5HY9B

Glycosylated, disulfide-linked knob-into-hole fc fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
205
structure length
200
Chain Sequence
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural differences between glycosylated, disulfide-linked heterodimeric Knob-into-Hole Fc fragment and its homodimeric Knob-Knob and Hole-Hole side products.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 200
sequence length 205
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hy9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hy9B01
3IDXH 1HKLL 4POYA 1JNLL 1U92A 1XZ0B 2XRAL 4XMLL 4KHTH 2AKRB 3D2UA 2I5YH 4HKJB 5D1ZA 3TJHC 3IAQA 4WEBH 2DQGL 3KPMA 2D7PA 3TM6A 1CTOA 4AEHH 4PJEA 5E8OA 4IHOB 4PRHA 3SCMC 1INEH 3ZDYE 1MCKA 1A7QH 4HIIA 4KMQA 5F9DC 5E6ID 4DTGL 1MCDA 2NY1C 2A74A 4GG8A 1KPRA 4OZIA 4PRID 1MEXL 3U0WL 4K8RH 4KMTL 3F6LA 4XNQA 3EOBB 4MNQE 1RUMH 1HIML 4OCYL 5FFLA 5FKAB 5C2UB 2X5PA 3BKYL 1CGXA 1I7UB 1A6AA 3OV6A 3NH7H 4L3EA 2VLMD 5CJBA 1XIWD 1BGXH 5DMKB 1IT9H 4YDKH 5EZJB 3DECA 3G5VB 2A6DA 1MCFA 3O45B 5CP3A 3UTZA 3QJFA 2PXYD 4W68A 3G5YA 2OMNA 3LIZL 4A2MA 5E2WL 2YS4A 4JG0H 4KDVA 4MCZA 4ODVH 1KB5B 2EYTB 1J87A 1DQML 5F3BB 3DRTA 4LGRB 2HA1A 1PAMA 4S11A 3GIZL 3S5LG 1YN6B 4G80B 1Q9WA 3BPOC 4X99B 3U2SB 4X6EB 2W1NA 4N5ED 3EYUH 5HDQH 3WIFA 5IMLA 5JZ7C 2MFNA 5EU5A 2E7LC 3MBXH 4CVWA 2DBLL 4F3FA 5T1DH 5HYSA 4Y4KB 2UVFA 4H8WC 1TDQA 3P9LA 3BW9B 3HZVB 2ZCHH 1UENA 4NNPH 2FX9L 2WINA 4LSTL 1NFIA 5IMKA 1O5DT 1UFUA 3PL6C 4XCEA 1ZA6A 1T1WA 4TVPH 5TE6H 2QSCH 3KPLA 5M94B 3OF6A 2CO7B 3EOTH 3ZHDA 2NXZB 1PG7L 4IOFD 1KACB 4GKNB 4I77H 4JFDE 4P2OD 3D85A 3JTTB 3ULVF 4CMMB 3QI9D 4NKDA 4NKQB 3PGCA 3OZ9H 1G7QB 1VERA 2ORBL 2NNAB 1MFCH 2ID5A 3H9HA 4J3OC 2F5BH 3KGRA 4QXGH 3BWUC 3GM0A 1MJJA 2SEBB 4G8GB 1YN7A 3MACL 2O93L 2AEWA 4RGOL 4EEEA 3UCRA 1J05B 3MGTB 4AG4L 2BXYA 1OGAD 4NO5A 1OAYH 3RX5A 2KH2B 5KVGL 1DJSA 4X7SL 1EVTC 4FOMA 3FO2B 3W9EA 3L6FB 4HWBH 4L3AA 2R2EB 4Q74A 3GI8H 3AM8C 2X7LA 3QDHA 4UOW1 1XR9B 3RWGB 1QLFB 4P5KB 4M1GH 4X4ZA 1XZ0A 3QWOB 2AKRA 3D3VB 4HKJA 4YR6B 3WDJA 4QRUB 4LIQH 2EC9T 4KI5D 1YYLL 3RA7H 4BSJA 4YWGL 4KKBD 1YPZF 1W0YT 4LASH 4TULL 1OWRM 4M1DH 4JZJB 3DURB 4PLKD 2X42A 4DGYH 4IHOA 2WANA 4WY7H 3FFCD 1NUNB 2Y36H 1RIVH 1X5FA 1BBDL 2QHRH 4JG1H 3L3OB 4GMSL 1HN1A 3KPQB 1EJOH 1FAKT 4MA1C 1LQSR 3MJ6A 1FRGH 5HHVH 1IE5A 3RPIB 5L2KE 4XPFH 2E27H 1FCCA 4WFEE 2E6JA 3EOBA 4TOYL 4TYUA 5FKAA 3CMOH 1I7UA 1AY1H 1CR9H 3TV3H 2J3SA 5BOZG 1NPUA 1GXEA 2XWJB 3Q0HA 4NN6B 4G6AC 4HAFA 5DMKA 4LLMB 1GC1L 4HJJH 3FQNB 4NN5C 5EZJA 3G5VA 1XGYL 3O45A 1XH3B 4ZS7L 2B7DT 4OZ4B 1XR8B 3SE4C 2EECA 1G9EA 3PG2A 5GJSL 1Y0LB 1KB5A 2EYTA 5F3BA 3VH8B 3UYRH 1DP0A 3QIUC 3QUZD 2JJSC 1YN6A 4G80A 3U2SA 4X99A 4X6EA 5GHWL 1J1OL 2YA2A 5MERB 4LPYA 4HQQL 3LKOB 1P69B 5EIVA 4I8DA 4MS8D 3W5MA 3KYKH 4PJ8B 5TQ2H 3HNVL 4PP2B 3TWCH 4LLUB 1XEDA 2DQCH 4L9LC 1W2KT 3FO1B 4Y4KA 4UV4H 4AY0A 2OJZH 3VI3F 3TEUA 3WIHL 4DUXA 4DN4L 3UJTL 3EYOB 3BW9A 3HZVA 2YD4A 2K9UA 3BGFB 3GIVB 1X5ZA 4UTBL 5I0DA 4JCLA 5T5NF 2W9DL 4GKNA 4KJPC 1S8DB 3JTTA 4CADB 3RVUD 1ZKAA 3ZTNH 4CMMA 5EUOE 1INDL 1G7QA 4POZD 4NUJB 1F4WH 2Q7NA 4NDMB 2NNAA 4MLSA 2VH5L 1UM4L 2BHZA 5TH2B 5I9QC 1FCGA 3FRPG 2V5TA 2SEBA 1CLOH 4G8GA 2QV2A 1P7QB 3W5NA 3G08B 1J05A 3MGTA 1RJYB 1ORQB 2DL2A 2IADB 5DI8B 3FO2A 2X09A 4DN3L 3L6FA 2R2EA 3CU7A 4Z7QF 4N9OB 4Z7WB 2JB5L 3X13B 1T89C 1XR9A 3RWGA 1QLFA 3ARED 3VXRB 2JLLA 4P5KA 1KULA 3QWOA 1JRHI 4HMDA 4RWYL 3D3VA 4YR6A 4QRUA 2WUBL 2R9HD 1JZ7A 3Q6FB 2OQJB 2WSKA 2X4QB 1FPTL 2J6EL 3M1BB 4JZJA 3H3PH 3DURA 4G3YH 3CFKB 4U3CA 4DEPC 3GJFK 3GSNH 5F88B 4PD4J 1A2YB 4QYOB 3L3OA 3KPQA 43C9B 4PJ9B 4O9HL 4TPRH 3KXFE 3MOAL 3RPIA 5E5MB 4WUUB 2VDQL 1G1YA 1YQVL 2P48B 3CDYA 2NXYB 5IB2B 1SBSH 4WO4C 5ANME 3V4VH 3JTSB 2XWJA 3PQYB 3TJEH 4JDZB 4LFHG 4PJGF 4LLMA 4I2XE 3ZYJA 2XICA 3FQNA 1XH3A 5IUSA 2EZ0D 5HYQB 2Q7YB 4JFED 1JHLL 1FE8H 4OZ4A 1XR8A 1QKZH 3MLUL 4OFYA 3I50H 1KC5H 1IEAB 1Y0LA 5IM7B 1BF8A 2W0FB 3VH8A 1SYSB 5C0AD 1U3HB 4WDIB 2OK0L 5D96C 5IB4B 4R8WL 2EH7H 5I1KL 1MI5D 5DRNB 5MERA 3LKOA 4PJ8A 1J10A 1HHKB 5AZ2H 3RVWC 4PP2A 3L3JB 3VWKD 1EAPB 2ZG1A 2ARJB 4LLUA 2D4DA 4PLJC 2J8UF 4RRPG 5AYUH 3B9EA 3V4PL 2F8XC 3FO1A 1V5JA 5C0ND 2HKFH 2E6PA 3EYOA 3AMKA 5DFVC 4M48L 4PTTB 5C0BB 3RY5A 1J9CT 4CMHC 2BNRB 5I76B 3UJIL 1K8DB 3GIVA 4E42B 1S3KL 1JYWA 5GGQH 2BRRH 1Z9SA 3MCKB 4RSVA 1S8DA 4CADA 1YMME 5IKCB 3S6CA 3D39B 1G6VK 1Z9MA 5C09D 4K23L 4G8IB 5T3XE 4NQSB 4NUJA 4NDMA 2CXKA 3FO0L 1RZ7L 4JQIH 3O11B 2Z91B 2W9LA 5TH2A 4N90E 4Z7OF 4I18B 4WI6A 3BJLA 3DLQR 4AH2B 1A7OH 5C2BL 1P7QA 2KPNA 5FECB 3G08A 4X7CC 5F72S 1U58B 3RTQB 1RJYA 2BVYA 3DETD 1OSZB 4NOBA 5DQDL 3ARWA 3WJJA 1ORQA 4LSVL 1DL7H 1ZHBB 2EO1A 2IADA 5L0QC 1TJGL 2VXQH 5DI8A 3AFLA 5C9JB 5D1XC 4AYFA 5TDOB 4Z7WA 3X13A 3FCTB 3VXRA 4WV1C 2Z0BA 3OGCB 2L7UA 2DLFL 1X5JA 3VRJB 2K1MA 5EZIH 3F7QA 3Q6FA 1OTSC 1G7IB 2OQJA 5DD3L 3MLRL 2X4QA 4EIGB 5ICZB 3KJ4B 2QHLA 3M1BA 5HHXL 4XXDB 3ARGC 2D9CA 4Z7VB 5ILTL 2ZSWB 3CFKA 3WHE0 2W9EH 2O5YH 2I25N 4UBDD 2ESVD 4ZAKC 5F88A 1A2YA 3IDYC 4QYOA 3HE6D 4XAKD 1RK0B 4YHZL 4P46B 4PJ9A 5J12C 4X7FC 5KAQF 