5HY9B

Glycosylated, disulfide-linked knob-into-hole fc fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
205
structure length
200
Chain Sequence
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural differences between glycosylated, disulfide-linked heterodimeric Knob-into-Hole Fc fragment and its homodimeric Knob-Knob and Hole-Hole side products.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 27
structure length 200
sequence length 205
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hy9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hy9B01
5DSCB 5GGRB 4LCYB 3KYOA 1KBGL 3VGFA 4YC2C 2X6MA 5DEZA 3TT1H 4M62L 4ZFFA 4CN1A 4U7SA 5FB8A 2UY6A 5FM8A 3P11H 3VH8A 3LIZH 5GZNC 4BKLB 2YD7A 1ETZA 2ZOLA 5FGBC 4WHTB 3MZTA 4YXHH 2PXYB 5L2JB 1IGJA 4P46B 4O51A 1RMFH 3G9AB 2AK1H 2P45B 5ADPH 1EHNA 3L1OL 4NQTA 4YXLH 3K1DA 2PO6C 3MV01 5D70L 2FH6A 1Z9MA 1A3LH 1S7WA 2GJZA 4Z77A 4LVHC 4GO6B 5T1LD 4HJJL 4PJXB 2AABL 4Z7UF 2Z8WC 5D70H 2DQEL 5F7LB 2P47B 3TH2T 1JP5A 1PX4A 3SKJH 1JGDA 3IJYB 5FKPA 2R2HB 3P77B 3F7VB 2Z4QA 2DQUL 4R7NA 4L4TD 4PJHB 2IPTH 4K3EL 2UUDK 4J6RL 5BO1H 5E1AA 4PLNC 1BOGB 1MFCH 1UADC 1ZLSH 2ED7A 4JGUA 4BJLA 4JY4B 1YPZB 4JO4H 4J4PC 4Y19E 4O4YL 2X89A 2E27L 2HTKD 3SDDA 5BCAA 2FEEI 3BP7B 3MACH 1G7JB 5DGRA 4K7PY 2VDKH 4P4KC 3D25B 2YMXL 1KF9B 1RHFA 5D7JB 5CJXA 5F9JB 3F12B 4NRXA 4LLDA 3VG0H 3IT8D 3BX7C 1UGNA 5EOTA 3EFFA 1MJJA 3HZVA 5ISZB 2E8YA 1LVEA 1AXTL 1MI5E 1KELL 1U3HA 3ARYA 4R26L 2Z8VC 4C4KT 3ULVH 2ADFL 3GMMA 3RWCB 3MOAL 2VXTL 1HWHB 4GUPA 1RUMH 3AMLA 4QRPE 4LMQI 1U8QB 4NRZB 1KT2B 1AHWA 4EOWL 3RUGA 4DGVL 3PL6C 1A8JH 1XF4B 1NGXA 5EC1A 4NN5B 4UUJB 4PLKC 4OM0L 2AV7B 5B38B 3X12B 1U8KA 5E2TL 1DUZB 2M1KA 4QOKB 4RFOL 5M95B 5I8EB 5HI4D 1CN4A 4LPUA 3CFEB 5C8JB 4FHBD 3W82A 2AJVL 4R2GB 3OKMB 4PJ5B 2BSRA 1ONQA 4L4TE 3R1GH 4CVWA 4QTIL 2RIKA 5JIKA 5C0GB 5GRXG 4LAQL 2DMBA 4JN1H 3O6LH 1FVEB 2V5YA 4LRNL 4RISL 4YUEH 3UZEA 4LSDA 1OW0C 3INUH 5BOZG 4IS6B 4OKDA 5AWNH 4C58B 2J3SA 3VD5A 5D7JA 2O61A 3W81A 4OFIA 3OKEB 5FYLD 4NT6B 4KZEH 2R1YA 3DVNB 3EZ8A 1YJDH 3CDFA 2VDQL 1LO4L 1BGXH 1NBVH 43CAA 2OCFD 3S96A 2XI9A 5DZOA 3NA4A 1GGCL 3D2UA 3RKDC 4MVBC 3D6GA 1J5OH 4UBDC 4LQFL 4X6FA 1MI5D 4F8TA 4Y5XA 2CLVA 1JFQL 3FN3A 5EG6C 4HGMA 3NPZB 1A6VH 5EOCL 3NIGE 3WFBH 1OTTD 3IFNH 1MVUB 4XP6L 3RKPA 4MNGA 5BW7A 5ADOH 1NC4D 4CNIA 5HY9B 4O2CB 4TVPH 2WWKT 1P5UA 4QRUB 5CJ8A 1WV7T 2Q1EA 2JJUA 2P8LB 3DECA 5FGCE 3LPGA 1S7VB 1PKOA 4R0LB 1TNMA 1BFTA 5CIPH 1WWAX 1S7QB 2VUYA 2B1AL 3VWJA 5CIPA 2ZUQB 4M1GL 4OFPA 3S34L 2JB6B 1L7IL 2Z92A 4P5TC 4U05A 4JN1L 2B1HH 3RI5K 4XNXL 1SEBB 2EC8A 1UWXH 1WEJH 4WJ5A 3HZMB 4YJZL 4YWGL 3QH3A 1OSPL 4X9FA 3RVVC 4G8IA 1WLHA 1VENA 1LEGA 3GI9H 2FBJL 4CW1B 3AAZB 4Q74A 4XZUA 1LE5A 2FX8H 4ZXBB 4IDLA 3UX9B 4Q9QH 5GSVA 1Q94B 1NC4B 5IEKA 3NFSL 4G9DB 5GQBA 1A2YA 5EO0B 1MLBB 3HPLB 5D1XD 4JZOB 4PJBB 3L3JA 2MPAH 4K7FA 2G2RB 5HD8D 3SCMD 4G8EA 1I85C 4KPHL 5IHUL 2QR0A 4L4VB 2X4NA 2N4IA 5C0ND 3U2SB 4R26H 4PGEB 2IC2A 4LSVL 2CRYA 3BPCB 4MAYA 4LPYA 2QQLH 1XF2A 3NABH 4ZQKA 1II4E 3Q6FA 3C5SB 5IF0B 1OOAA 4G8EB 4MXVE 3QUMA 2C1PA 3VXTA 4JFHD 1ADQA 4NQXA 4POZD 1MH5B 1MCDA 4HWBL 4V1DB 1D9KC 3PP4L 5J1AA 3PG2A 1L9MA 3D18A 5F9WC 3GBMH 1QSEB 2O5ZH 1JV5A 2F19L 3O8XC 4XP1H 5DUBA 1JGVH 2VLKA 1ADQL 5GHWL 5JOFB 4FOMA 3VXRD 1G6RB 2F53B 1ZEAH 3TIDA 5CFHA 1MNUH 1MFCL 4LL9A 4EXKA 1ZA6B 4QRQA 5KVGH 2Y23A 1QSEE 1H15B 4FQXD 4HPOL 3BP4A 4YPGB 4XP9H 5IJVA 2H32H 3MC0A 3ILPB 4FQ2L 1BVLB 5HGDA 4QNPF 4XAKE 3L6FB 3CCHA 1X9QA 1XZ0B 1MCFA 1M05B 1PFCA 3TA3C 2G9HA 3K8KA 3L3JB 25C8L 3UBXG 2VDRH 4W4NA 4BFGA 2YZ8A 3WN5B 1BFVH 4XCEB 3BO8B 1OGAB 2WIIB 1BFOA 1SJEB 3W9EB 1AP2A 4NCC1 1PZ5B 5DK0B 5DK2B 3CDGA 4RWYH 2Y9RT 1KN2L 5IIEB 4HUUA 2CRMA 3SE8L 3MR9A 3QDME 1MCWM 3GKZA 3MOBL 1P6FA 4V1DA 5KS9F 4ZUVA 3AU1B 4NKMB 4AT6B 2VDPL 1A9BA 1UKSA 3DMMB 3I2CH 2H2SC 2P48B 2EDHA 4M6AA 3ZDZE 3RIFK 2R0WL 4JFHE 4XC1L 1XT5A 3DETC 2YK1H 1HILA 5EUKA 3CMOH 3KDMB 3RJDA 3HUJE 1NUGA 1JBJA 4EI5D 5CP7B 1NCWL 1ZGLP 3HAEB 5CJOH 1F4XL 4Z7QE 