NB 1S8DB 4D9LL 4PGEA 3L3HA 3GJFK 3UTQA 3DRTB 3MOAL 5DK3A 3CDFA 1DBBH 5BV7H 4PLNC 4G5ZH 1BQHA 5KANG 5CMAA 4DCQA 1PEWA 3ARFD 2HFEB 4FQXB 3ARGA 1MFCL 2B1AL 3MMEA 4O5LH 1KIPB 1H0DB 1NMAH 3KJ6H 1T66D 4QLRA 1MI5D 4RGNB 3RVUC 4Q7DA 4XNUH 4E41A 1QEWB 4HUMB 1HQ4A 1RZFL 4BYHA 2OQJA 1EHAA 5DJ8B 2WINA 4H8WH 4L9DA 2D7NA 3BDYL 5DEFA 5I9QC 2R15A 2ITCA 4NUJB 5DUPH 5A1AA 2BSED 3LKQB 2XTJE 4HGWA 5ID1A 4JZJA 4GUPA 5I1EL 5JHDB 3DYOA 1OTUC 2HH0L 5GISL 4LNRA 3QUMH 1CLYL 5HDBE 4NKOB 2Y5TA 3LIZL 5ENWB 5IVXB 2M1KA 3HE6A 2ZUSA 5C0EB 4O2CA 4AM0B 3QXAA 4KK8D 4FQPA 1U3ZA 2D4DA 5GGRY 2BMKA 3PIQB 3C60A 4OF0A 3P0YH 4KDTA 2O5ZH 1DL7L 2P8MA 4KI5E 4NZRH 1KSRA 5TQ2H 5TDOA 4R8WL 2D03L 5HDBF 4LDEB 1JZ8A 3DX6B 2YPVH 3JWOL 4N5EC 2FJHA 3GSOA 1YMME 4X8JA 2DMBA 1NMCC 4OGYH 4R2GC 4TUOA 1SJHA 5EWIH 4XMPL 2Z4QB 4KI5F 4S10A 5FO8B 4UT9H 4QRRA 1KFAL 4JY4B 3LKPA 4M93C 3ARFA 1TITA 1KIQB 3LKRA 1S7RA 3SKMB 2E7BA 5CKAA 2IQ9H 5SWQB 1MI5A 2P1YA 5DI8A 3QDME 4ONHB 4PY8J 1RIHL 3V7AG 5MEOA 3FB6A 1L6XA 1NKOA 4KKCD 4PUBH 2RFXA 2DN7A 2BFVL 4XCNA 3PGDB 5MP6H 5MENB 1HYSC 1GAFH 4U1KA 1TETH 2ZCKH 5HSFA 2C3VA 3NIFE 5F7LB 4Y4FB 3VFVA 3ZKND 4BKLA 4XVJH 4DKEH 1JF6A 2EKSB 5J6GA 4WTZG 3V4VL 3ARQA 4UDUA 4WEUD 1A9EB 2VZ1A 3FN0L 3C6LD 1GGBL 3PJSA 2HFFB 3MLPA 4PS4L 5I8CB 3PABB 3S97C 4EUPG 3D0VA 5F96H 3OAZK 1NCAL 2AJUL 1TZIB 3NIFF 3QIBB 4XP9L 1R0AL 1YNLL 1A1MB 4H88H 1GL4B 1W2KT 4EN3C 1WZKA 1FL6B 3L3GA 2EYSA 4GFTB 5JUEL 1NBYB 1DSFH 1UENA 4OI7A 4KJYB 2B39A 5F8QC 4DZ8A 4OQ1A 2XTJD 3GMPA 2KBGA 4GKSA 2Q20A 1N7MH 1D9KC 4E0RB 2EEDA 3FB5A 3QEUA 3LKSA 3NACH 4QHNA 1WAAE 4KRPB 5I71B 1OP5H 1NAMH 5IIEA 1FFNB 1OP9A 1QSVA 1AY1H 5C07A 4O9HH 1RJYA 5TQ0L 1VEOA 2CRIA 5E5MA 5FB8B 1A4JA 1IAIL 