5E5MA 1YNLH 3QRGH 3BRDA 5JORB 4WUUA 2KUTA 3O9WB 3P4NB 4BQ9A 4ZPTB 1BQSA 3BT2L 1KV3A 1NAMB 2X10A 5HYJB 2VO5A 3WSQL 3GMOB 5IB2A 2WAHA 3FFDB 3JTSA 3PQYA 4LCIL 4XP1H 1F4HA 4JDZA 3RY6C 2BVPB 3FT4B 1G9NH 2E7HA 5HHQB 5JQ6H 4IDJH 4CUCA 3LN9A 5T3ZE 5LWYL 3PWVB 4Y4FB 5HYQA 2Q7YA 3ULUE 2DN7A 4PGZA 2ZNWA 1TQCC 3U4BL 5MENE 5JMOC 3D2UD 5IM7A 1IEAA 2M8XA 2UWEF 4QRPE 1PFCA 5D1ZD 4Z0BL 2IFFL 3W0WB 4AIZB 1SYSA 1U3HA 4WDIA 4RX4A 3BE1H 3OPZH 5IB4A 5IB3B 5DRNA 2ZKHL 4PRHD 1HHKA 3L3JA 2FEEI 5EFIB 1EAPA 4UUJB 2ARJA 5D7SL 4YHPB 3FKUS 1N0XH 4KRLB 4XPAH 4ZFFB 2FJHB 3EZJB 2PTUA 3JV0A 4PTTA 5C0BA 1JI2A 4KDWA 2BNRA 1GOFA 2E9IA 2VR9A 2E7MA 1K8DA 4E42A 3WFEH 1JYXA 1KN2H 2E6QA 1OM3H 2NY0B 3ARDB 1MFDL 4L3ED 3MCKA 5BW7C 5IKCA 1NBVH 1FH5H 2J8OA 3D39A 5FKPB 3BH9B 4NQSA 1OD9A 2BERA 4S1SH 1PKQE 2Z91A 3O11A 4P9HL 4Q9QL 2X4RB 4A6YL 1KN4H 4I18A 4X6CE 4XWOD 3N85H 3BN3B 4AH2A 2XZZA 4PJFB 3M07A 4FQIH 2VN7A 5FECA 4K3HA 1NUGA 1RZKH 1U58A 3RTQA 5DUPH 5DO2D 2EDEA 5TFSH 1OSZA 4PG9B 3O3DB 4ZFGH 1L9NA 4LSQL 1F6LL 4MXVF 1QSFB 4OLYH 4Z7UE 1ZHBA 2PTTB 1UWEH 3EZ8A 4EUPH 5C9JA 2H8PB 3I85A 1MFBH 3NCJH 5TDOA 4ZTOH 1JZ6A 3BP4B 3BIKB 3FCTA 5C71A 3ARFC 4LVHC 4DZBB 2D7NA 3OGCA 4HDIB 1I9JH 1A02N 3VRJA 4J23A 3RDTC 1V3JA 4X7EC 3ZKND 4OCNC 1TJHH 3MV9B 4JM2C 1G7IA 4X4ME 5ICZA 3OF6D 4XVTH 2OXHA 4LSUL 4YXLL 3O4LE 1WFTA 4DCQB 4OGAD 2FR4B 4XNZC 4AEIH 1MWAL 4XXDA 3D85D 4Z7VA 1ACYH 2ZSWA 4HPYL 5DFTA 1CL7L 1MCIA 1HEZB 3FZUD 2XKNB 2VDMH 4HEPG 3WLWC 1RK0A 3BSZH 4P46A 1SY6A 3IT8D 4X80L 4U49A 1MAML 5JORA 1Z0MA 3O9WA 3P4NA 4ZPTA 2P46B 1GIGL 1TENA 1KJ2B 1NAMA 5HYJA 4BKLB 2IPTH 3GMOA 4C4KO 5I6XC 2J5LC 1PBYA 3FFDA 3JWNC 2QADC 3RI5F 2BVPA 3FT4A 4JJ5B 5GZOD 2VDRL 3PP4L 4HC1H 3QPQC 4GQ9H 5HHQA 4M43H 4MXQC 3LB6D 4NM4H 2HKHH 3PWVA 4FFZH 4Y4FA 1MCLA 1UADC 1JPTH 3TCLB 1GOGA 3UXFA 3QQ9D 1RU9L 4K07A 1LE5B 3RAJH 2DQHH 3W0WA 3BEVB 4AIZA 2VN4A 3RWHB 2H41A 1UXSB 4XMKH 3O3UN 3I9GL 2FEDC 3L3KB 3MUJA 1A6VH 3TH2T 5IB3A 1EGJL 1HHJB 5L9DL 4JE4B 1I9RL 3QZWB 2FHFA 4HUKB 5EULV 2XFXB 2EDHA 4JGJA 1RSFA 2EDLA 5EFIA 5IROC 1QFUH 4UUJA 1DBAL 3GFUA 3B5HA 4YHPA 1JGVH 1FNFA 2BJML 4LSRL 4LF3B 2VDOH 2CJUH 3ZT7A 4ZFFA 3LQAL 4AEFA 3LKNB 1MRCH 5DHVH 1QBMH 1CE6B 1TVHB 2FJHA 4AL8L 4DAGH 4I3RL 2LAGB 3Q1SL 4LEOB 3SDXB 4EBQH 4U1SA 2AP2A 3F58L 1UCTA 5KSUB 4W81A 3QAZB 2B0SH 2WWMD 1GGIL 1WAAA 2JELH 3MYZA 4QT5B 1R6VA 3ARDA 4TRPH 3TT1L 1T03H 3G5ZB 3U1SL 3QZWG 3GBMH 1RULL 5FKPA 3BH9A 3QRFM 3QEGL 3VWJB 3F7RA 2GFBB 2X4RA 4MA3A 2VXVL 2VOTA 4HUWB 5E99L 2CLZB 5C86A 4K3EH 4PJFA 3MRPB 3CIQA 1T1ZB 2AJXH 2ITCB 4BQ8A 5E6YA 4ENEC 4OZHE 4JZNB 4S1QL 2DDQL 2ZUYA 4XPTL 4Z8FL 2Q76B 4FZ8L 1WZLA 4XWGL 4PG9A 3O3DA 3K8MA 1MCHA 1QSFA 5GISL 1N6QL 2ZCKH 2PTTA 2NY3C 2HTKC 2H8PA 3T1WA 2Z31C 3D18B 3MOBL 4KK8C 5A3ID 4PJCB 4YDJB 1JFQH 1WQVT 3BIKA 4DZBA 3KLSA 1HYRC 4HDIA 4Y4KD 2YN3A 4BK5A 1K9TA 4IJ3C 3WO3B 4BH8B 3CXHK 1I85A 3CSGA 4CDHA 3C09B 1RIHH 1N7ML 3LQAC 1DE4B 3MV9A 2GK0B 4DCQA 4RAVB 2FR4A 3MZGB 1BD2B 4M5ZL 2NXZD 3QNYB 4DOHB 4NHCL 1CFVL 5FGCB 4LU5H 3PV6B 1MHPL 2WLYA 3QEUB 1J1PL 2MCG1 4NQCB 1ZLUH 1HEZA 4HS3B 1FORL 2XKNA 5I8KL 4MNHB 2X40A 1W8OA 5CILL 3L9RB 2IG2H 4L4VE 1F97A 1MJ7L 4OSUH 4G8GD 3DXAB 3NZ8B 1UJ3B 1T66D 2A6JB 4YUEL 5C07E 1KJ2A 4U2YA 4OD2B 3IRZA 4BKLA 1FSKB 1W0WB 5D1QC 1JL8A 2ICWJ 4PJHE 1R0AH 1KELH 1T6VN 3DMMB 4JJ5A 3LQMA 5KN5B 2A6IB 1T04B 4WFFE 4K2UH 2N56A 2VZSA 5F7HA 4M7LL 3TCLA 5E2JA 3FQUB 5TQ0L 3MJ7B 4PJIB 2YK1H 3WIIH 1LE5A 4ZFOL 4MMZC 3D3VD 2VZTA 3BEVA 2YUZA 2FZ3B 2PYEE 3RWHA 1GYAA 5TPWH 1GGUA 1IAII 1UXSA 5E8NB 3F5WB 3L3KA 4I0PC 1ZTXL 3MSPA 3JV4B 1HHJA 2XI9A 3O81A 3QZWA 3QUMB 2XFXA 3UAJC 3VGEA 5E4EC 5FM4A 1FQ9C 1CN4A 3LMJH 5DFWH 3B9KC 5JXAH 2YOCA 4LF3A 3FO9B 1ZMYA 2AJSH 2W91A 4JHWL 3LKNA 4QXUL 5T3XL 3QNXB 5KTEH 1CE6A 1TVHA 5F1OB 2R29H 1E28B 2PTVA 4LEOA 3SDXA 1QSEB 3LQZB 3Q6GH 1G7MB 3GO1L 4OM1H 1UB5B 5KSUA 2X4PB 1UZ6E 2NX5B 2H45A 4QT5A 3CK0L 3RRQA 2A77L 1CFTB 2NYYD 3G5ZA 4OD3L 2JJWA 4ODHL 3Q5OA 3VWJA 4FP8L 4KKLD 2GFBA 4HUWA 4OI8A 1FL6B 2IEPA 3V52H 2CLZA 3T0EE 4N0UE 4OFYD 3MRPA 1T1ZA 1Q1JH 2ITCA 3VG0H 1T0MB 5F9OL 3VA2C 1RUKH 2XZCL 4JZNA 5IHBA 3VD4A 1BFTA 2Q76A 5FUZL 2X1QA 2DQUH 3IRPX 4OV5B 1OPGL 2H26B 4LHQB 3PWPB 1KENH 3ZZ1A 3D18A 5GRJH 4HZLB 4PJ8D 1PZ5B 4PJCA 4YDJA 2E8YA 5HYIA 5DD0H 3UDWA 4JREC 4PRNB 4HHAB 2R56L 3CX2A 1C5DB 2CQVA 4BH8A 2ZZUT 3THML 4PBVC 3VD5A 1RHHB 1F58L 1DE4A 4IRJD 1ZK9A 4OCSH 2ATKB 1RMFH 3HG1E 1T80A 2AXJA 1C5BH 2GK0A 4RAVA 1BD2A 3QNYA 3R4DA 1QNZH 4GRWF 2P8MB 3IFOB 1EMTH 3PV6A 3QEUA 3UO1L 2OR9H 2VABB 4NQCA 4DQOH 3CDFA 5D2LE 1KCSL 4HS3A 2GQHA 3MR9B 4MNHA 5DRZB 4QTIL 3LPFA 2NY5L 1HSAB 5TE7L 4JDTH 3L9RA 1KTLB 5FV2A 5T3ZL 4YBQD 3DXAA 5JW5B 3NZ8A 1P7QD 1YNKL 1UJ3A 3HRPA 3LRGA 2A6JA 1ZLSH 3RWDB 1SJHB 3DIFB 4K3DH 3ULUL 5JA8B 1DLHB 1MELA 4OD2A 1I9IH 5CEZE 1J0KA 1W0WA 4R90H 2ZJSH 1SBBA 3DMMA 1A6WH 4OQTH 2DD8H 5KN5A 2A6IA 5I16B 1T04A 2XNAB 4YHML 1DQTA 2QBWA 1I3GL 2GT9B 3QDGE 3NABL 3VXRD 5LG1A 2X1OA 2FH6A 4PJDB 1UC6A 3FQUA 2MWCA 5DC4B 3MJ7A 4PJIA 5HPMB 8CGTA 4P9ML 4PV9B 2EXYC 3NFSL 4CDGC 2VZ1A 2FZ3A 3E2HC 4KVNL 5A1AA 1BF2A 3OKLB 5E8NA 5J3HD 3M8OH 4MNGB 3BYTA 