2LVCA 3ES6B 3MNZA 4H0IA 1BEYH 4L3ED 2X05A 5DHVA 5HJ3B 2EKSB 3V7AG 4YHKH 3LKPB 4PJXF 4U6HB 1DE4B 1IAOB 2X09A 3U0PB 4FTVA 2NLJA 5EORL 1M7IA 4X5WA 4XI5C 5K9KB 4WGVB 4UILH 2NY7H 1IAIH 2YRZA 1CGTA 1UWEH 1TITA 1RZIB 1FG2A 1KIRB 1G9MC 4P59L 2MJWA 4ZTOL 1IGIH 3MRGB 3RVWD 1U3HD 2BVYA 1QVOA 2JIXB 3RTQA 1FG9C 1FH5L 2IFGA 3QNZB 4JO2H 1IKNA 3IDXL 4HUXB 5HYQB 1DBBL 3MRJB 1U8IB 3FMGL 3CDGB 4K3JL 4YHNB 1CDGA 2ZCHL 3IDMB 5C0CE 4A6YA 3ZTNH 4DFHA 3TWCH 2F74A 5JHDE 5E0QA 4KK6C 5F9WB 1IFHL 4PIRF 1QQDB 5FYJL 2GQHA 1F5WA 4Q6YA 1D9KA 2P42B 4UOW1 5GGTA 2YZ1A 3V5DA 4KUCF 4HULB 4JRXB 1TPXC 2NY5L 2UV3A 5DWUL 1LEIA 4EQ2A 3BN3B 3CD4A 2HT4D 2IBBA 2BOCA 1UYWL 3GMRA 3WO3B 2VQTA 3I50H 4Q0XH 5F9DC 1R0AH 4G8GA 4ISVA 5DJ2A 3OJDA 3KPSE 5BOPA 3IYLW 2R2EA 3LEVL 4R4FH 4FQQB 5FA4A 2OTWA 3D18B 3GI8L 3P4MA 4M9OA 2Z35B 4RMUA 4QHKJ 1G0XA 2VLRE 1H0DB 1INQB 2X2YA 4OZFA 1SBSH 1OT1A 1NAML 3DPBA 3MRHB 3N1MC 3VFSB 3GHBH 2BMKB 1MWAA 1C12A 3X3GH 4TUJA 3SDCC 3NFNA 1K4CA 3AM8C 3GB7A 1YEEL 2AXHA 4IRSD 3HS0B 2EO1A 1DN0B 3BKCH 3NA9H 3B4NA 4HIIA 4PRIE 4EBQH 1X3DA 2F9BT 1DN2A 1HKLH 4O5LL 5E5MB 1OAKL 5EU7C 1ZE3C 2P7TB 1CXHA 4JDTL 1G84A 2X4SA 1U3HC 1SY6L 1S7WB 1W0VA 1C16A 1EVUA 3T4YA 4KK5C 5D2NC 2VN4A 3SO5A 4ERSH 3V7MA 3IFOB 5I8EA 4X98B 4HMEA 3Q5TA 2AJZB 3ARFA 1UFUA 3QIWB 5J12B 3HG1A 4KY1L 4WHTA 5L2JA 1JVKA 4KAQH 3PIQA 4PB0L 2JB6A 3EO0A 3MA9H 3LSOB 5I6XC 5EZOL 5H35A 2IADB 2R4RL 4OCYH 1UZ8B 5EPMB 2WBJA 4N5ED 1EHAA 4HZAA 3DX8A 2AK4A 5DHVH 3ZE2F 4CVXA 3FFDB 5C7XH 1D6EA 3HI1A 3MRNB 4QRPA 5D9SA 4HWZA 4DZ8A 1CWVA 1NGZB 3TLRA 1MCOL 3IU4H 4WUUE 1WBYA 4TNVK 3FKUS 3TCLA 2B4CL 2QKIA 4P99A 5CMAA 3SGDH 5I15L 4NJ9H 4Y7MA 2C7UB 3BJ91 1YEEH 2VLJD 2DQFA 1FO0H 3FFDA 1K5NB 1A0QH 3KXFD 4N0YH 4LEOA 3SDAB 2HJFB 2DWDB 3LN4B 1GXEA 5GS2D 3VFNB 2GEEA 4BQBA 5DRNB 3HUJF 4JY4A 5E2UL 1KGCD 4XPFL 5KVFL 5CGYC 1EGJA 3JSSA 1F6AB 2EZ0C 4H25B 3U46A 3ARFB 4ENED 3FRUA 1BF8A 3P30L 4Y2OA 3S34H 4WFHD 3C09C 4PJDE 5DJ0A 4P4RA 2V2WB 1Q9LB 1AO7D 4JPVH 2AEPH 3UC0H 2HFTA 4LP4A 2NY5H 3B6SB 3OSKA 4XPGH 4F58L 2XKUA 1JUFB 3HMXL 4AYFA 2PTTB 3MBEC 3HAEG 3DXAB 3IETB 3P3YA 2P8PA 5B4MD 1KTLA 3W9DA 3VXSE 1BIIA 1H3WM 2DD8L 3QT2A 4Z0XA 5ITFA 1CXLA 4YHLL 4JQVC 5E6IA 1T7ZA 4F80A 1X7QA 3LN5A 3BFOA 2OL3H 4LLVB 1KXTB 3HE7D 1U91B 4J3OC 3IDJB 1IGIL 3V5KB 4JY6B 4KI1A 5DJCA 3F7YA 5E94A 4PJ9B 1KJ2A 4JKLA 5CBEA 1NBVL 3TYFA 2DI8A 2JE8A 2VDQH 3DURA 4N90D 1YNTB 3CVIH 3QDGB 1JZ3A 1VADA 2BHUA 3I3DA 3BWAB 3NTCL 3ARXA 5E2WL 1CGUA 4X4XA 4ZSOE 5ACZB 3K4ZA 1NCWH 4XRCA 5AWNL 1KGCE 3TYGH 4YHYB 4E41A 1G9ML 1OB1B 2VXVL 3I3EA 3RX8A 5F1NA 4JFXA 4RRPG 3TT3L 1XMWA 4LAQH 4RISH 3F5WA 1D5MA 2DBLL 4OCRH 5GGTL 1WAAF 3I6LE 5DJZA 2EDEA 2CSPA 4OIBA 2ATPB 4JZJA 5EWIH 1J1PL 3BP7A 3QEQB 1EBAA 5IG7A 3OKKB 3Q5OA 3CZFB 2W0FA 4ZPTA 2VDPH 4OFYA 1BZ7A 3KR3L 1F4YL 1UM6L 5IROC 3S36L 1UB6B 3RDTC 5EZLB 1F58L 3JUZA 3VFNA 3H9SB 4GKNA 2Y25A 3T8XA 4NM4H 2PXYC 4Z7OE 3OXSB 5F6IC 1KIUA 1RIVL 3VXSD 5F88A 2D0GA 2XWJA 3MV8B 3IJSB 3D1MC 3WLWD 5DURD 1I9IH 2HJLB 3MRLB 2X4UB 4BQ9A 4F7PA 2ORBL 2DYPA 1QP1A 1S78C 5GRUL 1KXQE 4NQEE 3U9PH 1A6WH 3CFJB 1R3JB 4NFDA 4Z7NF 3BKMH 1M7XA 1A7NH 3IDYB 5JLZB 2N1KA 2CLZA 2YMXH 4Z7UB 3QFJB 5EB9A 3QZWB 2IPKA 4UT7L 5IVXF 2V7HA 1NC2A 3HNSL 5EZJB 4WJ5B 3OMZA 3OB0H 3BRFA 1G7MA 4ZAKD 4WGWB 3QWRA 4FZ8H 4PLKD 3IDGB 3AU1A 4W6XB 4OZIE 5DQ9B 2O5ZL 5EUOB 4BFIA 2BNQA 3BPOC 2XFXB 4Q6IB 3KPRB 5IB3B 3DYOA 3MRCB 3QEQE 2J2ZA 1MCSA 4EN3A 5I1AA 1MF2H 3EJZC 3RZCC 5KG9A 2GCYB 2OLDA 2I26N 2J4WH 1AD9A 1I7TB 1UVQB 4WEMB 2Q8AH 1NCCH 3ZTJG 1XAUA 2GFBB 5GS0C 2R0ZL 3PABA 1B4RA 5DYOB 2VAAA 2R29L 2PW1A 1F02I 3HNVH 3IJSA 4DTGH 3SGJA 4KH2A 1CFQB 4NHCH 1HHGA 3QDGE 3MRMB 3GGWB 4HS3B 4IRSB 2XWTB 1T2QH 4IMLB 4YHOH 5B22A 2XQYG 3O6FC 2UUDH 4D0DA 2AK1L 4DW2H 4L8SA 5IW1B 1T22B 2DLIA 4RBPH 1S5IL 3WIHH 1JHLL 5IP4A 2APWA 1O7SA 2WUCL 4XBPA 2CK0H 4H8WL 4KJPD 5DD6A 1LDPL 5D5MF 2YUXA 1O0VA 3KPQB 5IQ9A 3GI9L 1QA9A 1PSKL 4XBGA 1M71B 3NN8B 3K7UA 1KB9J 2DKUA 2VKWA 3ELAT 5DVLA 5LG1A 3ZMRA 2LU7A 5HHNB 4J23A 5CKGA 1TTUA 1VACB 2NTFA 3GNMH 