1QBBA 5IF0A 2GW5A 3FN9A 4JVPA 2J8UB 4KI5D 1L0XA 1G9NL 1NCUA 2FGZA 5F1IB 1WBYA 5A2FA 1OTTD 1NCBH 1ZGLP 4NC2B 1CFQA 1WAAF 3P9LB 5I6XC 1YMMD 5F9JA 3V9FA 4E42A 1VFAB 1SEBB 4NQTA 4ZAKC 3BRDA 2I5YH 4FQCH 5C0BB 1DE4A 4WI4A 4TNVK 5D93B 3GJFH 1MLCB 4YDVA 2KPNA 1N59B 3VXUB 2EYRA 1MWAL 1B0RA 1NFDB 3OKNA 1U8LA 3QO1B 3W0WB 3C6LA 4LVOB 1EEZA 1BREA 2R2HA 4JZNB 4NPYA 1EO8L 1CGSL 1TNMA 5GGUA 5CEXB 1PG7L 3OXSB 2IH3B 5KOVC 3QDMD 1XGUA 3VXNA 3BP6B 1LWRA 1DQQB 2OTUB 2LFGA 3B9KC 1OF2A 4U6XB 4NP4L 1A7QH 3GI9H 5DT1H 3VW3L 4YHKL 1ZLSL 5D6DA 3MV9E 1DDHB 3DX9B 2MSPA 4NHUA 4KROB 4Y4HB 2DQDH 3F6LA 3CVIH 1NGPH 4OLWH 5ECJE 1KPRA 2GJ6E 4QXUH 2J6EA 1FDLL 1BAFH 2BRRL 4WWKD 4BSWA 4K7FA 5D9SA 5CJ5A 3T0EC 4JO1L 5ISZB 4RMRA 3GRWA 1G7IB 4WY7H 3V8CA 2HT2D 3HC3H 1MEXH 3QXWA 1XR8A 4FXKA 2X4NB 5F6HJ 2EDJA 2OI9C 5C0IB 3OZ9H 2CIIA 1QFUL 1T83C 3ARTA 5EOCH 1YMMA 3IDIB 3X13B 3LPWA 4CNIA 3OSKA 1FG2B 4X6FA 5J9PA 4ISVB 3B5TA 1ZWIA 2Z31D 4A2LA 4BFIA 3QXDB 3R0NA 1NC4B 1CGUA 3LN4A 2FEDD 3P4OA 3WIHL 3WKMH 4MDJA 5I76A 2BVYA 4HZLA 4I3RL 2FBOJ 2VLJE 5IEKB 2DWEB 2HVJA 4LLMA 1UVQB 1QBLL 5HDOA 4UV7L 5BCAA 3TO2B 4L5FH 2WWKT 5GRVL 2B8OT 1U3HB 1KN2H 3QDMA 2AK1L 4B7IA 2VLRB 1UG9A 3B3IB 5GS1C 1IFHH 2EXYC 3HNSL 3BRFA 5IUSA 4I18A 4WW1B 43C9B 1QLFB 4P2RE 4R4FH 3WL9B 4PRNB 4JM4L 4ODUB 3RVWC 2UUDH 2JJVA 4Z76B 3DXAE 4HLZG 2DDQL 4NN5B 5EPMA 4ZYKB 5H37H 2DLFL 3WJJC 3ME0A 3WBDA 4Y16D 4F9PC 2D7MA 1BIIB 5FA4B 3NFNB 1UXSA 1FZJB 1FRGL 4ENEC 1GZPA 1IAII 4WWKA 3BN9C 3HB3C 1JPSL 3BMWA 1D5XA 4GLRH 5I8OL 1XF4A 1TFHA 2I60H 1AR1C 1LK2B 1SM3L 2WWMD 2YEZA 4JY5L 3OAZH 5FGSA 3QYCA 4MXWL 4RQQA 3SCMC 2CRZA 4CN4A 1NAKH 4NKMB 3QCUH 3OAYH 3MV9D 1GJIA 4MJ6A 1TXKA 1U58B 4L29A 2I27N 3JV6B 4WU5A 