3F5WA 5IBUG 4NIKB 1BJ8A 3JV4A 5CGYD 4LVOC 2HYMA 5DRWB 3BPNC 3QUMA 3MJ9L 5IEHB 3DOSA 2DQJL 1VFUA 2ADJB 3QHFL 1OAZH 3B9VA 4NBYB 5C92A 3VD9A 3FO9A 4PJ9D 1OW0C 3QNXA 2C1OB 1E28A 4WUUD 4L1HA 1QSEA 3LQZA 2NY5C 1G7MA 1HOCB 4OF8A 1UB5A 2X4PA 3NZHH 2NXYD 1BQLH 3ILQC 2NX5A 2AQ1A 3Q3GB 2VITB 3ULUC 2K7QA 1ORSB 3PQYD 3P0YH 1CFTA 2BFVH 4KZEL 5JIIA 2Y7QB 5IJVB 4CU8A 4CKVX 3GNML 4NNXB 4PJ5B 3QCVL 1JYVA 4EDXB 1FL6A 3DGCR 2B2XH 2IF7A 1R5IB 1GL4B 4ZOBA 1T0MA 4UT6L 2EXWC 3P30L 4OCLC 3HI6L 4LPTA 1U3HD 2W60B 1NLDH 4OV5A 2H26A 5DD1L 3EOAB 2LVEA 4HIXH 4RGMB 3PWPA 1DVFB 4OKDA 4HZLA 4XAWL 1PZ5A 5KSVB 5E24E 5EIQA 3GSVB 2Z4QB 3IFNL 1MAKA 4PRNA 2PR4L 3ILPB 4ZD3H 3TT3H 2J88L 5GGRY 3QUXB 1C5DA 3CNKA 3WN5C 1UJTA 1QRKA 3LDBC 2DJSA 2YRLA 1RHHA 1I3RB 5F6HI 5C0BD 4NZUH 4XPHH 2ATKA 2BNRD 4LAQL 2WMPA 4XHQA 5D2NE 1FGNH 4UT9L 3F12B 1H5BC 2GHWB 4KJQC 3KLHD 3GBNL 5JIKA 3WD5L 3D39D 2P8MA 4FTVE 1VHPA 3IFOA 5KVEH 4QHLB 1ND0B 2VABA 1ZHLB 4FXLA 2DI8A 1H3WM 3MR9A 5DRZA 1HSAA 1KTLA 4BYHA 3O6MH 1EBPA 2EC9U 4JPVH 2DLHA 5EU3B 4D9QD 5JW5A 1WWAX 3RWDA 3P11L 3WFBL 3CH1B 1SJHA 3DIFA 1F8TH 4R4FH 4WFHE 1DLHA 3RTQD 5HVWA 4M6OH 4FABL 3UC0H 5D93C 5ADOH 3VFVB 4KTYA 1ERNA 2HG5B 3V6FB 5I16A 2XNAA 4PB0L 1QO3B 1NGWB 2GT9A 2P5WB 4M7KH 5IJKA 1MCPL 3S34H 2FGWL 4Y2DC 3HC3H 4PJDA 4WI8A 2VJXA 2W0PA 5HPMA 5I30H 2A1WL 4YBHA 1QHPA 4PV9A 5CJQH 4FQPA 5JW3L 1IEHA 8FABB 4HG4K 5BV7H 3OKLA 5MEPB 5JR1L 4KDTA 4MNGA 2C7UB 2MNUA 5DRWA 5I75C 1C08B 4LRNH 4JO2L 5IEHA 1NEZB 4HWZB 5IGXH 2ADJA 3DBXB 4RWHA 3GGWB 4GUPB 4HV8B 1UA6H 4ONFL 4P46D 1FO0B 5I1DB 2C1OA 1A7NL 4FFYL 2VXTH 1TTFA 2W59A 3K1KC 1MUJB 3R8QA 3VRLF 1NMBH 3F7YB 3MRBB 3O9WD 1HOCA 5CEXB 3SDDC 3IB4A 4I1NB 4FZEH 5HYJD 5IT2H 4TVPE 2B1AH 3VMNA 1ADQA 4Z95H 3C60B 3Q3GA 3BJ91 2VITA 4H20L 1J1XH 1ORSA 1RZIB 5LBSH 3T2NL 2Y7QA 2LAAA 4APQB 5IJVA 5GSRB 5ITBH 1NEZG 4NNXA 5HVHB 4PJ5A 5F7YC 4Y4FD 4EDXA 2Q8AL 4BZ2H 3DUHA 2PUQT 1R5IA 5SWSE 5A43C 4NBXB 5CZXD 2EKSB 4OLUL 5DLML 4J3SA 3PDOB 5F97E 2W60A 3IAPA 4IRZH 3VRIB 2GK2A 1YPZB 2EIEA 3BESR 1GJIA 3EOAA 3HMWH 2BVOB 2DMKA 1DVFA 1TIUA 1A14H 4G5ZH 3GMMB 1X6NA 5KSVA 1IFHL 4UDTB 3EYSL 3GSVA 4KI5F 2Z4QA 1FVEB 2Z35B 1HE7A 2WK2A 3ILPA 2A83B 3QUXA 3N1GC 4MD5B 3GI9L 4EUPG 5B38B 1B2WH 5DMGC 1BFOB 1I3RA 5KG9B 1WITA 2CXGA 1T21B 1A7PL 3DRQA 3X11B 1I3VA 1CT8B 4CU7A 3LS5L 2VC2H 3F12A 2NY0D 3EFDL 3ARDD 1LEGB 5D5MF 3TBWB 2EKJA 2IQ9L 2AJUH 3R0MA 4CAGA 4ZFZB 4OCRH 3UTPD 4QHLA 1ND0A 5K59F 1ZHLA 2MMXA 4JKLA 4ALAH 2DWDB 3RVVD 1I8IB 1C5CL 1CDJA 2NR6C 3RVTC 5GRYA 5EU3A 1VGEH 5B38G 3HMXA 3CH1A 2WBJC 1EA9C 2F58L 4N0RA 4M6AA 1E6OH 2FX8L 5F7LB 2R8SH 3RVXC 4JPIB 3DNKA 4HBCH 1QSFD 3VFVA 5J57B 5EA0L 2HG5A 4HEME 3V6FA 3CU1A 3FQWB 1QO3A 1NGWA 2P5WA 3HFMH 4K3GA 4UILL 3STBA 3QB7C 1HDMB 4YXHL 1U3ZA 1H3VA 2NW2B 3QHTC 5DUML 3QQNA 4H8WH 3OBAA 4XHJC 4JFPB 8FABA 2LU7A 3WHE1 3MV9D 4K3JL 1XGTB 5BRZB 4IM8A 5MEPA 1MCBA 2C7UA 1NH6A 3MLSH 4GAJH 4D94A 4K8RD 2VDKL 4OB5L 1SYVB 4W6YB 3ZE1E 3ZYZA 1C08A 3TF7C 1TMCB 2ZUQC 1NEZA 4HWZA 4XP6H 3DBXA 4MD0B 3GGWA 4GUPA 4HV8A 4KQ4H 1IARB 5F9WC 1FO0A 5AG9A 5I1DA 1NGPL 3NIDF 4HS8L 2QQQA 4HT1L 1MUJA 4F58L 3F7YA 3MRBA 2GW5A 5CEXA 2LU4A 1TZGL 3WO4C 3O6LH 2IPUG 3EJZC 4DZ8B 1B4RA 3C60A 4H88L 4YPJA 1RZIA 5I1CL 4R7DB 1WT5A 3CVHH 4F9LA 5ICYB 3B2VH 1CLYL 2KZ1B 4APQA 3ZKSD 5GSRA 1L9MA 1A5FL 1JF5A 1CU4H 4P5TC 1NC4B 3EHBC 2BY2A 2X1XR 4X6DE 5FYKH 2F54B 1UM5L 2EKSA 3PIQB 5FGSA 4JO4H 3PDOA 1FAIL 2MCPL 3VRIA 2F74B 1YPZA 4JY5L 1N6UA 2BVOA 5DURB 5C0RH 5DJDB 3GMMA 5LGKA 4P2QB 5B8CB 4UDTA 1UH4A 1NGZB 2R0LH 3W82A 4YQXL 3ARYA 1FVEA 2Z35A 3C2SA 1YEJL 4NHUB 3HI5H 2A83A 4MD5A 4LEXH 2ZUXA 3CFIC 3U30B 5B38A 1AFVH 1J88A 1PSKL 1BFOA 3V5HB 5KG9A 1T21A 1BIIB 2D7TH 4Y5VB 3QEQE 3X11A 1DANT 1CT8A 2GSGB 1FNSL 1RD6A 4JFZH 3EBAA 1LEGA 4XB8A 4PJBB 4XP5H 3TBWA 4D2NA 2F9BT 1MCJA 1UVQB 4OFDA 4ZFZA 5CEZL 2FD6H 5GGVY 1AR2A 3VWJD 4IEFB 4FQCL 5A2FA 5C0EB 2EIDA 1ZLUK 2LTQC 2DWDA 2NY7L 5L7XH 1I8IA 4GFTB 5ALCL 3TZVC 1HILB 2BVEA 1NAML 4J3VA 5FK9B 2MQ0A 1EFXB 2AK1H 3EO9L 2GCYB 4JPIA 1TJIL 1V05A 5EU7E 3WNNA 1NLBH 1GHFH 5J1AB 5I1HH 1LILA 3L95B 2F8OA 3FQWA 5E6IC 4FFVD 1RZJL 4MYWB 1QHOA 4PRHE 4JQVC 2J8UB 2I9LB 2VQ1B 1HDMA 5AZEL 4IMKC 5I1IL 3VXSB 4I9WE 2NW2A 1DQJB 5EWIL 4JFPA 1R3HB 3MLVL 2VLRB 4G42B 1XGTA 4LSPL 5BRZA 2A38A 4LQFL 1A3LL 5FGBA 1BD2D 1XIWC 1SYVA 2R69H 3UJJH 1K5NB 4RFOL 1EJ6A 5JHDB 4L8BB 2PXYC 2MHAB 3NA9L 1Z9OA 2HFGL 4PBXA 4PS4H 4KROB 4MD0A 3MGOB 3IU4H 1YUHB 1YJDC 1EZVY 1U8QB 1NAKH 3DXAD 5FGRA 3JV6B 1ZVHA 4XNXL 3RKDD 3OKMB 4Q2ZB 2VDPH 4UIKL 3DUUB 4J3XA 2K7PA 5EC1B 5JOPD 4FG6C 4CJ0A 4YXKH 4DZ8A 4MAYB 4KXZI 4N5EC 1I8MB 1Q38A 5HGBB 4R7DA 1IM3B 3GRWA 3DMMD 5ICYA 4RAHA 2YC1B 3K2MC 2Y07L 3HLAB 1RK1B 2YD7A 2YUVA 4QHUB 2QTEA 1NC4A 5HHME 4DKEL 5E2UH 2B4CL 2C4XA 1AC6A 1BQHB 5IFAH 4MZ2A 2BVTA 3CFEB 4LSSH 3CVIL 2F54A 3PIQA 2NZIA 3IDXL 3HUJF 3WJLC 2F74A 4P4KC 4KHTL 4P2OC 2I5YL 5E2TH 1TZIB 3QI9C 1X7QB 5DJDA 5EUOF 3HAEH 4WEBL 4L4TB 4P2QA 5B8CA 1F5WA 2DJ4A 1NGZA 1VESA 4AEHL 4NWUH 3D1MC 4NHUA 1FFRA 1BQHG 3DSFL 4DK3A 4E41B 4KVCH 5D9SB 1A7QL 1FP5A 3V5HA 1RUQH 1J8KA 1BIIA 4Y5VA 3LHPH 1VFAB 1Q94B 1FYHB 3HE7D 