4FXLA 4D0BA 1C08B 4OM1H 3U4EA 3SKNA 4ZFZB 1BREA 3W11D 15C8H 3BQUC 3F7YB 4X8XA 1LK3H 3LKOB 4Y19B 5FUZL 1Q72L 3ARDB 3BVNA 5TDPA 2P44B 4D0CA 5D5MB 1DL7H 2MFNA 3QEQD 1U8KB 4POZC 4HJGB 5AUMA 5IVZA 3NZHH 3MCKA 4UU9B 3CXDH 3O0RL 1XEDA 2H3NA 4PJFE 4JZOA 4Y4FA 1WAAA 4XCFH 3UZQA 3WFBL 1RJYB 2VLLA 3ARDC 1LQSR 3IB4A 1D3CA 2WNGA 4UAOC 3ULVD 1G9EA 3ARSA 2ICWI 1OSZA 5DTFA 1BIIB 1BVKB 2CDGB 2NNAA 2PN5A 4WRLA 5IMKB 3U4BL 2NY3D 4LQFH 3HZKB 2W91A 2Y36H 3QCVH 2JCCB 4OD1H 4NYLA 4JDVB 1GGCH 2APXA 4V2CB 4L9LC 4QRRB 3MFFA 5IFAH 4M3KB 4WO4A 1UQSB 4NGHL 3ARWA 3BWUC 5DJ0B 4ZD3L 4X9IA 1IC5L 4XP4L 5KS9A 5EBGA 3O8XA 4BQCA 4BSVB 5EU6D 5CP7A 3BZEB 3KPSA 5F93C 2HKFH 2YD9A 1RJZA 1HE7A 2RFXB 2D03L 4A6YB 1HQRB 5I8CB 3LEYL 3FT3B 4LCCB 4O9HL 2C3WA 2BVUA 3LS5H 4MNHA 1DQDH 3E8UH 1ACYL 4R4NC 4CADB 2IPUK 5ELIA 1AQDA 4LKXA 1QRNA 2R2HA 5TPWH 1HH6A 4RX4D 4GW4A 4KKAD 1P6AB 1KCSL 1NLBH 1V8HA 3Q1SH 3F8UB 2YPLD 3RZCB 3GJFK 4HIHB 2LQRA 4DGVH 1QSZA 3MV7D 4NJ9L 1N0XH 4KHXH 3MJ8B 4XHJC 3C8HA 4PBVC 1QFWM 1EEZA 4ELMB 4J3WA 1RJZB 1TCMA 3S3PA 1HHHA 4YK4C 1R3IH 4OZHB 2EDOA 1L7TH 4NKQB 2IALB 3L6FA 2DQDL 2DM2A 2XXMB 5I76A 1ZLUK 1EMTL 3T0EA 4E42A 1XR9A 2F5BH 3B9KA 3VG0L 4QHMB 3VH8G 1FNHA 2VLRB 4AY0A 4HPYH 1Q0XL 3V4PL 3QZWG 1C16B 4TNVF 4R9HA 2XRAH 5EU6E 3RWIB 5JA8B 1IGTA 1T1YB 4PG9A 1TVHA 5SWQA 4RAUB 1NEZA 5IBUB 3MJ6A 4IOIA 1JRHL 3QO1A 3WUZA 3MA7B 3BT2H 1BQSA 3WJJA 4C56A 1OCWL 5INDB 1KT2A 1CFVL 3SKJL 2VWEC 3B5HA 4I4WA 1HH9A 1IL1B 1D7FA 1I8MB 4D9QD 1P2CA 3W11C 5DJAA 2WV3A 3BH9B 5C0IA 3ARGA 3X3GL 2YPLE 4HMDA 2XKSA 1DQMH 3IKCB 3FRPA 3MV7E 5KW9H 2VABA 1CTNA 1MLBA 5HDLA 5E8OB 3QWQB 2GSGB 5EN2A 5M94B 3QNYB 1BAFL 3D25A 3PP3K 5HGGS 3PP3H 1RMFL 4P9HC 4Y5VC 3MXWH 2APTA 4GT7A 3KPQA 3PGFL 5GRVK 1X4ZA 3NIGF 3GI8H 3SDXB 3J7HA 1L6ZA 1WFNA 3EOTH 3MO1A 4JPWH 3D69A 3LEVH 4R4FL 3VFOB 4AK1A 1YPZF 1FGNH 4M62H 2OJEB 3QWOB 2X4TB 5E4EC 3BPCA 3GMLB 5DHYB 2X44D 5SWZE 1FCCA 1XGPA 1JWMA 4OLYL 3TBVA 4TNWF 4ELKA 4S1RH 2E9JA 3VD9A 1UCTA 2D7TL 3H9YA 3V0WH 4X6EB 4ZAKB 1KNOA 2PETA 4KFZC 4PY8J 2F74B 2X4QB 4HD9A 4PJ8A 3CSBA 4UDTA 1CFSB 1EEZB 2AJUH 2C4FU 5JR1H 5DHYA 2DI9A 5CSZB 2FSEA 1HNFA 2J88H 2OMBA 1U3JA 4G42B 2B5IB 2DMCA 5CAYB 4LIQE 2YC1B 3SKOB 3O3BA 3FMGH 1DBBH 5HVHB 5HDOA 1LO0L 4LLQB 5ESVA 4RIRB 1HH6B 3FB8B 4LASH 4RWHA 3VFVA 4PJGE 3VXSB 1BQLH 3EYUL 4XVTL 3IFPA 5B8CC 5BS0A 1I4FB 3GJEB 3ARRA 5E24E 3C09B 4BZYA 4FQ1L 1WBZA 4CBPA 4I4WB 5HYJA 4KZDH 4OCXL 3NAAH 3H42L 4N0UE 2GITA 3VFWB 4NKIH 4CNIB 5INCB 4G8GD 1CDUA 4PRNA 4DKAA 2NTSP 3RWHA 3ME0A 2XY1A 4F7CB 1A7PL 4ODHL 2R8SH 1P7KA 2HAZA 4JREB 2GJ6E 4R97C 2R4SL 5DEFA 5JUEL 4ZUTB 1FNGA 4IOSD 3EDKA 2A9MH 5JA9A 2A6DB 4JVPA 1WCQA 2DQIH 5ESQA 1MCWW 3CFEA 5C8JA 2DLGA 2VLLB 1TZHB 4H1LB 1NEZG 3N85L 3ZHKA 3I9GL 3QXAB 3LAFA 2Y72A 1JI2A 4NNXA 5DD1L 4U33A 3ARGC 5F96H 1T7YA 4M7JL 1NGXB 2I27N 4WUKH 1YEGH 3X14B 2LAAA 3BP6B 3QUXD 5IGXH 1CGYA 4PJ7E 1AI1L 1HHHB 1V7NL 4GH7B 1IEAA 3D0VA 3CGTA 5SWSE 4HDIA 4HK3N 4PJCB 1SJHB 3L5JA 3EYSH 4AZ8A 3LPWA 5T3XD 1ZLWH 4WFEE 5GGSY 3O4LA 5DRWB 4O2EB 4PUBL 4XP9L 3G6JE 2LVEA 4Z7WE 5EOTB 3VGBA 1YY8A 2DMKA 2AXJA 4HUNB 1T83C 5T1DH 5DA4A 2VH5L 3VGGA 3VXOB 1YNLL 1EBPA 3B9DA 3LMJL 1QPPA 4TULL 2QSTA 1TQCC 3B83A 3O45B 4OD2A 1OT2A 5D7IB 4KKAC 4MQSB 5TQ0H 5IVOA 2Q8BL 5D1QA 5MEOA 4L8SB 4NNYA 5IW1A 4P2QA 4YX2L 1HQRA 2ITDA 4ODXB 1CE1L 3QFJA 2ZUTA 1T6WA 2ZUYA 1WZKA 4OZGB 4WU7B 4LHUA 1MIML 3ALPA 5HPOA 5KANI 3RWCA 5L8KB 2COQA 4JFFE 3NABL 2GJ6D 1PQZB 1KC5H 3OTTA 4HG4J 4E5XB 1CCZA 1C1EL 2AAVA 4G8FA 2KUTA 3LEXB 4FFZH 5I73C 2HTLC 4ODUB 5F21B 3RPIA 5I66B 2RHEA 1HEZB 4XX1E 3BGMA 3PNWA 2D3VA 4C57C 1IEBA 3DOSA 3ZE1E 1JZ6A 4X9GA 1A6UL 4HC1H 3T0XA 1VEPA 3MTRA 3WNKA 1AGBA 1UJ3B 5ID1A 1YEFH 5GSVB 1AIFB 5C6TL 2EH8L 2P24A 3GFUA 5SWSD 5LGHL 1A7BA 4FP8H 4RBPK 4PRDB 1AHWC 3CZFA 4I13B 1KN4H 4MDIA 4LU5H 1PG7H 4R7NB 5DR5L 4YWGH 3TZVC 4AENB 3G5VB 2NX5D 3O45A 2OXHA 3QIUA 4N5EC 1WFUA 1S7VA 1KCUH 4YDKH 5LAXA 2CIIB 5IB2B 3QJFB 3LN9A 2EDNA 4R0LA 1JN6B 3AVEA 4FTVE 3ZT7A 3ARQA 1JPGB 1ZHBA 1CICB 3ZKMD 2IF7A 1MVUA 