4J6RL 3BGAA 5FYJL 4PP2B 2J88L 5CS7A 2XRAH 4M7ZB 2GJ6D 3FFCB 4KVNH 5ALBH 5EO9B 4UAOC 5IG7B 4KVCH 3ROLA 2Z31A 1WAAA 3VE0B 5E4EC 5L2KB 2GEEA 5DHYB 2EIDA 2E7LA 2MJWA 5DQ9A 1F45A 2NNAB 2QR0A 1IE5A 3NCYS 4P3DA 5KSUA 4HEME 1A4KB 1CGXA 1C5CH 1GOHA 4MJ5A 5IGXH 1MPAL 4NN7C 2P5EB 4FZ8H 2ICWJ 1LEKA 3WFHA 1G7LB 1CD8A 2Y36H 2EC9T 1CVSC 4PTTB 4ONFH 3O45B 4Y8DC 5IMKA 4KY1L 1INDL 5L2JA 4YHLL 1PX4A 3RPIB 4XGZA 2HYMA 2VLJD 5EU7C 2V17H 1OTUD 4Y16A 1LNUA 1KEMH 1VACA 2XWBA 2CIKB 5CJQL 3OKLA 4B50A 3MRGB 5BJTB 5FGBA 5C3LD 5A3IC 3ULUL 2BVEA 4L9LC 1KTRL 5GJSL 4TNWF 2DQCL 3L7EA 2X70A 5GS3A 5C0CB 1U3JA 4OTXL 2BHZA 2Z35A 2X4OB 3MV9A 3FT2A 1KPVB 4W81A 2Y23A 2MHAB 2JB6B 4F7TA 4S2SA 5EUOE 3GSNH 4MJIB 3DXAD 4XP1H 4OCRH 4CJ1A 5DWUH 3PQYB 2UYLB 5C3TA 2GJ6A 3D48R 2JLLA 2YZ8A 1T7ZA 5CJ8A 1E4XL 3WE6A 4HUVB 3PNWA 4ZD3H 3JWDH 3R06A 4NGHH 1IM9D 4XI5D 3CLFL 5TGBA 5EUOF 3ESVF 1T2QL 2GFBB 4JCLA 4ODSL 1R24A 1OM3H 1MIEL 3FO1B 5KVEH 4OLZH 2D0FA 4NJAL 1Q9OA 1J1OH 4LDLB 5EZLB 2H32B 2Z8SA 3AB0C 1U93A 4HFWA 4CGTA 2FGWL 4XCYA 4YHOH 4X0KB 5M94B 3GHEH 4PRBB 4WCYH 1CIDA 1VCAA 5F88B 2AJ3B 3NABH 1T1XA 2W9LA 1I7ZB 1WC7B 4LFHG 2ICES 3KYOB 4RIRB 3SO3C 1CS6A 1UEMA 3TNMA 2VLJA 2LVCA 4JJ5A 5INDA 5ADOH 3EO0B 2AS5M 3WDJA 3O3AA 3JWOC 4I2XE 2FX8H 3E6FB 3EFDH 4MWFA 1DTUA 2XQYK 3LHPH 4O02L 3W82A 1P7HL 4P9HL 1S9XB 4OGAD 5DMKB 2VR9A 3TT1L 1ZHBB 2VL5B 3OPZH 4HJGA 3U4AA 4YPGA 1MY5A 1WISA 2QADB 5H94B 3DXAA 2FLRT 3ILPA 2F58H 3O9WC 5CGYC 3S88L 4OI8A 4FRWA 1N6VA 3MRRB 4XWGH 4D2NA 1EO5A 1PY9A 3QEGH 2XN9B 4JKKA 3KPOA 1YC7A 2O5YH 4D9QE 2NR6D 3BPCA 2V7HB 2VSDA 1IM9A 5FKAB 4L4VE 4G43A 1PYWB 3NGBB 3EYOB 3DETD 1Y0LA 4GBXD 1CG9A 1T5WA 2IAMC 5IK3A 1T1WB 2XQYG 3L3IB 1ZGLA 3V0WH 2CH8A 