5D7LB 2AXHA 2GSGA 2NX5D 2QKIB 3EO0B 4K8RL 1SEQH 4RA3A 4PJBA 1J8HB 4AZ8A 5JXEA 1UVQA 1ZSDB 1RUML 1VEOA 1WV7T 5F7FA 1S9YB 2HH0H 2R0KH 5C0EA 2QJDA 3NH7L 1F6FB 4JR9H 2O61B 3X3FL 3T09A 1BGXL 1A7RL 2EDJA 1IT9L 4FS0A 4Q58C 4ZDHB 5I1AB 2OS7A 4YDKL 1HILA 3MV7E 3IXTB 4KKBC 2UWEB 5FK9A 4F57H 1EFXA 1NGQH 2GCYA 5CFHA 4PLKC 2FECL 4JG0L 5J1AA 3SDCB 4ODVL 3PWPD 3L95A 3VXMB 5CBEB 1CXIA 1KFAH 4MXWH 1HNFA 2JJTC 5D2NC 5HDQL 2J8UA 2I9LA 2VQ1A 5I74C 2L4OA 3VXSA 3MBXL 1DQJA 4MHHG 1R3HA 2AXGA 2VLRA 4G42A 5T1DL 4LCUB 4X83A 1P4IH 3TVMB 5IBLC 3SDAB 3H0TB 2ZCHL 4NNPL 1K5NA 5JHDA 4TVPL 5TE6L 2QSCL 2AJVH 4L8BA 3MRQB 2MHAA 3EOTL 3TPKA 5EOCH 3MGOA 2MTPA 3SPVB 3QUYB 5MEQB 4MGXA 4I77L 1YUHA 3C8DA 3G5XB 3OZ9L 1U8QA 3JV6A 5GRUH 4O5LH 2OI9B 1MFCL 3OKMA 2HT3D 1DN2A 2ZUWA 4JB9L 3BKCH 4Q2ZA 2F5BL 2E5EA 3QUZC 3DUUA 1E4WH 5BXFB 5EC1A 2VUYA 2FO4B 4QXGL 5KSAD 1N5YH 4MAYA 1I8MA 5HGBA 4MS8C 1IM3A 5MP6H 2YC1A 4X9FA 4WIQA 2VL4A 3HLAA 1L0YA 1RK1A 3GKWH 4QHUA 4P2RE 2NMSA 3QT2A 1JGUH 2EE9A 5ICXB 4U1HB 1BQHA 2PN5A 3ULVH 1PW3A 4HWBL 1G7HB 2O5XH 3CFEA 3GI8L 1EH9A 2KL6A 4RMUA 2OL3B 5EO9B 3ARQA 3MA7B 1KT2B 1ZXQA 5IBTH 4KQ3H 4YPGB 2H32B 4YHYB 4M1GL 4K71C 3V95A 4GOSA 5B3NA 4GRLC 1PQZB 3RVUC 1TZIA 1AD0B 4LIQL 5EBLB 4TUKH 1X7QA 4POZC 3RA7L 4L4TA 4LASL 1AGBB 4M1DL 2HN7B 4M7LT 4Z5RA 4JPKL 2ADFH 4DGYL 1B6DA 4MB4A 4WY7L 5DWUH 2P24B 5C6TH 5GIRB 2GKIA 4E41A 3JBG7 5D9SA 2Y36L 1RIVL 4JGMA 2MSPA 1NMCB 4JG1L 1XGUB 2DKSA 3BDBA 1EJOL 1IC4H 1VFAA 5D6CB 1Q94A 4UNVA 5D72H 5D7LA 1FRGL 1GGBH 2QKIA 3EO0A 5DJCB 5HHVL 3O3AB 4KXZH 4XPFL 4ZTPH 2E27L 5I19H 1J8HA 3SKJL 1BWMA 1ZSDA 4PLNC 3AREC 3CMOL 1S9YA 2ED7A 4PJ5D 1CR9L 3TV3L 3V9FA 3DO7B 2O61A 2M26A 1UKSA 3T0XA 2YD6A 1N4XH 2KQMA 5I1AA 4ZDHA 5CJ5A 4HJJL 3MJ8B 2CKBB 3KYNB 3PJSB 3IXTA 4XNUH 3PXJA 5FYJH 1OWWA 1AO7E 1RHFA 2UWEA 1KNOB 5A2LH 1F3JB 4U1IB 2QSVA 1XMWA 5FYLD 1NUDA 3SDCA 4UI2A 4G6JH 1BVKA 1M4KA 5IG7B 3VXMA 1DVFD 1TTUA 4GKSB 3KJ6H 1MRFH 1FNAA 2H6PB 3O0RH 4OUUB 5CBEA 1O7SA 3NA4A 5EOQH 1OP3H 2OMBA 4MA7H 3PWUB 2PKDA 3QUXD 1B6UA 2ICCA 7FABH 3C5ZB 3KYKL 4HK3J 2HTLD 2BP3A 5TQ2L 3TWCL 3X3GH 4OT1H 2DQCL 1L7TH 4PJAE 4UV4L 4ZSOB 4LCUA 4KFZC 1WICA 3TVMA 4XP4H 4L8SB 3SDAA 3H0TA 1IZKA 1MQ8A 5L88H 2AEQH 5E56A 1K8IA 4DVBB 3N1MC 3V79C 3MRQA 4PBWD 2DIBA 5KSBF 2ZUVA 3SPVA 3QUYA 5MEQA 5E8EB 3ZTNL 3G5XA 4LCWE 3IDMB 2E8ZA 5DQJB 1F4WL 5FF6B 4NBZB 2BHYA 4B41A 5BXFA 2FO4A 1NCWH 4L1DA 3DVGB 2IMMA 2AV7B 1EO7A 2WIMA 1CLOL 2ERJC 4NZJA 4Y89A 4OLXH 4YHIB 3ISWA 5GGTA 1G0DA 3VWKC 1BVLB 1A3QA 1GVIA 4ACPA 4NCC1 5H2BB 2XTJB 5ICXA 4B7LA 4U1HA 4UAOB 3WEXB 1BQUA 2V5SA 5I1LB 1MPAH 1U8NB 4GAGH 1G7HA 3H7BB 1MIMH 4FQQB 2OL3A 4HJGB 5EO9A 3MA7A 4YDLC 3DVNB 1F11A 1KT2A 4HCRA 2EDNA 4YPGA 2H32A 1A4KB 4CBPA 3V0VB 2NY1B 4KK5D 2CMRH 2EEDA 2WNGA 5CD3B 4GMTH 1RAMA 5T1MB 5DYOB 1PQZA 1P4BH 1AD0A 3CX5K 5EBLA 3MV01 4U3HA 5E9DB 1G6RH 5H8DA 1OAXL 5HY9B 5K9JH 2HN7A 3H3PL 1QFOA 4G3YL 1SVZA 1DR9A 3EYQD 2D7QA 2P24A 5GIRA 3GSNL 1P6FA 3QULB 3QXAB 1XGUA 1ZGLB 3DETC 3HB3D 2XQBH 5D6CA 4Z7UF 2BSSB 5DJCA 4TPRL 3D5OF 3C60D 3O3AA 1R3JB 5MHSD 4U0RC 3HZYB 1E4JA 1WLHA 3P3YA 2V7HB 5EU6E 4APQD 5E6ZA 1I1AC 2RQ8A 1SBSL 3V4VL 3L5XL 3AVEA 3DO7A 3ARVA 3SKUD 3MXWH 4Y0GA 3BPOB 4GO6B 3M45A 3TC9A 1VFMA 4Y8DC 2WP3O 4EDWH 4JFFE 4OI7A 4L9DA 1EVUA 3MJ8A 2CKBA 3KDMB 3KYNA 3PJSA 3UTSB 1OD7A 1KNOA 1F6AB 1F3JA 1FE8L 4U1IA 5IQ7H 3ALPA 1X4ZA 1QKZL 5D71L 3I50L 2Y72A 4UV7H 4LVNC 1KC5L 5IG7A 3NCYS 4UBDC 4GKSA 2G75B 2FBOJ 1E0OB 1V3LA 2H6PA 4OUUA 2JB6B 3HE6C 4N8VG 4IBLT 4NZRL 3PWUA 5GS0D 1PD6A 2NTSP 2E9WA 4HGWB 3C5ZA 5AZ2L 1EBAA 2Z8VC 2ICES 2JKXA 2UYLB 5HHOB 4CU6A 2VLJB 1II4E 1MJ8H 4ZOAA 5AYUL 1FNGB 1ONQB 3K7UA 2P4AB 4S1RL 4ZSOA 4M7ZC 4FQLL 5D70H 2HKFL 2F53B 4L8SA 4WUUE 1OTUD 3KLAB 4Y19B 4PJXE 4DVBA 3WNKA 4D9RE 4XVJL 3VXNB 5GGQL 2BRRL 4J6RH 4HUVB 1CQKA 5E8EA 5GGSB 5T1KB 2VQUA 1J7VR 2X1PA 4F8TA 4X9IA 3IDMA 5D1ZC 2VDNL 5DQJA 5FF6A 3SO5A 1A0QH 2YPVL 4DGIH 4FQ2H 4V1DB 1CFBA 2VDLL 1ADQL 3DVGA 2AV7A 4V2BA 1HXYB 1A7OL 5LKNA 3BQUB 3BKJH 3CFCH 4YHIA 3NPZB 1BVLA 4IOSD 4H26B 3WNPA 5J13B 5J1TC 1WC7B 3QJHB 1KCUH 4U1NB 4UT7L 1DL7L 5H2BA 3RIAF 2VXQL 3WEXA 3ESUF 5I1LA 5D8JH 5DVMA 2VR5A 1U8NA 5IVZB 3H7BA 3KS0H 1F3RB 4FQQA 4HJGA 1B90A 1Y6KR 4YBLC 3DVNA 4OLEA 4HIJB 4U7MA 4F15C 5LVEA 1D6VH 1A4KA 1WWBX 5BRZD 3V0VA 4ODXB 1IC7H 4ZNCD 5CD3A 1JZ4A 5T1MA 5DYOA 3ZLQC 5EZIL 2DKMA 2P47B 5C3TA 1FL3B 5E9DA 1JPFB 4LMQI 1KTDB 1VFBB 4KJWD 3T4AB 3ZL4H 5IESH 4GRWB 3NIGF 2KQNA 5HY9A 2V2WB 3UZQA 1CFNB 1U8PB 2FHCA 2W9EL 4OZHF 3QULA 3QXAA 4NN5B 2J2ZA 3MXVH 1ZGLA 5AYQA 3KPRB 2BSSA 1R3JA 1YNLL 1Q9KB 1P9MA 3QRGL 3HZYA 1MVFA 2V7HA 3WV0A 3IU3B 1S7XB 4N8VA 1D5XB 3I6LD 1NC4D 4XP1L 1UWGH 1JI1A 1TNMA 1G9NL 3V5DB 4LBEB 5KANG 5JQ6L 4IDJL 3HMXL 1CLCA 3KDMA 3UTSA 3C2AL 2F54D 2E7LA 1JYNA 1TQBB 2EYRB 3P40A 1YEFH 3O3EB 1F6AA 1VADB 3BPLB 4QOKB 3QXUA 4OGAC 1G84A 3P4LA 2H2PD 5I71C 4F33B 3WCYA 2G75A 4KKCD 5C08B 3IDJB 2JB6A 3FZUC 4P2QD 3BE1L 3OPZL 3LZFH 4Z7VE 1P1ZB 4HGWA 2YA1A 3BYYA 1FYTB 3MC0A 4XT1C 2UYLA 1NCBL 5HHOA 1L7IH 3VFRB 1N0XL 2VLJA 3CFJB 2IBGA 1FNGA 1CXLA 1ONQA 1BEYH 3FB5B 2F53A 2QQKL 4ZS6D 5ENWB 3KLAA 4Y19A 