3TN0D 4K71C 4MQXD 4WI2A 1HINL 5I1GL 2HRPH 3BEWB 3TF7C 2WW8A 1FZJB 2IANE 4P9HH 1G9NL 2LTQC 3OHXA 3VG9C 5I19L 1Q9WB 1T21B 4QWWD 4X6FB 5DGQA 2EDQA 1ORSA 4XTRD 3VFPA 1BJ1H 4H1LG 4GRWF 1ZVSB 5L9DL 5FF6B 4M1DH 3KWWB 4QYOA 1FYTE 3KWWA 4YFEA 2EZ0D 1OQXA 3MNVA 1I9RL 2VL5B 1T20B 5HPMB 4ODSL 5CP3A 2Z31A 1N4XL 2Q86A 3KGRA 2UWEE 4NZTL 4NOFA 1AE6H 3L5XH 1UZ6F 3CMGA 4GKSB 1AY1L 4HH9B 5JZ7D 1XGRA 4JFDB 4J3UA 1RPQA 1T4KA 4B5EA 3ULSB 1BVKA 5ISZE 4OCXH 2YUVA 1KCVH 5E2VH 3VFGL 1CI5A 1IEHA 3O2WL 4GW1A 2FGWL 3Q6GL 1DANT 1FJ1B 2RAMA 5DJ8A 2XFXA 4Q6IA 3FFCE 3DARA 3RKDD 4NN7C 4H25A 3U46B 1KJ3H 4EI6B 1LDSA 1AKJB 2Y7QB 5JDJA 1YMMD 4ZS6D 2ZCKH 4OI9A 3SGKC 4LARH 3WFEL 1YC7A 5KVDH 4E42B 4CGTA 1KFAH 5EZJA 1OAYL 4NCDA 4D0CB 4Y8AA 4DKEL 4RMRA 5LBSH 3MX0A 3MRKB 4HLZH 3B2UC 2C4XA 3CUPB 2OTWB 2D2OA 1UM4L 2EIEA 2CRIA 3WFZA 1E27A 2VERN 1RUML 8FABA 5CJQH 3O3BB 4H26A 1J11A 3AMKA 4UINL 4X4ZA 1EZVX 3ULSA 5IWLA 3LB6D 4H0HB 1EV2E 3NN8A 2E5EA 2UWEF 3T0EE 2BCKB 4PJ9D 1ORQA 1S7XA 1DSFL 2YN3A 5KN5B 4QHNB 2BNUB 4OV5A 3G08A 1EJ6A 3CFKA 1YEIH 3Q2CA 3HE7B 1I7UA 2A1WH 5FO9A 3DYMA 3KPMB 5CBAB 4RFEA 5KTEL 3V7AE 3O81A 4UMGA 2DQCH 4LSUL 3WJJC 3GSWB 5HDBE 3UJJL 5ENWA 4JO4L 3P9LB 1Z5LA 4WHCA 3O6MH 3QEQA 1ZLSL 3NVQA 5ISZD 2OMNA 4U1HB 3EDEA 3JV6A 4R7DA 5GJTL 1IC1A 2V7NA 5GGQH 4EDXA 4OIIH 5D7JD 3FFCD 1U3ZA 3MGOA 3BN9D 2IQAB 1LD9A 1DQQA 2BVQA 3ZSTA 4K8RH 2Y07L 2DQHH 2QQKH 3KYKH 2QKIB 1YMME 2E6JA 1WZ1L 4QHNA 2YKLL 4OV5B 5DMGC 4GRLB 1YDPA 3PWVB 2YPLA 5KSUA 4UV4H 3MRCA 3QDGA 1CD9B 4KTEH 4RNRB 1CIUA 4XPTL 4XCNA 4AG4H 4TPRH 4KVNH 1QZ1A 35C8L 3DVFA 3KJ4B 4P5TB 5ANME 5KSVB 1INQA 1H0DA 3GMNA 5IVZB 1CLOL 2HLFC 4WEUD 1JZ2A 3L3KB 3T0ED 4HEME 3CJJA 4HFWA 1QFOA 4WI8A 4GS7C 4C83B 3CFBB 1KTLB 2DLHA 4Y19A 2V2XA 2A0LC 1YY8B 4HPYL 3BHBB 3C5ZB 4HZLA 5L6YL 1JZ8A 4Y4KB 4BA8A 2XQYK 1NGYB 4F37K 1SY6A 4OLZH 4OBRA 3BAEL 3L3DA 4YHPB 4JM2A 5L2KA 2AGJL 4AJ0A 1U8PA 3LEXA 1KB5B 1ZTXH 5JW4R 2FNBA 4NCC2 1L4IA 3X13A 3TVMA 3KYNA 4KRMB 2Q86B 4PJCF 2HKHH 4K71B 4KHXL 5ICXA 1P84K 5IVNA 4OLWL 3CZJA 4XNMB 3IGAB 4LCIH 5AG8A 1MJ8H 3ZKND 3EYVA 1ZWIA 3O2DH 2AXFB 5K93A 2F53A 4QRSB 2BJMH 1I1CA 5D7LA 3ORJA 2CXKA 3F5WB 3G6AA 4PJEA 4AMKH 3TZVB 5KSAC 4N9OB 5DUPL 1ZXQA 4NUGL 3EKCA 2ZNWA 5CGMA 2NMSA 1A6TA 2Y5TA 1IAKA 1PJ9A 1SQ2N 1IAOA 4X4XB 3QPXL 5J11C 5DJYA 4U1LB 5B3JF 4I48B 4M8VA 1EHLL 2ZKHH 2ZPKH 1N7MH 3RA7L 4NGHH 4OLUH 5DQ9A 2I60L 5H35B 2EXYD 4N1EA 3GMPB 3HUJA 2YPVH 1XGPB 4RGOL 5AAMA 4OD1L 4C56D 4YGVA 3U4BH 1P7QD 4LLWA 3LZFH 2C9AA 2BRRH 5L9DH 1BZQK 4AMKL 4NZJA 2P8MB 5JDSB 4U7MA 4HQQH 3V52L 2X70B 1JUFA 4QCIB 4CJ0A 3BH8B 3GO1L 1LNUB 4ZFGL 2EEBA 4JQVA 1E4XL 1G9NH 1CQYA 3FQRB 3NZ8B 4UQ2A 4X7SH 1MJ8L 1GZPB 1TTFA 3O41B 3QEUA 4PTTB 1A7OL 4LFHG 4P4KB 5T33L 4GXVH 3O9WC 3NCEB 3HAEA 3TCXA 4YXKL 1F3JA 3OKOB 3H8NA 1AFVL 1VERA 4FXGA 4NRYA 4JANB 4YPJA 3QISA 1CLZH 4U6YA 1J18A 1L6XA 1YC8A 4I48A 1EJOL 2VXUL 1RULH 4OFKA 4D8PA 3IXAA 4OCSH 2NYYC 3RDTA 5DR5H 5LQBH 1KN4L 1UH4A 5E08L 2ZOKA 2YOCA 5D72L 5L0QB 5EBMA 1QFHA 3ZDZF 1F45A 3WIIL 3L3IB 4FP8L 5LGHH 5I1LA 3MJ9L 3HZYB 3MYZA 2OSLA 3MROB 4GRWH 1L9NA 3ARBB 3E6FA 4OZ4B 2CR3A 3SY0A 1T2QL 1IQWH 4YHOL 3BH9A 1TJIL 3FO1A 2OR9H 4YDIL 3X17A 4HJ0D 3QUKA 4C56E 2FJHA 4JFEE 1CT8A 1NLDH 1YMMA 4NDMB 3T0EB 4AIZA 5IR1A 1JGLL 4JGJA 1KB5A 1EO5A 1OAXL 3D0VB 2K3TA 1C1EH 1AD0A 5BS0D 2FO4B 1OM3L 1DLFL 1FNSH 1WZ1H 2NR6C 3IFLH 5HDQL 1RZGA 5KSAB 2EYSB 3QUZD 1GC1C 3AXLA 4KVCL 2HFFB 4ZS7H 4YX2H 1X5HA 3HI5H 2YXFA 5DDHB 3U79A 1LEKB 5C3LD 3RVXD 1G6RA 1QBLH 5HYFA 2BOBB 4YDVA 2UZIL 4UV7L 4XVUC 4TULH 5T5FL 3TV3H 4FZ8L 3AGVA 4NQDB 4J1UB 4C54A 4POYA 4FG6C 2VH5H 5HGHB 5T1DL 1Q9OA 1KB9K 5INCA 3WD5H 5C0AE 3GMNB 3TIEB 3MNZB 4QRTA 5SX5K 3S4SB 3P4LA 1UXSB 3T0DA 2AQ2A 1UACL 2NY4C 1P2CB 4LCCA 5H37H 4L9DA 4XB8A 4WHDA 1U8QA 4U6YB 5GRUH 4JFQA 1IM3A 1Y18B 1JGEA 1PD6A 2IANA 5EFIB 1QTYT 3MA7A 4H1LH 1FFNB 4X7TA 3MCLL 1PKQA 4DN4H 4EZMA 4LDLB 3EUUA 1UQSA 5DD1H 1I4FA 1QR1B 2DWDA 5EO0A 4NM4L 3MRLA 4JFED 3RGHA 1FYTA 1E4WL 4X7DC 5EBLA 5AG9A 5CHNB 3B9KD 4XMPH 4GXUN 4OZFG 