4MXQD 4H20H 2O61A 3SGEH 1IT9L 2ZG3A 2APBA 3NMEA 1O5DT 2KZ1B 2QBWA 2QSVA 4Y5VC 4ZSOE 2P48B 1RVFL 1BVZA 3NOIA 4ODTH 1AD0B 3MLXL 1F8TH 4LAJH 2ADIB 5DD0H 3RWHB 5JPMB 5J1SC 3STLA 4KWUA 5I15H 1JZ4A 3QDAA 3DMMD 5BZDB 3EO1B 2V9QA 2H8PA 5JXAH 1JF1B 1SMOA 3N85H 1UB5A 5IBLC 5SWZB 4NQVB 1LO2L 1OLZA 3AU1B 5EC2B 5GGSY 1OAZH 3B9KD 4TSBH 4M1GH 1LD9B 3IFOA 1KN4L 2OS7A 3QDJB 5EDXA 1E4XI 2B1HH 3RZWA 4N8VB 3MCG1 3AS0A 1P9MA 5E2VH 1RMFH 5J3HC 3IVKA 1ZAGA 1G9NC 3EYQC 1QFPA 4S1QH 4ZPVB 5A40E 1KCSH 2GI7A 4FNLH 4CU7A 5D8JH 5FOBB 5KVFH 5EBLB 3FOLA 3IDNB 2DYPD 3LS5L 4HUUB 1AHWC 3A6BH 4ZFZA 1BM3L 3G5XA 3RWCB 3MRQA 3T0ED 2CO7B 5JZ7C 4WEBL 1M71A 4NKIH 4GBXA 5GZNC 3H42L 2Z91A 4KTDH 3KVQA 3TP4A 1U95A 4KHXL 5E6IB 5EUOA 4G8FA 2YXMA 3LEXA 1S9WA 2QKIB 2FYYA 4JAMB 1QRNE 4Z7UB 4G9FE 5EU4A 4OZ4A 3ZYJA 4HFUL 5EBWB 1R3HB 1EEQA 3MOQA 3MRKB 2XA8L 2HLFD 4P3WA 5ABDE 3HZYB 3V6FA 1WQVT 4RWHA 2WANA 1FFQA 3EIFA 4L4VD 4TVPD 3VMPA 4OZIB 2APFA 3FFDA 2NTFA 1T1ZB 4KH2A 4NQEB 5IW1A 3DMMA 5FYKL 5HYJB 4NCDA 5DVKA 1JGEA 2JCCA 1XR9B 2EDQA 3QIUB 2CKBA 1F58H 5DGQA 4Z0XA 4XAKE 5C0RH 3VXMB 4JHWH 3WS3B 1J1PL 2FR4A 2R1YB 2Z92A 1E28B 4X4ME 3V52H 2DQJL 3FONB 3NH7L 1S3KH 2LABA 4N5UA 6FABL 3RVWD 2H9GB 4UTAL 1FVDA 5A16A 2E8YA 1JPTH 4N1HB 3KDMB 5TFSH 1AKJB 3MCKA 3EZ8A 3C2SA 5JDJA 2PXYD 5GPRA 1J0JA 2F19H 3TPKA 4KGJA 4RRPG 2DYPA 5I8KL 4YNYA 3WJLC 3ARBB 1CDCA 2MMXA 5EOTA 2IPTH 1U91A 1BBJA 3NZ8A 4QXTA 4YHYB 5F3HA 3W5MA 4GKNB 4HWNA 4NO0B 2ESVE 3V0VB 3SE8H 1BFOB 1OAXH 3AMLA 4DVRH 3QNZB 4NC1E 4HKBA 4L3CA 1Q9WA 2DLIA 1RZ8B 4TYUA 2V9RA 4ZO8A 4OLXH 2EDOA 2APXA 1T21A 4Y5YA 3SKUD 1U0QA 5FO7B 1JYVA 2UZIL 4BZYA 4P4KD 5SX5K 5DQJB 2D7OA 3UX9B 2AV1A 4L4VA 1RURH 3LMJL 5FOJA 3RAJH 3WS6A 