1LP9E 5JXED 2R0WH 3ARTA 1HWGB 2XXMB 4WEUD 1IAKB 3RBGA 1KBGH 4RMWA 4IRSB 3VXNA 3WFEL 1KN2L 1OM3L 3VFSB 2CIIA 4HUVA 2HT4D 1N26A 4GT7A 3TH3T 5GGSA 5T1KA 1NBVL 1FH5L 4G6MH 3QXTA 1NMAH 4NGHH 4F7PB 4S1SL 1G9NC 4V1DA 1KN4L 5D7IB 4U1GB 1EFXD 3BO8B 3N85L 3WL9B 1NGXB 5IVOA 1HXYA 3V4UL 2EE6A 3BQUA 3W0WE 1RZKL 1FZJB 1PVHA 1WIPA 4H26A 5TFSL 4RDQG 4F7MB 4ZFGL 1WC7A 3QJHA 2VNCA 1MFNA 4OLYL 2DLTA 4U1NA 1UH3A 3HZMB 1UWEL 2FB4H 3OB0H 2HT2D 5IVZA 1MFBL 4ZTOL 3VXSD 4X8JB 4FQXD 4HIJA 2YWYA 4OJFH 2ITDB 5DJ6B 2WWMC 1UZ6F 1K4DB 2VLRD 5HVGB 3EUUA 4ODXA 1W72H 3T8XB 1SHMA 1I9JL 2DYPB 1TJHL 1FL3A 1E4KC 1JPFA 1KTDA 1VFBA 1DBMH 3T4AA 5JHDD 1KG0B 2P5EE 5FO9B 4Y4HB 3MFFB 4JO1H 4KROD 5GS0L 2V2WA 2CKNA 5D7KE 4AEIL 1CFNA 4KPHH 1ZVYA 2F5AH 1U8PA 3MV8E 1PJ9A 4QRRE 1ACYL 4H0HB 3KPNB 4K94L 3HAEG 4ZOEA 4KK6D 1MRDH 3BUYB 2VDML 3BSZL 4WHCA 3KPRA 3MLYH 3BP7B 4MAYD 2G5BB 3QYCA 5ESVB 4OF0A 1Q9KA 1DQDH 2VWEE 2DQIH 3SE4A 2EDDA 1J0JA 1MCEA 5A3IC 3FQRB 2YPLB 1JE6A 2DRUA 2IPTL 3IU3A 1S7XA 1AI1L 1D5XA 3QIUA 3ES6B 3S36H 5EO1B 4Y4KC 2JJSA 1CF8H 1OARH 4YE4L 1OF2B 3V5DA 1MF2H 4LBEA 5J11C 4HC1L 4GQ9L 4M43L 2YRPA 2HKHL 1V8HA 1JPTL 2EYRA 3O3EA 4G6KH 1VADA 4QOKA 2HVKB 1M7DB 1L4IA 2NXZC 4JRYB 2DQHL 5K9QG 3I3EA 3RFZC 2AQ2A 4F33A 5C08A 4XMKL 3IDJA 4L4TD 4WJ5B 5D2LF 3KYMB 1A6VL 1C7TA 3G04B 1A6PA 4AMKL 3SBWA 3VFUB 3A6OA 1P1ZA 3QDMB 4LCYB 4E41D 2B1HH 3NCCB 1QFUL 1FYTA 1WFOA 3VFRA 4KHXH 1N6VA 2VDOL 4PGBB 2CJUL 5D7LD 3FB5A 2Z9TA 1MRCL 3LH2L 1QBML 4DAGL 2I9TB 3OXSB 5CLWA 1J8HD 4EBQL 5DMIH 5ENWA 1QP1A 2B5IB 4PGJA 3QG6B 1JBJA 3SDYH 2B0SL 3SQBA 1DSFH 1IAKA 1R3IH 2JELL 4IRSA 4Y1AB 3VFSA 1NCUA 4TRPL 3OAZH 3BDXA 2OYPA 4RMSA 3GBML 4KRNA 4N0FB 1V7NH 1T22B 5D1XB 4F7PA 4ELMB 3QPXH 4XNMB 4EI5C 5D7IA 4B0MM 3VXPB 2ICWI 4WV1B 2BZDA 2EDWA 4JZJC 3BO8A 4TNVF 3WL9A 1NGXA 4LLQB 2AJXL 4KK9D 3GRWL 3SDCD 4C56E 1FZJA 1IGCH 3VXMD 3HNTH 3VFMB 2CUIA 3H9SE 3WIHA 1PX4A 4F7MA 4FNLH 2O5ZH 2V17H 2HFFB 2RCSH 4WENB 2ZCKL 3HZMA 2PETA 4MLIA 4O02H 1UM6H 4X8JA 1H9VA 2AJZB 1JFQL 1RI8A 4EXKA 4HF5H 2ITDA 1JTOA 1K2DB 5DJ6A 2COQA 1K4DA 3MNZB 1KYOJ 1UZ8B 3IDYB 3S7GA 1EO5A 2DTMH 5DT1H 3T8XA 3TVMD 4NN6C 1LO3H 2DYPA 3SDAD 2H9GB 3LY6A 3E3QE 4GS7B 5CINH 2DM4A 1T20B 1KG0A 2I27N 4U0QB 4KKLC 5TF1H 4P5MB 5FO9A 4Y4HA 2AJYH 3MFFA 1DBBL 5FCUH 1SM3H 1A6UL 1YMHB 3ZO0A 3QUYD 3NCEB 4LU5L 3KPNA 4OGXH 3B8SA 3VA6A 3BUYA 5DD5H 2CDEB 4PFEA 5GSVB 3S4SB 4CVXB 3BP7A 2G5BA 2IG2L 5ESVA 3O2DH 3E6HB 4OSUL 1D5IL 1WWCA 1ZS8A 4PJ8C 1Q8MA 4JZOB 1AXTH 3FQRA 2KKQA 2YPLA 5C6PB 4M6NL 3ES6A 4BQ6A 5EO1A 5FUOH 4HPOH 3P0VH 1R0AL 2DQEH 1KELL 4Y2OA 1OF2A 3CZFB 3CC5B 2OTPA 2BY3A 4Y16C 1BLNB 4BK4A 2J6EA 2YMXH 4K2UL 4OM0H 1GPOH 4PJ7E 4YO0B 5IB1B 5E8DH 1DANU 25C8H 3BGFC 1KB9J 2HVKA 4MNQB 4X98B 3S4SG 2YK1L 3JUYA 1M7DA 3SY0B 3I6GB 3WIIL 1OAKH 3TYGH 4JRYA 1UCBH 1HSBB 4ONGH 2NQCA 5T5FH 1F00I 4JFOB 2R4SH 4WJ5A 1DQLH 3KYMA 1OP3K 3OG4B 3G04A 3UX9B 3VFUA 4MX7B 3RZCC 3QDMA 4LCYA 1FZKB 1S5HB 3LMJL 4NQCE 3TCXA 2NTFB 5L8LB 1ITBB 1JPGB 4PGBA 2DLIA 4R9HA 2AJSL 3OXSA 1FLRH 3Q6GL 3LAFA 4P2YA 4R4BB 4OM1L 3QG6A 1SMAA 4WW2F 4Y1AA 4ISVB 4Q7DA 2ZUUA 5BCAA 5C3LD 1JTPA 3STZB 4N0FA 2YPKB 1T22A 5D1XA 4ELMA 4XNMA 1MFAH 5IOPB 3VXPA 3V52L 3W2DH 4WV1A 4PJIE 3QO1B 3WFDH 3GHBH 4LLQA 1Q1JL 3H2WA 4M3JA 3QCUH 3VG0L 1KUMA 4KGLA 1RUKL 4YHKL 3RDTB 3VFMA 4JM2B 5B3JE 2DQUL 2HFFA 1JVKA 3V5KA 4PJ9C 3FHAA 1KENL 3RNKB 5GRJL 2YUWA 1YY9C 2AJZA 5FYKE 1K2DA 2AV1B 3MNZA 5I15H 2NXYC 2X2YA 3W11D 4RMVA 1UZ8A 3MRKB 3B43A 1QUNA 2M1KA 1X5LA 1OP5H 2H9GA 3B2UD 1QSEE 1BBJB 2IFGA 2LABA 4A6YB 2EDXA 1T20A 4OCSL 4UNTA 1RMFL 3NCBB 4P5MA 1C5BL 3SDXF 2HRLA 1YMHA 5I6XB 2LQRA 2J5LB 2Q3ZA 4PB9H 5TE4H 4W4OA 2QADB 4GXVL 4CN1A 1A8JH 1AGEB 1EMTL 1OAQH 1KJMB 2OR9L 3ELAT 4LGSB 4DQOL 4YEEA 2FX9H 3LSOB 4LSTH 3D69B 2CDEA 5GSVA 3S4SA 4CVXA 4JDTL 1R5VB 3E6HA 4O4YH 1PG7H 4JZOA 4K3DL 1LHZA 1LD9B 1EEYB 4G9DB 1MREH 1I9IL 1TVDA 4O2CB 2IJ0C 3K74B 3S97C 2ORBH 1JWSB 2ZJSL 1A6WL 4OQTL 2DD8L 3CZFA 3CC5A 3SO3B 1CDIA 3LEYL 1BLNA 4OD1H 2IBBA 5L2KB 4RGOH 4YO0A 1CXHA 5IB1A 1MWAB 5B39G 2NY1D 4MNQA 4X98A 3SY0A 3GJFH 3I6GA 3BWAB 2DM3A 3OKYA 1GZPB 3PWJB 2HJLB 1HSBA 4WWKB 2QSTA 5E9DD 4JFOA 3M8OL 1G0YR 4ZUSB 1IMHC 4I18C 2FCBA 1GGTA 4MMXC 4MX7A 4JKWA 4QWWC 1DTUA 5J9PB 1KLUB 1FZKA 1S5HA 1NCTA 5F9JB 5HVFB 2NTFA 1CD1B 4J1UB 5E2VH 3JSSA 1OAZL 1JPGA 3U83A 2F8VA 1AC0A 3ARSA 3MTRA 4NQDE 1ZWIB 1MLBB 1EK3A 1KXQE 2XTLA 3DPBA 4R4BA 1IBGL 5A2JH 2HVJB 2WIIB 3NZHL 3O2WH 1BQLL 1X5IA 5F7NC 2EYSB 3P0YL 2BFVL 2FJGB 4ISVA 2R4RL 2DQDH 5CP7B 1ZLWH 3STZA 5J4MA 2YPKA 5JZ7D 3UTSD 4WUKH 5IOPA 4EJ1C 5DJZB 2B2XL 2ENSA 1O0VA 3KJ4C 5L2JB 3QO1A 5AWNL 4JKPL 5IMMB 1QRNE 2JJVA 5FM5M 3W9DB 2AI0H 3RDTA 4S10A 5EUOB 2BDNH 4JM2A 3H8NA 1NLDL 4Z18A 1R3LB 3FL7A 4PP1C 5FDWB 4HIXL 4RISH 4NKMB 2XN9E 5I1JH 3RNKA 3O9WC 2GITB 3EO1B 2VXSH 5HHOD 1TXKA 2VLJD 2AV1A 4WI4A 4ZD3L 3UBXB 4KUZL 3TT3L 3MRKA 2UV3A 1UG9A 3IF1B 3CD4A 1U8LB 2F53D 4QHNB 1KGCE 3IXAB 1BBJA 4A6YA 4NZUL 4Y19D 2EDBA 4XPHL 3QFJE 4Y4FC 4PD4K 3HNVH 1P53A 2W0KA 1U9KA 4HKXA 1J0YA 4OCWH 3UTOA 2PF6A 5D1QB 1KIPB 3CLEH 5T1KD 5CZKA 3OR6B 4BSWB 5DVLA 1AGEA 5CZXC 5KVEL 3SHSA 4YGVB 