5LKNA 2ZOKB 1VFAB 1UM6H 4M7ZB 3D39A 2W59A 5JHLL 2CH8A 4YQXL 5DD5L 1RFDH 3DTXA 2I9LA 4JO1H 1KJ3L 4Y4FB 2IH1B 1TIUA 1D6EB 3HI1B 3PXHA 4RDQG 4N0UA 4ZG1A 4FXKA 4BH8B 4RGMB 2R9HC 1X5KA 2VXVH 4Q58C 3WEXA 2AJ3A 2F54E 1NGPL 3RJQB 5FM4A 1U8LA 4PJCE 3BEVB 3OAYK 2I9LB 4P2QD 2F58L 3T0VA 4ELKB 4QRRA 2HVKB 4UTBL 1R6VA 3CVIL 2GJ6A 5I1HH 4H0GA 5C0AD 1QVOB 3BKJH 3RTQB 2QJDA 4PB9L 3WNOA 12E8L 4KTDL 3FQNA 3SGEH 4YQXH 2FIKA 2JK5B 4JRYB 1G7HA 3EDDA 2IGFH 4K3GA 2GJJA 1QR1A 1BD2D 1YYMH 4F9LC 2ZOLB 3KYAA 2D7MA 3KYMB 4S2SA 1MY5A 1W8OA 4U4BA 5F1IB 4ALAH 4QRPD 3RVUD 4MGXA 5C0RH 3CSPA 5E6IB 5JR1L 4XBEL 1QFWH 4MD0B 4QXTA 3QPQD 2VNCA 3Q48A 4MJ5A 2ID5A 4XPGL 1MRDL 1HHGB 3VFTA 3WXVL 2G2RA 1FAIL 3P0VL 3G6JA 3VRLE 2WP3O 4X0KB 1MOEA 4OLYH 5JOEA 1TVHB 5SWQB 1WFOA 1CLCA 2JKXA 3ZDXE 5IJKC 4UDUA 2Z31B 3LDBC 4QWWC 5FCUL 2D0HA 4AM0B 5B39A 3VXPB 1CFNA 3FZUC 3SDDB 4PGDA 2NZ9D 1X5JA 3BW9A 5DRZB 4ZOAA 5E2UH 3SO3C 3CFDA 4TNWK 3DIFB 1AQKH 2ZG1A 3L9RB 5FYLE 2VLRA 4QXGL 1U8NA 4KXZI 4JFFA 1ZVSA 3WJLA 1WZLA 4Z7WB 3VWKB 3QB7C 1ZS8B 3MREA 3FT4A 2IALA 4TRPL 5AYQA 3DROB 1RQ5A 2B4CH 3ARED 5AZEH 1X5YA 3MJGX 4M6MH 3OGCB 5GGUB 2VZSA 3C5ZD 3GSVA 2R1WB 3FO9B 4HZLB 2FATL 4MNQA 3PWVA 5KVEH 4HGWB 2J6EL 4LDEB 4IMKA 5HYQA 2F8OA 1U42A 3EYOA 3GSOB 1GAFL 5LXGH 1HI6A 1NCBL 5I74C 5SWSA 4Y88A 2BSED 3BPNC 2PXYA 4YNYA 1PDKA 4L9LB 1KYOJ 3FQXB 5C2UB 5CWSB 4Z7WA 1BP3B 1FL5A 3UEZA 1KJMB 4LSSL 5ALBL 3HG1B 1LP9E 1CICC 3BOVA 3RDTD 3QQ4A 5IFHL 3STBA 3TFKD 4MQ7B 2BVPA 3VXQB 3VD4A 4LVOC 4OT1L 3N1PC 3K3QA 5DQJA 2R9HD 4ZO6A 1CG9A 3OX8B 1OP5H 3IU3A 3N1GC 3IU3B 4GXVL 4MHHG 1W0WA 3MFFB 1NFDA 1LO5B 2YN5A 1IILE 4EIGB 3UO1L 2WZPD 3Q1SL 5E4IA 1E4XH 2VL5A 3F58H 5E9DB 2GTWA 1NAMH 2NNAB 4ORZC 1VA9A 4P0DA 1V7MH 4L5FH 1NSNH 4J4PD 1QSFB 3BSZH 3LH2H 4OGZA 1KJMA 2VZ1A 5CJBA 2BRRL 1FZMB 5FECA 4F2MA 1GGUA 4OZFB 3VWJD 2EDYA 3VCLA 3WUWB 3V6BR 2IFFH 3MXVH 2YPVL 2IBZY 5I73B 3QIBB 1HN1A 3HTLX 3IDIA 4ZDHB 2V2TA 1S3KL 3G5XB 1K4DA 3B43A 1TMCB 1DP0A 1NCDH 4NKIL 5HYSB 4NUJB 1NAKH 5GJSL 4Y1AA 5BVPH 1QEWB 4N0CC 2BC4A 2E6PA 2L0DA 3LHPH 4HBQA 1IFHH 3GJFB 4KROC 3VXRE 2OZ4A 3MRKA 5F9OL 2EDJA 3TWCL 1K6QH 3OAYH 4K9EC 4FABH 1B0RA 1CK0L 3G5VA 5JIPA 5LWYH 2WBJC 4FFWD 4HKZA 3T0BA 4X9BA 1PEZA 1DBJL 1RZJH 3G6DH 3ARDD 4O58H 4AIXA 3IF1A 2PNDA 1FVCB 3P4OB 4Y2DA 3IF1B 1A1OA 4H88H 3C60B 4M8QB 5MEPA 4GG8A 3SGDI 4Q6IC 3QUYB 3PWPE 4HUXA 4LCIL 4OLEA 2D4FA 5J3HC 1GGYA 5IMLB 2AQ3A 4IS6A 3HZYA 4JVWA 1J8KA 2JJTC 4M61B 3UTSE 3DO7B 1WUNT 1FZJA 2AI0L 3W0WB 4PRNB 2X4RA 2BC4B 3KXFA 2JJSA 1KCRL 1MUJA 1T5XB 4DGIL 3OG6B 1BBDH 5GGSB 3ROLB 5AAWA 3ZE0F 3GM8A 3QDMD 2Z9TA 4PREA 4D9LH 4NRYB 4MD0A 2BNQB 3ILQC 4O02L 1QHOA 3MLYL 3TO4D 1F6AA 4WWKC 3QO0B 3UPCA 5GS1C 3WYRA 4CW1A 3RZWA 3ZDYF 5KAQF 3SGKA 1ZLVH 1Z6JT 1RSFA 2VQ1A 2YWZA 4JPIA 4JREC 3U7WL 3FT2A 5FYJD 4LK4A 4FQIH 1A9BB 4LVEA 3QFDB 3LKSB 4QCIA 2R2BB 1MIEL 3OPZH 4L3EE 3D48R 3LQZA 3RVTD 1CICD 2DYPB 3SKOA 2A6JB 5KOMC 2X10A 2V5MA 1GGIL 4TQEH 5FOJA 4IRJC 2FSEB 2Z31D 3GSRA 4P2OD 5CZKA 4JGMA 2AK4B 2D31B 2JCCF 3MBXH 5JW5B 1F3DJ 4FQ2H 4TSAH 2X9WA 4X4YA 5BJTA 2NXZD 4HBCH 3S37L 5CINL 1J05A 1VFOA 1MQ8A 1H3VA 1ERNA 3F6IA 4OUUB 5C0CD 1CF8H 1X6LA 2A2QT 3MUGB 5GJTH 2BSSA 1KOAA 4HKJB 3UTSD 2DBJA 4Q9RH 4IDJL 1BWWA 2WP3T 4HK3J 5MENE 1MCEA 2X4TA 2FWOB 1CD1A 2CKBL 4MA1B 4W81A 1CS6A 1CLYH 1VDGA 5GS1A 4E0RB 3K46A 3B9VA 1S9YA 2YRLA 1JGDB 1SM3L 5DVNA 4UT7H 4OZ4A 3G08B 1IGYA 3RGVB 1BM3L 4KMTH 5TE7L 1QSEA 2E7BA 3MYJA 3BGMB 3E2HC 3PNWB 1NDMA 4H5SA 2X4OA 3T1FA 1S5HA 3KPSD 5HYSA 3I02A 3EOAA 1IL1A 4U2ZA 3G5YA 1AJ7H 4UIMA 4XH2A 2AK4E 3AC0A 2HWZL 1TJHL 2VLRD 1FL3B 2YEZB 3O6KH 4P2QB 3ZKXB 1S7RB 4GG6A 2W0LA 3LD8C 4M7LT 4Y5YB 3V6ZB 3OKDB 1QBBA 4JM2C 1A5FL 3S35L 3S97C 3TNMA 2AXGA 1U91A 3FQTA 1UCBH 5A16A 1A7QL 4IRJB 4PJEE 4PTTA 4WFGD 5KVDL 3C5ZA 4X6DF 5TPWL 3C6LA 1WSST 1WTGT 5JPMB 4GW1B 4PRID 5J89A 4PRPE 3KJ6H 1YNKL 3C8KA 1FQ9C 5C0FB 1QNZL 1I1FA 4I5BA 5DMIL 4OKVA 3V6FB 1KEML 1OP3H 1MPAH 4O9HH 3TPUB 5ESAA 1LEGB 4LMQE 4HS8L 5HHPB 4AEFA 1OF2A 2CUIA 3QUXC 3PV6A 3OR7A 3AS1A 