1X9QA 1JHTA 5EFIB 4KK6C 3SDAB 3NZHH 5JLZA 3T4YB 5DRWB 4LPYA 4MD4A 3B9EA 2A2QT 1DFBH 4JFEE 1KTLA 2B20A 2RCSL 4YFEA 3B5HA 1GOGA 3PWNB 1QRND 5DURB 4PRPB 1IBGL 5DC0A 1OW0A 4EVNA 1PEZA 4G9FD 3MNVA 1VSCA 3FAWA 5J11C 1OSZA 3HE7D 5LGHH 2GSIA 4XNZB 4DN3H 3BQUD 4RGNE 4NQSA 1H9VA 4WUUE 2C1OB 1RZKL 1G1YA 1NCCH 1IGCH 2PXYA 1DUZB 3DVIA 3F58H 3DURB 3IDJB 4ESKA 5IW6B 3IKCA 4XAKD 3QDHA 1TTGA 1YEKH 4HJ0C 2W9EH 32C2B 4RZCA 2PYFA 5JHDE 1DQTA 4QCIB 4UIMB 1J5OL 4JO2L 2VQUA 5F7EH 3O2DH 2A0LC 2F74B 5IVXE 4NBYB 2ATPA 4AQ1B 1FGNL 2P8LA 4HCRA 3LD8C 3QQ3A 4G42A 2EE2A 3GMMB 5FF6B 2VDOH 4YXLL 1FNGA 3VRJB 5IFAH 4R90H 3O8XC 2B2XL 5DD1H 1A64A 4P4KA 3BIKA 3K2UL 1C12B 3I75B 2R23B 5IVXF 2F53E 4X7EC 4J3VA 1BZ7B 1CN4A 4PLKC 3LEVL 5JW4M 3KYAA 2HP4A 2ESVD 5FA3A 2D7TL 2IANB 35C8H 4NM8H 1H8SA 12E8H 2VSCA 3T2OA 4CU6A 1FV1A 1HZHH 1QRNA 3U48A 3MRMB 1XGYH 4G9FA 4FA8A 3JTSA 4X83A 2IADA 2QEJA 2HA1A 5EZOH 5FUCC 3GSXB 3BKCH 3ULUC 3HE7A 3LDBC 3BQUA 4B5EA 4U1IA 1MFEL 2ZG1A 3O2VL 5E8DH 4HXBL 4OBRA 4JFED 3WEXB 1BHGA 1PVHA 5MENE 1YNTA 3X3FL 3WUWA 3ES6A 3H8NA 3HC4H 1NEZG 2VTFA 3P9MA 4YE4L 1AP2B 1ZXQA 3RY4A 1BJ1H 5I1CL 4J7RA 4A6YB 3CK0H 1N6QL 5GZOC 4HBCL 2AJVH 5DK2A 3QXVA 4LPUA 1F4AA 4X4MA 1JYWA 4O58H 1KCUH 4FQXD 1T2JA 4LPCA 3FO2B 3UPAA 2IH1B 5H2BB 1QKZH 2ZUQB 4RGND 1ULVA 5HHOB 4OB5L 4WUUD 1BJ8A 4HQQL 2FX7L 3TESA 5ACZA 1KC5H 1NGQL 5K59E 4TQEL 5MERA 3CFDA 3FT4B 1J87A 1SYSA 1NCWL 1TCRA 1JI1A 1YEFL 5HXMA 4RFNB 1FNHA 4BZ2L 1EXUA 2IMNA 4H5SA 4R0LB 3HZKA 5C9KA 1WEJH 3S96B 1DVFC 1RK1A 2D3VA 4LCYA 3TYFA 3MV11 2D31A 4LF3A 2ESVA 2R69H 3BH8A 2BRQA 5K59F 1G6RL 4GQPH 1JWMB 2NXYC 4ZFOL 3S8WA 1KELL 4UNTA 4XHQA 4GMTL 4NUGL 1RK0B 1ORSB 4PG9A 1MVUB 4LIQH 5AYUH 1A8JH 2R0LH