1KJMA 3O2VH 3OG6B 4BFGA 4YFEA 2V5MA 2YD5A 3LSOA 4KAQH 5FHBH 3D69A 4MVBC 2X89A 4V1DD 5F7DB 3UBXG 5FM8A 2X9XA 1R5VA 4JPVL 4UTBH 1M1SA 2JK5B 4JGUA 3BQUD 2I60H 1F8TL 1LD9A 2NY4B 1FLTX 1EEYA 4G9DA 4O2CA 1JWSA 4M6OL 3UC0L 1MQKH 5ADOL 4I0PB 4FXGB 5IVNA 4D9LH 3U4AA 1YC8A 3KXFB 5L2KA 5E4EB 2DIAA 4Q6IC 3S34L 5DVNA 1MWAA 2DIJA 3HC3L 2V7NB 5CZVH 2YA0A 3B9KB 2EEBA 5I30L 3ARDC 1QFWH 5CJQL 3BWAA 5ANMB 1GZPA 3PWJA 4XBEH 4GG6F 2HJLA 4WWKA 5DJ8B 3H9YA 5EIIB 5BV7L 4JJHA 4I2XB 4TTDD 4ZUSA 3RVVC 4LAJH 1FIGH 3X17A 1FNLA 4LRNL 5AUMB 5J9PA 1M6OB 1KLUA 3VGGA 5IHZB 4NNYB 5F9JA 1YJDH 5IGXL 1CD1A 5FOBB 1F4XH 4J1UA 1UA6L 5F1SA 4TQEH 3ZYOA 1FPTH 3KPRD 4BQBA 3UZEA 1ZWIA 1MLBA 1V7MH 4EIZC 3BOVA 1NMBL 3G5YB 2HVJA 2DMCA 2WIIA 6CGTA 4R26H 4L5FL 4FZEL 4MZ3A 5IT2L 4XBPB 2B1AL 5FHAH 1JMZA 4Z95L 4ZFOB 3QIUD 4MCZB 1J1XL 2EYSA 2FJGA 2VE6B 1I85C 5CP7A 3MOAH 2AEPH 5C7XH 1JN6B 5B21A 5ITBL 5EDXA 2P5WE 4P3DB 1EGJA 3QG7L 4X5WB 2BXZA 4G9FE 5DJZA 1XF5B 5L2JA 4BZ2L 4JREB 4QOKD 1INQB 5I1EL 5IMMA 5DA4A 4H0GA 1ZANH 3W9DA 4JY6B 2XV6B 1PEWA 1YMMB 1IQWH 5EUOA 2YBRB 1R3LA 3VFPA 5FDWA 3HMWL 4NKMA 3UPAA 1BJMA 3MCLL 3OB0K 4G5ZL 4ETQB 3ULVE 2GITA 3EO1A 3H42H 1FYTD 1NBZB 3VGDA 3FB7B 2ICEB 3UBXA 2W07A 3IF1A 1U8LA 3MRCB 3RUGE 3NACH 4QHNA 4POUB 3IXAA 1B2WL 4TUJB 4C55A 2D3VA 2ZG3A 1QR4A 4WCYH 4WI9A 4IRSD 2VC2L 3TIDB 1GH7A 5D1QA 2EE3A 1KIPA 4XI5C 3OR6A 4BSWA 5D6DC 1JZ2A 1P2CB 4OCRL 4YGVA 1VKXB 4UINH 1EEZB 1H8OA 3EJYC 4ALAL 5F7DA 3VU2A 1T7YA 2Q20A 4H1LH 3MRNB 1HCFX 4WFGD 2JK5A 1VGEL 4F9PA 1ZT1B 2HWZL 1W8NA 3SE8H 2R8SL 1HHHB 1CL7I 2BOCB 4MJIE 4HBCL 4I0PA 3RX8A 4FXGA 4LVOB 1MCCA 4G6FB 3BPNB 3KXFA 4XGZB 1LMKA 3E3QC 1MCSA 4JQXC 4OBRA 3QAZC 5FYJE 1IC1A 4PY7B 2V7NA 3A67H 1VSCA 3B9KA 5ANMA 2DYPD 4KI1A 4H8WL 4KMLB 5DJ8A 5EIIA 5JPMB 4I2XA 4Y4HD 3MLSL 2MOVA 4GAJL 4G7VL 3MLZH 2DI9A 5KSBB 3OJ2C 3RI5K 3GK8H 5AUMA 1M6OA 3S5LB 5IHZA 3KPPA 4XP6L 1HQ4B 5MENB 4NNYA 2AQ3A 4AENB 1PKOA 4OCMC 4QRPB 5FOBA 4KQ4L 3C08H 1AXIB 5HHXH 1BWWA 3KPSE 4C59B 4FFVC 2C3GA 4HK0B 2A9NH 2NZ9C 5ILTH 4MJ5B 4EOWH 4X8XA 2YPLD 2DM2A 2PW2B 4X5XB 3UDWC 4XBPA 3O6LL 1GGYA 1EZVX 3VXUE 4ZFOA 2VKXA 2DLGA 5CJXA 4RGNE 3QDJE 3OAZK 3CVHL 1BECA 2VE6A 3BEWB 5EB9A 3BD5A 5DXWA 2H1PH 3QO0B 1JN6A 3QIBB 1T1XB 1CU4L 4P3DA 3RVWD 4X5WA 1FFOB 1XF5A 4GBXB 1T2XA 2Y6SC 1INQA 2XPGB 1G9MC 4ORGB 1XFPA 3RWCB 4JRYD 4U33A 5FYKL 1KJ3H 1RY7B 4JY6A 3LDBB 4QNPF 1YMMA 2UY7A 4O00A 5LCVH 2YBRA 1PKQB 4DW2L 5C0RL 2V9TA 1P84K 5E4IA 4X6CB 4ETQA 1UJ3C 3QDMD 1U3YA 3RKDC 3T77B 3RNQB 1X5AA 1NBZA 2R0LL 3FB7A 2EDFA 4Z0BH 1BIHA 2CSPA 2ICEA 3HI5L 3CDGB 1FGVL 3KLDA 4LEXL 3MRCA 1AHWC 2WQRA 3PXHA 1AFVL 2HP4A 3FOMB 1T7WA 4Z7UB 3TN0C 4TUJA 2MQ3A 2D7TL 1PLGH 3D87B 1IVLA 4Y1AD 3TIDA 1K4CB 3P0GB 4XP5L 4LLDB 3JWOC 4NT6B 3MRMB 1QZ1A 1P2CA 4DVRH 1VKXA 2WLZA 1EEZA 5D1XD 5L7XL 3KG5A 3MRNA 4Y2DB 3O4LB 4UU9B 1KF9B 1ZT1A 1CIUA 1I1RA 1NDMB 5JUEH 2AK1L 1HHHA 1U8OB 1JWMB 2BOCA 4P9HH 1NLBL 1GHFL 4Y88A 3WFHB 5I1HL 4R4NC 3K80A 1NDGB 3ARGD 1D6EB 4XGZA 5I75B 3UTQB 1I7RB 1WWWX 2EE2A 4ZAKD 3RHWK 4PY7A 3MYJB 4HXBH 1A1OB 5KVMC 2CPCA 4LSQH 3CLFH 3E1F1 4HH8A 4S0SD 1EO8H 5JPMA 5C0CE 2ARJQ 4NRXB 4YFLF 1I8LA 3MROB 3V0WH 5KSBA 2YHGA 5BVJB 1AR1D 2R69L 3UJJL 1U36A 4M62H 3S5LA 5JHLH 4PJGE 4DFHA 1HQ4A 5MENA 1HHIA 3UP1A 4PS4L 4AENA 4QRPA 4LARH 5KOMC 4F7CB 1JPST 3IU4L 5GXBB 5SWZE 3CJJA 1ED3B 3DTXB 1CGUA 1FFNB 4HK0A 2VDPL 4MJ5A 5HYFA 4S1DD 2PW2A 4X5XA 3ARPA 4YXKL 5BJTB 5DK2B 4IMLB 3BEWA 2P7TB 4Y5XC 3QO0A 3SGDI 3LOWA 4NO3B 3QIBA 4OZFH 1T1XA 4OBSA 4PJAF 1A64A 1FFOA 2CRYA 1J11A 2QLVB 5E2UL 5BS0E 4GBXA 4MNQD 3MJ9A 2XPGA 2ADGB 1J0IA 4LNRB 4ORGA 1PEZA 3RWCA 4LSSL 1FVDB 4NJ9L 4LOUD 1PKQA 1G7PB 5E2TL 4YDIH 4CN6A 4IRJB 5I17B 3QQ4B 4M1CD 2DF3A 4BFBD 4X6CA 5JHDE 4CL7A 3I75B 4WU5B 2HT3C 3T77A 3RNQA 1VENA 4P59H 4NWUL 3P73B 4OZHB 5C70A 3CDGA 5ISZE 4Z7OE 3S3SA 4KVCL 3FOMA 4Z7UA 1OP5K 3DV6B 3NFPB 4XXCC 3MMEB 3AGVA 4CN4A 4YFDB 1JGLH 5HDBE 2WBJB 3LHPL 5IJKC 3R1GH 5F96L 1K4CA 1SEQL 2BJMH 4LLDA 2XKUA 4NT6A 3MRMA 1IGIH 3HC4H 1CXEA 3IKCA 1IL1B 2HH0L 3Q1SH 2R0KL 2DQFB 5INCB 4JR9L 3U7WH 4OGYH 3CPLB 4X4MA 2GJ6E 3KNBB 4Y2DA 4N0YH 1GGIH 1RUAL 3TO2B 3O4LA 4UU9A 3DX9B 3SQOH 3ME0A 2ATPB 4JFDD 3U1SH 2V9QA 3RDTD 4F57L 1NDMA 1XT5A 5K9KB 1RULH 1NGQL 4PYHA 4AJ0A 5HSFA 1U8OA 1JWMA 4JM2D 3H6JA 3HS0B 5GGVL 1TVBB 1H3PH 3WFHA 3FJTA 2NLJB 1NDGA 4L4VB 1D6EA 1B9ZA 1U8JB 3UTQA 4LLAA 1I7RA 4MXWL 1C8PA 3LS4H 4YIQB 3MYJA 5C07B 4BZ1H 3WMSA 4XPTH 1A1OA 4YX2H 3AU1B 3WLWD 4K55A 2I26N 4PJHB 1BMGA 4NRXA 4KV5E 1P4IL 3MROA 3WO4B 4WHYH 1FNHA 3G6AB 1S7WB 5BVJA 3AC0A 2QADD 4J3TA 2FLBT 4PJBF 2A73B 2P8LB 4MXQD 4RMQA 1N7MH 4F7CA 2PYEB 2X89D 1YEIH 4P5TB 1ED3A 3DTXA 3AXLB 1FFNA 3E8UH 1J0HA 4M5ZH 1AKJB 5GRUL 4O5LL 3UPRB 3BKCL 5EOTB 1E4WL 1KLFA 3O8XC 4OIAA 1MHPH 1N5YL 5BJTA 5DK2A 2FLRT 2FEDD 2NY2C 5I8KH 4IMLA 1QPXA 2P7TA 1R24B 4JRXB 3TBVB 5MP6L 1ZLWK 3F6IA 4XCFH 4NO3A 1NCNA 5L2KD 3GKWL 3EOYG 4WFED 1JGUL 1RZ8B 4K9EH 3QFDB 4DKFH 5DC9B 4YNYB 2ADGA 4LNRA 1M05B 2O5XL 5T33H 5C0DB 1FVDA 4M4RA 5E8PB 4WWKD 4ZXBB 5MI0C 1A1NB 4PJXF 3FRPA 5IBTL 4KQ3L 1S7TB 3SGKA 2HLFD 3IFPB 5CP3H 5DGQA 1G7PA 4NKIH 1FBIL 