3WNLA 1WBXB 3SOBL 2XV6B 3JV4A 4TVPL 4M5ZL 3N0PB 3UTTB 3KDMA 5E56A 2A6IB 2IH1A 5T3ZL 1AXSB 1TZHA 4H1LA 4XP6H 1F4HA 3B9AA 5ADOL 6CGTA 1AGEB 1KENL 2AEQH 3IFNL 2Y36L 1BOGA 1G7IA 1S9VB 3FO0L 1L0XA 4EN3D 3MO1B 3GMQB 3VXSA 1G7PA 3WKNA 4AT6A 1FP5A 2MSPA 4LNVA 4TOYL 4XNUL 5I1LB 2DOCA 2H9GB 5IM7A 4CL7A 2LU3A 4JR9L 1OY3B 2VOTA 2NW3A 4YK4B 3QUYC 4U1MB 2V5RA 1YEKH 5D2NB 2E9BA 3EOBB 1IVLA 2B20A 1QFUH 1YJDL 3HMXA 3KXFE 3OGCA 5IVXB 4WFGE 1EEUA 5FUZH 5I8OH 2G60H 2WBJB 5FOBA 1FL6A 1I1AD 4JCMA 2R15A 4MD4A 3RWJB 4XVSH 1FNLA 2G9HB 3WKMH 4PRPD 5GGVL 3QIUC 1TFHA 4JM2D 1WCBA 3GHEL 5HYJE 5KS9B 1F3DH 3UAJD 4S1QH 5IVXE 2CK2A 5EZIH 1KTRL 5EBWA 4M43L 3R0NA 4QTIH 1PSKH 5ABDE 4S1SH 4XWGH 3ALXA 2MQ0A 2YA0A 4KQ4H 4NYLB 5D96B 1BECA 4LCYA 4R8WL 4PJAE 1G6RL 1N59B 3C8KB 3SDCB 4HUUB 2HG5B 4BELD 4XMKL 1UKTA 2GY5A 5C6TH 2CK0L 3RP1A 4PLJD 4OTXH 3WFDH 1JMZA 1UCBL 3AY4A 5J3HD 2X4SB 1BF2A 2VLJA 3SQOH 2V9QA 1EFXB 5B38A 2O26U 3GMPA 1IC7L 1JGUH 4OGYL 4RA3A 3FCTB 5F1OB 4X6EA 3CCHB 3WCYA 2NY0B 1LP9F 3CLEH 1P4LA 4ONFH 4HIEA 1MWAB 2SEBB 5MEOB 1P9MC 2X4NB 4PJGF 4G9FD 3LKQB 2WINA 3VFOA 1YY9D 1CE1H 1HKFA 1R5IB 4KMTL 3MUY1 1QBML 3ZZ1A 4KAQL 4U31A 3L95B 3ULUD 1RZKC 4F7EA 4UT9L 1SM3H 2P5EA 3FN9A 3WO4B 3MRFA 2GSIB 2Y1VA 4MXQD 5IOPB 3ULUH 1NGWB 4I3RL 2IQAA 2X42A 1K2DA 5FA4B 1OPGH 2RR3A 4HUVB 5HYJD 2WIIA 4LSPH 2ESVA 1MHHB 2A74A 5D71L 4U1JB 1ZHLA 3I6LD 1J87A 3RY4A 5D7SL 1P4LB 5E8NA 1YEHH 1I1AC 3EYSL 2R1XA 4HS3A 2X1XR 4TVSa 2KQMA 4B53A 3BPNB 5TE6L 1BVLA 5HGDB 1S7QA 5FHAH 3PL6A 1F97A 3IXTB 5HHQB 4NDMA 2VAAB 2AJXL 3HN3A 4KRPC 2P4AB 1A7RH 2BY3A 5F96L 1ZA6A 5TE4H 4FNLL 1AXIB 4QRUA 4ZO8A 3ABZA 1OP3K 2LAGB 2B0SH 1V3MA 3QRFM 1IE5A 3LS4H 5IROA 1ZT1A 4BK4A 5IKCB 1GPOL 5I1DA 2VKXA 2J5LC 3DUUB 4AENA 2KL6A 4U6HA 3U0PA 1BQHB 4MA8L 1MSPA 1K8IB 4K94C 4M6OH 5K9KA 4G9FE 1NUDA 1S9XB 2EKJA 4YIQB 4N5UA 2R8SL 1MI5B 4OD3L 1J1PH 5TFSL 1NCUA 3ULUE 1NCAL 3P9MB 3D2UB 1C5BL 1AIFA 4HT1L 3TT3H 5T5NF 3KYOB 5D8JL 3ZT5A 3O11B 2ADIB 4L4VA 4DAGL 3HB3D 3TYGL 3I85A 3SDDC 2BDNH 5A2JH 4PJDB 1E28B 3NTCH 2NY6D 2O5XL 4U6XB 2HLAA 2Z31C 3LDBB 5TF1L 1QRND 4JB9H 4RX4A 3EZJB 1OW0A 1MUJB 1T5XA 5FYLH 1MCHA 4HWEL 1BQLL 1T1ZB 3EYUH 3CDCA 3QUZC 4LSTH 4AEIH 3CFCH 1NMAL 3PWPA 4XC3L 4U1HA 1S7SB 4OZGF 3SBWA 4RGND 4HXAH 1UB6A 3AB0C 4XNQB 5E6IC 2X40A 4J3SA 3MMEB 2G75A 5EA0L 4PGJA 4HUWA 2FZ3B 1T22A 3C60A 5MEPB 3SE9H 3UTTD 3RUGE 3CPLA 4APQD 2ICWA 2AV7A 3PDDA 5I16A 2Z92B 5TF1H 4X6DB 2W0FB 4ZPTB 1J9CT 2O5XH 4F57L 2VZ3A 1J0ZA 2VC2L 3OXRA 4G80A 3WNPA 5HHXL 5DI8B 5DZNA 3DV6B 2QADC 4Q9BA 3QUMH 1JNHA 1RURH 4F9PC 1OF2B 3FQUA 4ZSOA 5F6IB 5F1NB 1FBIL 3V0WL 2CMRL 4HX1B 3LKRA 1MCIA 2R0WH 5HI3D 4O2EA 3FO1B 1KEGL 3LQMA 2P49B 2VMFA 3BWAA 4KJWC 2A77L 4EI5C 4OZHE 1NBYA 3JWOC 1ZHKA 4XGZB 3EJJX 1QLEL 1YA5A 1X5ZA 2DJUA 3GSNB 3V5KA 3HRPA 1E6OL 3IDGA 1KPRB 5MHSE 3WNNA 1ZVHA 5IBLC 5J1AB 5I16B 4L5FL 1JNLL 1OTTC 4EUPA 4K3DH 2VE6B 5I1CL 1MWAH 2VDML 4YHYC 1QRNE 1A3RH 1J1OL 2IBZX 4U6VH 4Y2DD 1MAKA 3PGDA 2BVOB 3CSGA 1AGBB 5KANG 1YDPB 2FL5A 4K3HA 4PJ9C 2RBLA 5DYOA 1CXKA 3OWEA 3U6RA 1CIDA 4JM2F 3UTTE 3FQRA 1QR4A 3NZ8A 4R0LC 2DN7A 4EDXB 4Z9KB 1JF5A 1UM5H 1ZEAL 5KSBA 4OLVL 3DBXA 2HT2C 3ROOB 1HXYA 4PJFF 1VKXB 5HDBF 3VFMB 1DQJA 4YBQC 1CGSH 2APFA 3NMEA 3D9AL 3DGGB 4PGCB 4YBHA 4DN3L 4OZGA 4WU7A 3TO4A 5TGBB 5TDNA 1SEBA 2NY4B 3D9AH 4UT9H 3MLXH 1HQ4A 4R96B 2DKSA 4R90L 4LVNB 1XR8A 3RUGB 3I75B 5GZND 2HJFA 2Q3ZA 2QQLL 5SX5H 5D1XB 2R56H 4ELMA 2EIBA 3KS0H 1DEDA 1H3TA 4P2OB 4DKDC 3PABB 3GMMB 1N64H 3EO9L 3IVKB 2BNUA 2QSCH 1JMXA 3DLQR 4YDLC 1ZA3B 3U7YH 3JWOH 3RZCA 2ZCLH 5ACZA 5MHSD 4KGLA 3T2PA 5L88L 2YD3A 2X4UA 5D5ME 3SQOL 4OQ1A 5EIQA 3DURB 3MGOB 4GLRI 3MFGB 4MHHI 3MLRL 1KCSH 1CGVA 1KACB 3SDAC 2QQNH 4WO4D 1EO7A 3FT4B 4MNQE 3GMLA 1UT9A 2EEDA 5F3HA 5BZDA 2V7HB 1ACYH 4KQ4L 1HYSD 4XWGL 4MAYD 2NZ9C 1FGVH 3D85B 3MRPA 4HJ0C 3DGGA 3SDXA 3CFDB 3T77A 5MP6H 2MNUA 3ZYOA 1L7IH 2VZTA 1UKQA 4Q0XL 1JHKL 4KKLC 2A77H 3P77A 2JJVA 3A0OA 2Q6WA 5MEQA 1JHTB 4NT6A 4WO4B 1NGWA 3VFUA 1E4JA 3QDJD 2EECA 4JFDA 3TA3D 1BD2B 4ZUUB 