5I17A 4IRJA 2OTWB 3QQ4A 2XKSA 3X12B 4TUKL 3T0EB 4N0UB 3I75A 1N3NB 4WU5A 1BZ7B 3LVEA 5F1NB 5F44A 3P73A 4OZHA 2LTQB 2ADFL 4JKMA 3ETBF 5C6TL 3DV6A 3NFPA 4MJ6B 1BHGA 3MMEA 3LEXB 1FC2D 5EORL 4N0CD 1IC4L 2WBJA 5D72L 4WI5A 1GGBL 4JEGB 2E9JA 3GBLA 3RBSA 4ZTPL 4MXVE 2DB8A 5TDPB 4D3CH 3WNLA 1IL1A 3SGDH 2UY6A 2DQFA 4HSQA 4KK5C 5C0FB 4XTRC 5INCA 4P99A 4XB7A 2RGSA 3CPLA 3KNBA 3CAFA 1I8KB 1XAUA 2C3XA 5ALBH 3TO2A 4GXUN 2G60H 1WUNT 3UMTA 1LDPH 3DX9A 5GZND 4XNUL 5FYJL 3ZDZF 1WVZA 3ULVC 2ATPA 1FFPB 3K8KA 5K9KA 4FP8H 4LCCB 3HS0A 1X5GA 1TVBA 5B22A 3EYQC 3RWJB 5D2LB 1ACZA 3CMGA 2ZSVB 1JNJA 2NLJA 4G6JL 2Z8SA 1X6LA 3KJ6L 4L4VA 1PY4A 4HWNA 1U8JA 3O0RL 2HMID 3HB3C 5EOQL 2W38A 4NFDA 5F9OH 4MA7L 4YIQA 3QSKB 5C07A 5FUZH 1U8KB 3AU1A 1A47A 1WT5C 7FABL 1OPGH 4F9LC 3X3GL 3MODH 4PJHA 4OT1L 4P3CL 1SJXA 2IAMB 3N1PC 1F02I 1LEKB 3BXNB 4XCNB 1G7LB 5HVHC 2WM0A 4LMQE 2GTZB 4XP4L 3QDGB 4FRWA 3G6AA 5D1QD 3SJVE 1S7WA 4IIQB 5L88L 2AEQL 5GPRA 2R15A 1GAFL 2A73A 3IETB 2P8LA 2PYEA 1RZFL 4WNQB 5EZLB 1Z0NA 2XA8H 4P5TA 4FXKB 3C5JB 3AXLA 3MRLB 2GY5A 1RFDH 5DJXB 3PHQB 1AKJA 4AIOA 4RRPA 2YR3A 3UPRA 2BMKB 3ZE2E 4BELD 5EOTA 2XZQH 2NY4D 3UTTE 3SKMB 4KRMB 1JRHH 1VPOH 1IGFH 3AUVA 4OLXL 5HXMA 4I0PD 4P4KB 5TE7H 1R24A 4F37F 4JRXA 5FA3B 3TBVA 3C8HA 3QIWB 5FDYA 3KXFD 5GS1B 1RZ8A 3QFDA 1PY9A 3LRHA 1MPAL 2XY2A 3B9KD 3NTCH 4GAGL 4OF3A 4YNYA 1M05A 5C0DA 1LP9F 5E8PA 4ZXBA 1A1NA 3EDJA 3SOBH 1S7TA 4UB0L 2YD3A 4ZSOE 2CMRL 3WYRA 1ZGLP 3IFPA 2R0ZH 4U1SB 1IC5H 2OTWA 3X12A 5F7KC 5AG8A 2BVQB 1NFDF 3VG9C 3T0EA 4U6HB 1FV1B 4N0UA 5C8JB 1N3NA 3PHOB 5J6HB 3L3HB 1KB5H 1BZ7A 3TFKD 4J4PA 5F1NA 1OGTB 4I0CC 4RNRB 2KBGA 3AY4C 1P5VA 4HKBB 2O26U 3ZMRA 4RGNC 4OLZH 5HI5C 3O6KH 4MJ6A 4MA3B 3VGAB 2YRZA 3LEXA 1WGOA 3MLXH 5GS3A 3SGEI 3U79A 2D2OA 3S36X 4Q9BA 3DX8B 4Z77B 1QD0A 4LRIA 1G7JB 5TDPA 3VFGH 4W6XB 1ZHNB 1UQSB 5C0FA 2XTJE 3MXWL 5LGHH 1I8KA 5D2NB 4EDWL 5D4QA 4IMKA 1J5OH 4KZEH 3S37H 4QHKJ 1FFPA 1YMMD 3TBYB 3WFCH 1JV5B 3TP4A 5IQ7L 3ZHKA 4H1LG 2ADIB 4LCCA 5T3XD 3WHXB 4UV7L 3RWJA 5D2LA 2ZSVA 1CDYA 5FOJA 4HD9A 1EFQA 2VLKE 3ARBC 3PF2A 4EN3B 3T3ME 4JY4B 5LQBH 3DX6B 2A6KB 2XZAL 1GZQB 4I5BB 1U8KA 2BCKB 5C6WH 1HK6A 3CFBB 3RWIB 5M95B 3LN5B 1EEQA 2R2HB 1MJ8L 2IAMA 3VXTB 1LEKA 3BXNA 4XCNA 15C8H 1G7LA 3VFNB 3QXVA 2GTZA 5D70L 3QDGA 3D9AL 3IFNH 3VDAA 4WW2B 4NWTH 2OR8A 4IIQA 3CX5J 2KZWA 3MV11 2JTDA 5CHNB 3JWDC 1YDPB 3IETA 4J6RL 1VEMA 4OUOA 4WNQA 5EZLA 1QBLH 3K81A 4LAQH 4FXKA 3C5JA 1TCRB 3MRLA 3BIAX 2H2PC 1HH9B 5DJXA 3PHQA 1A0QL 2VTFA 2BMKA 2EXYD 4DGIL 3HR6A 1UYWH 4FQ2L 12E8H 4X4XB 3SKMA 4OZGE 3Q5YA 2V9RA 2FX7H 3RWEB 3BKJL 3CFCL 4P4KA 4GRLB 3U30C 3WKMH 5FA3A 4NYLB 4G6FD 1VCAA 3QIWA 3PUCA 4NJAH 3GKZA 3P11H 5GS1A 1KCUL 2KDGA 4Y5VC 1CFQB 2EICA 1BJ1J 1DBKH 3ZDXF 5D8JL 5CSZB 1SJEB 4ZS6C 1QQDB 3C6LC 3FN0H 2QEJA 4B5EA 5JXEC 2YXMA 3ZKMD 1D6VL 1VFOA 2J7LA 1IC7L 2HT4C 5T3ZD 1WCBA 2VUOA 3ULUD 5DR5H 2BVQA 2AABH 4U6HA 3ZL4L 1FV1A 1U95B 4MQSB 5C8JA 5IESL 3PHOA 5SWSB 5J6HA 5MEND 3L3HA 5MEOB 5CLTA 4QRPD 1YY8B 1SVCP 1OGTA 2YSSB 1WBZB 3IAGC 4RNRA 5A40E 1ULVA 4HKBA 1CD8A 2V6HA 3VE0B 2YZ1A 32C2B 2CK0H 2Q8BH 1IILE 4R97B 4QRQB 2EXWD 3INUH 1XGRB 3BFOA 1F3DJ 1OSPH 3H7LA 4YHLL 2HT2C 4NC1C 3DX8A 1CE1H 4ONFH 4Z77A 1G7JA 1LDSA 1ZHNA 3QIBD 1UQSA 3OR7B 1X5XA 1UWGL 4GBXD 1OY3B 5D2NA 3D25B 4P23C 1OQOA 5JW4M 5HGGS 3TBYA 3MLWH 3TGXA 1JV5A 2ADIA 2R1WB 3WHXA 3DYPA 1F45A 1MH5B 3GJEB 4OTXH 2J12B 4PRPE 1YC7A 4NPYB 4KJQD 2EO9A 3FAWA 4EN3A 1BFVH 1NL0H 4JY4A 3NIFF 3DX6A 1ZA3B 2A6KA 4I5BA 1GZQA 2VIRB 2BCKA 3B8YA 5DS8B 4Y5YB 3CFBA 3RWIA 1L7IL 3LN5A 2R2HA 2WBKA 4MB3A 3VXTA 3VFNA 1LK3H 2IPKB 1BEYL 3AROA 1MY7A 4WW2A 1NANI 4OCXH 3QBTB 2BNQE 5H94B 5CHNA 5IWLC 1J12A 4PJ7F 4D8PB 5IQ9B 1YDPA 1KBGL 4NP4H 1QOKA 1A7PH 4Y2DD 1TCRA 4G6ML 3FT3B 1HH9A 3O4LD 1NMAL 3EFDH 4NGHL 3NCMA 5JDSB 2IQ9H 1T1YB 4WI3A 4HLZH 4X4XA 1RUPL 2VISB 4LK4A 3ZKXB 3RWEA 1CD0A 1L6XA 5I8OL 4DUVA 3IVKB 4GRLA 3H3KA 1QSZA 3IDIB 2A2QT 4G7YH 4NYLA 5C08E 3IJYB 1CFQA 1V3KA 3D0LB 1CLZH 3KR3H 4E5XB 2AK4E 5CSZA 3TNMB 1SJEA 5BZWB 1QQDA 4LPXA 4GSDH 4OJFL 4OZFG 4M7JH 3IDUA 5HYEA 1CICB 1W72L 4F7EB 1KCVH 2FIRT 5E94B 4JCMA 1H3GA 2IANE 1DBML 1U95A 3HE7B 3Q2CA 2L7JA 3RGVC 5SWSA 4JPWL 4X6DB 5DUMH 5FXCH 2XQYK 5MEOA 4JO1L 2N7BA 1YY8A 2YSSA 1REIA 1WBZA 2F5AL 3OKKB 6FABH 4XVSH 1YQ2A 3SDCC 3VE0A 1PG7X 32C2A 5GRVK 1MRDL 1DLFH 1MY5A 2XQYG 2BY1A 4UOJA 3AS2A 3D48R 5TDNB 4QRQA 4HWUA 4HWBA 4UZGA 5B3JF 4R2GC 1XGRA 2XYCA 3MLYL 5A2KH 1DQDL 2DQIL 2HRPH 4MQXD 1HZHH 2FHBA 4WTZG 3G6JF 4F58H 3OR7A 1UACH 1TITA 3S36L 3SGJA 5A16B 1OARL 1TZGH 3QEQB 4TNWK 3SDAC 1MF2L 3VFOB 3D25A 3MBEB 4F8QA 4H88H 1KEGH 1U2HA 2LE9A 1LO4H 4GG6B 1TLKA 4G6KL 3OX8B 2R1WA 3QUYC 1LK2B 3GSNB 1MH5A 3GJEA 3IYLW 2VYRE 4PRIE 4NPYA 3VW3L 5FM5O 3RKPA 1ZA3A 3T0DA 4P2CG 4N1HB 1OL0A 2VIRA 3EDEA 1OT2A 4XCYB 5KVDL 4Z7NE 5DS8A 2B1HL 2NR6D 4Y5YA 3ARZA 5H37H 3RVTD 2P43B 3K1DA 1QR1B 2VLME 1XGQB 5I1GH 1I75A 4KHXL 2VLLB 5ECJE 5EPMB 2WBJD 2IPKA 5E95B 4ERSH 1U2CA 2V2XB 4ODTH 3STLB 3RVXD 4BA8A 1N0LA 5CCKH 4I48B 5KSAB 1Q0XH 2Z93B 5H94A 5IBUB 3SDYL 5IQ9A 4D8PA 3T3PF 4YHYC 1HHGB 1IGJB 3FMGH 4WHYG 2UZIH 1KCRH 4PRBB 1ZVSB 3I2CH 1IEBB 4PR5B 3FT3A 1V7NL 3K8LA 3QPXL 4W4NA 5JDSA 1T1YA 1ZEAH 3U9PH 2VISA 4PV8B 3MRGB 4FQCH 4N8CH 2X9WA 3IVKA 5F89B 3IDIA 1SY6H 5JQHC 5HI3C 4NZTH 1IGCL 3HNTL 4XP9H 4L4VD 5ALCH 1NMCC 3BPCB 5HBBA 3IJYA 4FNLL 2O5ZL 2V17L 2RCSL 4LFHD 1NAMH 3D0LA 5C07D 4E5XA 4O02L 1UM6L 3TNMA 5KS9E 5BZWA 5CAYB 5TF0A 4EVNB 3G6DH 3I3BA 1NCAH 5CIPB 5F7MC 4HF5L 5EBMB 3I84A 4MB5A 4NQEB 3LPGA 4WFFD 5L8KB 1CICA 1F90H 2DTML 4BQCA 5DT1L 4F7EA 4ODSH 4ETYA 2IH1B 1LO3L 3UZVB 5E94A 1L6ZA 5HHMB 4QEGA 3QQ3B 4WTZA 1T83A 5CINL 3SEPA 3HE7A 3FN3A 2D31B 5I1IH 5TF1L 4X6DA 4QGTA 2A9MH 2AJYL 5FCUL 3U6RB 5EWIH 2OZ4L 1SM3L 4JHZA 4QCIB 2PYED 1CGTA 4RDQF 3OKKA 4P5TD 1OGAE 4PPTA 5FEBA 1CGSH 3MA9H 4OGXL 5BVPH 1AKJD 2A0LD 5DD5L 3S88L 5TDNA 4JM4H 5JO5B 3GSWB 3S96B 3VCLB 4M6MH 2ZPKH 1CGYA 3O2DL 4EI6B 3KPOB 5D7IF 3C5ZC 3TA3B 1C1EH 4JRXD 1AXTL 1IAIH 5J56B 3OKNA 1DFBH 2M2DA 5A16A 4KI5E 5FUOL 4UIKH 3P0VL 3BP6B 2DQEL 2V5RA 4DK6A 4L8SC 3QEQA 3VFOA 2AW2A 3F8UB 3MBEA 3B2UC 1C12B 3U0TB 1S9VB 4OM0L 1GPOL 4ZXBD 2BVUA 2QL1A 4GG6A 25C8L 2UZXB 3FFCE 2VB5A 3OX8A 3T0AA 1E27B 1H3XA 3V6ZB 1LK2A 1OAKL 2CUMA 3GSNA 3TYGL 1UCBL 4PUBH 2OCFD 3OXRB 4JO3H 1CZ8H 2YWZA 5D5ME 3DRQB 4H5SB 4ONGL 3T0ED 4BSVB 5T5FL 5K33A 2R4SL 3MV7B 4J4PD 5K59E 1MVUB 4XCYA 1I1CA 1QR1A 1XGQA 3TZVD 2VLLA 5EPMA 2VERN 5DJ0B 2XTJC 2V2XA 4XC1H 3STLA 4UAOC 2X4OB 1FG9C 1QACA 1FLRL 5T1LD 4I48A 3DSFH 5KSAA 3ALXA 2Z93A 4ZNEA 3SE3C 4YK4B 1JNHB 3LEVH 1HHGA 1IGJA 3RIFK 4N1CA 2VSCA 4PRBA 3HG1D 1ZVSA 1IEBA 4PR5A 3MLTB 1F2XK 1UWXH 3PWNB 1MFAL 3CZJA 3DI2B 1ODAA 3WS6C 3BD4A 3MRIB 3W2DL 4PV8A 4HUUB 3MRGA 3WFDL 3GHBL 3TNNB 1AGCB 4JRWA 5CJOH 2OM5A 3QCUL 5F89A 3X3FH 1A7RH 1MFEH 3BPCA 2Q3AA 4QXTB 1KJ2H 2RAMA 4RFNC 4HBQA 5CEZD 1P9MC 5KOVC 4EVNA 4UDUB 3NIDE 3UROR 5CIPA 4XX1G 5EBMA 5CUSL 4NQEA 5I15L 2IAMD 3T0VA 4X7TB 4IOIB 1PZUB 4FG6D 1Q72H 2IH1A 2VMFA 4P2RB 1RV6X 3QDGD 3QQ3A 1DBJH 3RU8L 3O6FB 5FUCE 4Z9KB 1HH6B 2D31A 2DLEA 2APFA 4XRCB 4HH9B 3U6RA 4M02A 1LEIB 3QCTH 4QCIA 4HZAA 4PB9L 5TE4L 2WQ8A 4O51B 5IVXE 4U2ZA 4M9OA 1OAQL 2Q86B 1MJUH 2CLVB 1JIBA 5J11B 3R8BB 4UNUA 5JO5A 4EUPB 4ELMF 1UXWB 1A9EB 3GSWA 3S96A 3VCLA 5GS2D 3KPOA 4O4YL 4EI6A 4Q0XH 4P4KD 4CJ1A 3TA3A 2JCCE 1IGMH 2OX5A 2QQNL 3QIWD 1MREL 3DX7B 4HIEB 5F6IC 4JB9H 5SV3A 4HAGA 1CG9B 1CGWA 1WTGT 3BP6A 5HPOA 3RUGF 4Y8AA 5IFHH 1C12A 3U0TA 5J06A 4OD1L 1S9VA 5EC2B 5CWSB 1A9BB 5I73C 1A6TB 3WXVH 4RA0C 2BK8A 4TSCH 1E27A 3V6ZA 1K6QH 3REVB 3OXRA 4H5SA 4BSVA 3GMLB 2CGRH 1J0ZA 2P42B 1NGYB 5IFJB 3MV7A 4YZFF 1AO7B 1D5ZB 1QFWM 1MVUA 1EX0A 3BQUC 3Q5TA 1YYMH 3ZKQD 3VD3A 3T2OA 1S9XB 4R7NB 1T5XB 5E2VL 5J13C 1FHGA 1N5AB 4EI5B 1P4LB 4RFEB 5DJ0A 3FQTB 2X4OA 3V8OA 3O41B 4JFEE 4JPKH 1RIUH 4M93B 3C5SB 4M61B 3O2WL 1JNHA 2OTUB 1MCWW 1KIQB 4PJAB 3ZDYF 35C8L 1VA9A 2DQDL 5C0AE 2ZOKB 1D5BB 3MZTA 1JK8B 3MLTA 3MRDB 2AXFB 1G9MH 1DEDA 2FWOB 3PWNA 1S7UB 4WUKL 1OCWH 3SKJH 1MI5E 4TTDC 1F2QA 1RVFL 5F7UA 3MRIA 2H2SC 4FTVD 4HUUA 3LD8B 1KTKE 3TNNA 1AGCA 3ARRA 1P6AB 3JVGC 3VDBA 4NKOB 4EZMA 4F80A 2AI0L 3KYAA 1IKNC 4R0LC 5IBLD 5JA9A 4JKKA 1YNTB 4EN3D 4LCWB 1E4KA 5EU4B 3AB0C 2BDNL 5DHVB 3N06B 1Q9OB 4AK1A 4QXTA 4WFHD 4RISL 5I1JL 4UDUA 2R1XB 2VXSL 4U6VH 3ET9F 5DGRA 5C09E 4X7TA 3L1OH 1AGFB 4IOIA 5B4MD 1CVRA 4P2RA 4J3WA 4KTEH 2OLDA 5C0GB 3O6FA 5DMJB 1CK0H 1Q9LB 3QISA 1HH6A 4E0RB 3JWOH 4XRCA 3CUPB 3MNWB 3BAEL 1TQBC 4HH9A 4OCWL 1LEIA 3BPLC 3SE9L 2UZYB 2RBLA 3RIAK 4OIIH 4O51A 3CLEL 3MRFB 4G43B 1NKOA 2Q86A 4UTAH 2CLVA 3O2VL 3FB8B 5ETUB 3NGBB 5INDB 4Y16B 4KAQL 2AGJH 5FHBL 3QUMH 1I9EA 3W81A 3VH8G 4EUPA 4JDVB 5D7JC 1UXWA 5ITFB 3HUJE 1A9EA 2V2TB 3SBWC 5CKAA 2I60L 3GUTB 4GRLD 2YD2A 3LRSB 3DX7A 4GAFB 4HIEA 1BM3H 1MQKL 1CG9A 1OAUH 1GC1C 4ZO6A 4M5YH 3CXDL 1FDLL 4JM2F 4BH7B 4TVPD 1WTLA 4D9LL 4OFPA 1U0QA 4PREB 3RZCB 5EC2A 5KJRH 5CKGA 3K2UL 2FATH 5CWSA 2AVGA 5EU6B 1A9BA 4IRSC 1A6TA 5CZVL 2ESVE 1QFWL 1OVZA 3BP5B 4ZUUB 1E4XL 1JGEB 3REVA 4XBEL 4XAKE 1YZZA 5E03A 5F8QC 2CDGB 3GMLA 4JFFB 5SWSD 1NGYA 5IFJA 1L0QA 1AQKH 3RY4A 4U1GC 1FIGL 1AO7A 1D5ZA 4GW5B 4U4BA 1YJDL 4TSAL 3KS0J 1S9XA 4R7NA 4ZPVB 1T5XA 1F4XL 3LKQB 4TQEL 3NFNB 1N5AA 1WZMA 4EI5A 1OAXH 1P4LA 4RFEA 2X4TB 1IKFH 4HC1A 3J8F7 3FQTA 1V7ML 3O41A 2APVA 3C5SA 4YHOH 4M61A 4R26L 4LP4A 5FHAL 2OTUA 2B39A 3NCYP 1KIQA 4PJAA 2Q6WB 3MUY1 2ZOKA 1D5BA 1JK8A 3MRDA 2AEPL 3PDGA 5C7XL 2AXFA 2FWOA 1S7UA 5A2IH 4PJEE 2EH8H 1T3FB 4Y4HC 4PJXB 2JF1A 5CBAB 3L5XH 1ZANL 4ONOA 4FQXB 4NKOA 5JDJA 2AXGB 3ORJA 4OZIE 4BZYA 1YNTA 1IQWL 4LCWA 3EIFA 4HLZG 5EU4A 1JF1B 5DHVA 1Q9OA 5FIEA 5SX4I 1R3KB 3O4OC 1PGRB 1U91B 4C58B 1E6JH 3OSKA 5BO1H 5D71H 4U7KA 2R1XA 3H42L 3ZYIA 4L3EE 5DC0A 1Z3GH 5DVOA 3V0AC 4DGVH 1AGFA 5E1HB 5F93C 3NACL 4NZRH 3FAXA 2Z8RA 5C0GA 3HPLB 4X4YB 4LLYB 1Q9LA 4KKAD 1FL5B 4E0RA 4WCYL 2OR7A 1A6ZB 3CUPA 3MNWA 4WTXA 1JZ8A 1YECH 1WBYB 3QWRA 4S1RH 3MRFA 3ZSTA 4G43A 4FQLH 1EHAA 3NAAH 3FB8A 4UINL 5SX5K 5ETUA 2VZ3A 5FV1L 4Y16A 5INDA 5LXGH 5BMFH 3BMVA 4JDVA 4U31A 4XVJH 5ITFA 2V2TA 3N50A 5CIPH 3EDDA 3T0BA 3GUTA 3TPUB 1HCVA 3V6OA 4RZCB 4YFLI 1AH1A 4IOFC 3SE8L 4J2XA 2VDNH 3LRSA 2YPVH 1TETH 3HRZB 1KSRA 2VDLH 4BH7A 1ADQH 4PREA 5HD8D 2B5IC 3RZCA 4HFUH