2VL4A 4NO0B 4PRHB 2M8XA 3UBXB 1OVZA 4M3JA 4S0TD 5C0IB 1DVFB 4WCYH 3KPNB 4X5XA 1ZANL 3KPOA 3BHBA 2HT2D 1K4CB 2F5AH 4MXWH 3JWNC 4I77H 1K4DB 5EU5A 4ZUWB 2B8OT 4X6CE 4GG6F 2XPGB 3IAPA 1I8IB 3V4UH 1CU4L 4HWUA 4PJIB 1GC1L 1IGJB 4P46A 2ZCHH 5HYIA 4PJFA 3B5TA 2GAZA 1I7RB 1MRCL 1YYML 1SMAA 1LK2A 3NGBB 4HJGA 5E8DH 1FH5H 5AUMB 4CKVX 4XCFL 2BRQA 1T1YA 4PG9B 2ITCA 5GS0L 3LN5B 1BQUA 1KENH 4AEIL 4LSTL 3MUJA 4D9QE 3UTSA 1ZGLB 4MJIB 2NY7L 1I3UA 5I1JL 4HWEH 4M5ZH 4LKCB 5GISH 5HI4C 3W9DB 4YHKL 3K0WA 1JPSH 1LO3H 1WF5A 5F71A 3CVHL 2ZSVA 4PJBF 1DVFA 1WZMA 5D1ZD 4AH2A 1YNTA 1NGZA 1NDMB 2XQBL 1R3LB 3UZVB 3ESVF 4QOKD 3GMOB 4LRNH 4YUEL 1G7JA 3VFUB 2R69H 4YEEA 2ICEA 4RQQA 1BLNB 1FAKT 3QNXA 5DMIH 2E7LC 1S9WB 1Y0LA 3VCLB 3SPVA 2V9RA 4ZFOL 4H20L 2AEIT 5SWZD 4NNXB 3MRPB 4GMTH 2VR4A 2J12B 3QDJE 4GAYB 4HKJA 3TH3T 5B4MC 3WIHL 3ISWA 1M6OA 1E4WH 4L3EA 1ND0A 1TZGL 3WS3B 3S35X 1X4XA 2ED8A 4OAWB 1TPXB 4KDTC 1WT5C 1LO5A 2DLEA 2W1NA 1AQDB 1CTOA 1T1ZA 1A7RL 5KN5A 4OF0A 1I7TA 2MHAB 3EYOB 4PRIA 25C8H 2BHZA 3RX7A 3MV9A 4WV1C 5CILL 3T2NL 5C0CA 4KJQD 3MRNA 2DKMA 1MF2L 2BVOA 2HA1A 3TO4C 4GSDL 4NZRH 5CSBA 3WD5L 1NH6A 2X5PA 2VDLL 1T2JA 5D1QB 1CLYL 2PYED 4KROD 3T09A 3WFCL 5FB8B 1XCQB 2I5YL 1XH3B 2OTUA 2AV1A 5C1MB 3EGSB 2HH0H 1BQHA 3C2AL 4HUKB 2F19H 4XP1L 3WFCH 4I3RH 5DZLA 4QOKE 1BOYA 3ULUL 3AS2A 3MRQB 4NQSA 2VDLH 2FECL 3MR9B 2PO6D 4ZTPH 2R2EB 1VKXA 2IPTL 4K3EH 2LFGA 3BZFB 3ZL4H 3L5IA 4ZMAT 4G8GE 4DK6A 1BFOB 1SJEA 3W9EA 5E00A 1NBYB 2BHYA 3TN0A 4HGWA 5B39B 1KJ2L 2GHWB 4MCYB 2NY0D 4OQTA 5IW6B 4LIQH 3GUTB 1T1XA 3QXUA 3FQTB 5IEHA 3DX8B 4TQEL 1OAXH 4M61A 3KJ4C 1S9KC 1JGLH 4LAJH 1QG3A 1DZBA 3U0TB 4UDTB 5KAQG 1H5BA 4YH6A 5D5MA 1EXUB 1QQDA 4U7KA 3RWEA 3HS0A 1FORL 1A1MB 4ODVL 5JMRA 2GTZA 4KI5F 5ADPL 2GI7A 3BPLB 4FQIL 2I25N 4WHYG 1H15A 3QXVA 4GRLC 5DJXB 4QKXB 4BSJA 4PRPA 3DJ9A 1F4YH 2E3VA 4KJPC 4H5SB 1U8JA 3OR6A 2CKNA 3U30C 2OZ4L 4H20H 5C0JB 1EERB 3P4MB 4UDUB 5T3XE 2EYRB 1UB5A 5EWIL 4PPTA 4RMQA 5MERB 4OCSL 4HHAB 4Y1AB 5DJXA 5EZIL 1DDHA 4Y4HB 1GHFH 1I1AB 4ZQKB 2C1OB 5K33A 1CLZL 2PYEE 3O6FA 7FABL 2C1PB 1JNJA 5DJAB 1JN6A 1AFVH 1IMHC 3V5DB 3FCTA 1MCPL 1IGCH 5HBBA 4C56B 2EXWC 5I1JH 3BZ4B 3VRJB 3GIVB 1C5DA 3SE4A 3VMNA 5GS0H 1ZHNB 1UVQA 3QEUB 4L1HA 1IAMA 5I75B 3RVWC 2EDRA 2XG5A 3I6KA 1RHHA 2A0LD 3PQYE 1GC1H 3BH8A 2BOCB 3GMRB 1NFDB 3KLHD 2HG5A 2XZCL 2NY0C 4HKBB 1FPTL 2DJSA 4OI8A 3UYRH 3GM0A 4NSKB 3G9VA 4JRXD 5EIIB 3RQ3A 1HZHH 1A6ZB 2EKSA 2XZAL 2V6HA 2UYLB 3DRQB 3GZKA 2HN7A 3FRUB 3QO0A 4OZHA 1OWRM 1PQZA 4KRPD 3O3AA 3TBVB 4U3XA 3C5JB 4IIQB 5DJ6A 5GRZA 5IK3A 1NFDF 3O6LL 4R6UA 4YPGA 4M7KL 3MRJA 5E8PB 2NX5E 1YN6A 2UWEB 4PRIB 1FGVL 2JIXD 3GSXB 4D0BB 4RZCA 2YD1A 3PL6D 4KUZH 2K9UA 4FTVD 4JVUA 2OQJA 3V8OA 4QHUA 5IOPA 4OQTH 4ORGA 3B2UD 5JO5B 3CH8A 1U8JB 3OR6B 1NCTA 1IKFH 1FFNA 4X7TB 3S8WA 4WW1A 2BVTA 2IAND 2ZG3A 3C08H 2HFFA 3O6KL 4M4PA 3H2WA 4WEBH 1MCOH 4NIKB 4JFQB 4OT1H 2ADFH 1T7VA 2AGJH 2EXWD 1OAUH 3PQYD 3TVMB 3EO0B 2R1XB 5DFVD 1MCRA 3DMMA 2UYLA 1FYTD 4YFLF 5DLMH 1DJSA 3K8LA 4MDJA 5HGHA 2AJZA 3WV0A 4U1JA 2VDKL 4GBXD 5D93C 4CJ1A 3VXMB 1H8SA 4POUB 2JJWA 4BH7A 2GCYA 1J86A 4YDVB 3U82B 4LCWD 1D5XA 4WW2F 2H6PA 1HNGA 1DUZA 4QOKA 1PLGH 5L2KD 1DUYB 3AFLA 4Q9RL 1G6VK 1XIWB 4L8BA 1XCQA 3BDYL 5BV7H 2H3NB 1RK1B 2RGSA 2YWYA 3NCYP 5HGAB 4JDTH 4XXDB 5A16B 3RBGA 1NPUA 3QUXB 1AHWB 3QUMB 3VFTB 4IRZH 5C86A 4BZ2H 5EO9A 4HK0B 4NFBA 1BBJA 3ZDXF 4Z0XB 5ITFB 4M6ML 3VA2C 3NA9L 4MS8D 4ODVH 1FORH 1UJ3C 3UTOA 1YEJH 3STZA 3AY4C 2XWBB 2P46B 3LB6C 1CGXA 1J8HA 3F6LA 3LKNA 1DANU 1BD2A 4F7PB 3OPZL 3RNKB 2R23B 3S98A 3VMPA 1SBSL 4ELMF 4BZ1H 2A9NL 1Z9LA 4AEHL 2XN9D 1MCCA 1FIGL 3GBLA 4N8VA 4OF5A 2H1PH 3LIZL 4RZCB 2EO9A 2W65A 4Z5RB 1N59A 3CX2A 5J13C 1HSAB 3TPKA 3ET9F 3VXUE 3QAZB 3QH3B 4IHOB 1B2WH 5A40E 4QHMA 4WNQA 1UA6L 4IMLA 2CKBB 5EBWB 1JTTA 4O02H 4L4VD 2FHFA 1MREL 3EO1A 4G6KH 1I9JH 1YEIL 2HTKC 3OKLB 4U2YA 4PJHA 4UB0H 1MRDH 3OKLA 1YN7B 4LCWE 4NZRL 3QUML 3FOLA 1JWMB 4NKDA 4DGIH 1NMCB 3MLZL 4DGYL 3RY5A 5L2KE 3OZ9H 4NSKA 1WWWX 4U0RB 1OB1A 5D2NA 1UM4H 4DZ8B 1A3QA 4YBQD 1Q94A 2AERT 5KZCB 2BFVH 4XPBL 2JELH 5K9JL 1DCLA 5CD5D 1JPFA 1OAYH 2OTPA 3LKSA 1H9VA 4LLWB 1LE9A 1IARB 4PJ9A 1KIQA 1Q9KA 2ZCKL 1U8HA 1LK2B 3MV11 1C5DB 12E8H 4KTDH 5I2IA 1U8NB 5LWYL 3ARGB 5EORH 1JPTH 2PYFA 1RZFH 5FOBB 1WC7B 1X5LA 5JIHA 3L3OB 4MS8C 1EEQA 4LVHB 3FAWA 5AYUL 3QEHA 5INDA 4UIMB 2XN9E 4CMHB 5DJDA 4X6BA 1A4JA 2R1YB 4FFYH 5GJSH 1NAKL 4P3DB 3GSQB 3UTZA 2YK1L 1VACA 3L7EA 4OD3H 3EHBC 3VXUD 3MV8A 3TPUA 2Q6WB 5MEQB 3H0TB 4WY7H 2IMMA 5F8QC 3DO7A 1WITA 4MA8H 43C9B 1U6AH 1D5BB 4S1DD 4Y5XB 2BOBA 1P4IL 2QHRH 5GS1B 2B4CC 4E0RA 4GG8B 3UPAA 1X5AA 4M6NH 3RNQB 5JQ6H 5C70A 3QDHA 4A6YL 4NPYB 4FS0A 3PJSB 2V9TA 1OWWA 2GTZB 4WTZA 1BZ7B 3QHFL 1U36A 4Q7DA 1PZUB 2AJXH 2AW2A 1KB5L 2HRPL 4YHIA 2ICES 3W2DL 1VFBA 1XIWD 1UH3A 3HC3H 2WWKO 1FL3A 1IT9H 2NY2B 3MJ8A 4XWOC 2F5AL 1ZHBB 2JF1A 3WXWH 3MCG1 1RUAH 4N8CL 4PRHE 4X6BB 2GK2A 3NIDF 4HF5L 4CDHA 2CDEB 3PWLB 5BMFH 4S10A 1N6QH 3NIFF 5ERWA 2CIIA 5IB2A 1KCKA 1MNUL 2J7LA 3EDJA 1EDQA 5EBMB 4ZAKC 3B3IB 4WW2C 6FABH 1BHGA 3GBML 1T7XA 4HLJA 3OKDA 3ZHDA 5TGBA 1G1YA 1NAMB 2VZOA 4OFYD 3C5JA 5E4EB 3HE6B 4NM8L 1MQKL 5J13B 4ACPA 3TNNB 1OM3H 2ILLA 2ENYA 4JHWH 1WK0A 2QQNL 2YPLB 1CFQA 3N06B 4LSVH 1KPUB 4KV5E 3GEWB 4NNPH 3PDGA 4FTVB 5TH2B 5D7LD 1KCLA 1ZT4A 1FSKB 1DQQB 4OSUL 5LCVL 1F4AA 4HKBA 1J8HB 5IB5A 2NY6B 3QCTL 5JMOC 3JWOL 3U7YL 2CDGA 3D39D 5IMKA 1KPUA 3NPSB 5C0NC 4G6FB 3L3HB 3DHJA 2WIMA 3WFDL 3JTSA 4D3CL 4WI3A 5BVJA 1OTSC 1FVCA 3P4OA 4HS6A 5FIEA 4YNYB 4KU1A 5D72H 2W0KA 4S1SL 1NJ9A 5BRZD 1XGTB 4NO0D 4PRHD 4NQDA 4XNXH 1F90H 2B1HL 5SWZA 1JE6A 4S1QL 2FJFB 4HIJA 5TJWK 2OI9B 2GK0B 3WXWL 4N9GA 2HT3D 4JE4B 4YXKH 4TUOA 5I8OL 2CDEA 4UNUA 1TXKA 3EBAA 4I2XE 4KXZH 2DM7A 5HSFA 1C7TA 5IV2B 4X7SL 4WUKL 5F88B 3MLTA 4P46D 5DI8A 5IQ9B 3QHFH 5AZ2L 4LEXH 4MB3A 5EO9B 5EPMA 5BXFA 2RB8A 4M7LL 5E8NB 1ZLUH 5SX4I 3W2DH 5FUCE 5I74B 1T04A 2OL3A 3DIFA 2EIDA 2VSDA 2GAZB 1A1OB 4M6NL 3UXFA 3IGAA 1YECL 2VR9A 3L9RA 3WIHA 5BS0E 5JNYA 2E9WA 2AEQL 5KBNC 3QULA 5J4MA 5D2LE 1FRGH 1O5DT 3MV7A 1W0YT 1AGDA 2BY0A 3D39E 3K8MA 3VXMA 1S7SA 4OLUL 3N1QC 4A2LA 1P4IH 2QHRL 3NCJH 5GIRA 3KXFB 1RZIA 2QEJA 1NMBL 3OJ2C 2FB4L 3UTZB 3IJHA 4R3SA 3BZDA 4U1NB 3SBWC 4HIIB 5HJ3A 5BRZE 4P5KA 4HKXB 3S36X 5KJRL 5CJ5A 4NHUA 1FBIH 4GAFB 3PGDB 4X6DE 2WUBH 4K23H 1XF3A 3I6GB 4PJEF 3UTQA 4ZOEA 3KJ6L 1F3JB 4I0PD 5JHLH 3LRSB 4EN3C 2VE6A 5KSVA 2FX7L 3OF6A 1PY4A 1EFXD 3VWJC 1GGBL 1CBVL 1MAJA 5J8OA 3DO3A 4XTRC 4NKOA 4JLRB 4KI5C 5I18L 4C55A 4WDIA 3T0WA 1V3JA 1PY9A 2IBGA 4M5YL 2VAJA 2KZ1B 3OZ9L 5I1IH 4DN4L 3MCLH 1NGQH 1QYGH 4BSWB 1OAZH 4N0CD 4NQEA 1AP2B 4PJAF 2GK0A 3MLSL 3MSPA 1UXWA 1ROWA 2FECI 3H9SA 4GKNB 5ID0B 3MACL 1A6ZA 4NC0B 4JM4H 1FGNL 1UC6A 2YS4A 1QACA 4I0PB 3SQBA 1CVRA 4M48H 3VDCA 3P4NB 3EOTL 2XKNB 2DRUA 4KWUA 2CKBH 4O2CA 2PO6A 3E6HB 32C2B 4JAMB 1UJ3A 2F54D 4PP2A 5ID1B 1RUQL 5DRZA 4P2QE 1QBLL 5KSBB 1ZKAA 3EAKA 1D5MB 2YHGA 3M45A 4GKZB 4OGAD 5DUBB 4CVUA 4GKOA 1VGEL 3VW3H 2VXQH 3GSNL 4HBCL 5DMKB 5JORA 3L95A 2GSGA 5EULV 5D6CB 4PJXA 2AXFA 3LKPA 3BZ4A 2K7PA 1YEJL 4YO0B 5F1SA 1JF1A 4FQLH 4MQ7A 5I0ZA 1CFVH 1MHCB 4S11A 1BD2E 3PWJB 5GGUA 3VXNA 2IANB 1ZT7A 1A3LL 1KJ2B 4J4PA 4BZ2L 4ODXA 2X1PA 4L4JA 3BKYH 3UP1A 2IADA 3QUXA 5BV7B 5CWSA 3T65B 5DUMH 4X7EC 4YHML 2JJTA 1TZIB 1WICA 3SDXE 1KPRA 2IAMA 5E6YA 2GUOB 4IRZL 1F00I 2ZP0T 1J0HA 4F33A 1I3GL 1IZKA 2Z35A 1E4KC 5C0GA 3V8CA 5I1DB 1D5XB 4OB5H 2YD5A 3GJFH 4JFPB 5EU5B 2DTML 3D5OF 3PWLA 1PLGL 3MV7B 4Y2DC 3W5NA 1YQVL 5DVKA 1UEYA 4KHTL 43C9A 1B4JL 3BI9X 5F89B 3RAJH 1EGJL 3QQNA 4U1GB 4WWKA 4CN4A 1C8PA 1FZOA 1OAUL 4U49A 2V17H 1XF1A 1F4WH 2ESVE 5C07D 2CGRH 5H2BA 4RFNB 3IS0X 3BUYA 2D7OA 4PJIF 2H32A 4EUPH 4UINH 3MREB 4LPTA 3RWJA 3BP6A 4GUPB 3MLTB 2HYMA 1K8DB 1Q0YL 3LOWA 3G5YB 4MD5A 4G6AC 4YHZH 4ZNEE 2NCMA 2CLRA 4I8DA 1JI1A 3ILQD 4U1MA 4QRQB 4GRWB 1JGUL 4H88L 3BJLA 5EU6B 3C08L 2PR4H 2KBGA 3D39B 2MHAA 4MZ2A 5EU3B 4Y5XC 1SYVB 5F7DB 3WHXB 3QI9C 4AM0A 4MNGB 2DAVA 1FG2B 3E8UL 3RGVD 1VESA 3CSYB 4PY7A 3CH1B 4FABL 4OQTL 4UQ3A 4OTXL 4Y16D 3SJVE 2IH3A 1PW3A 2NQCA 2NY1C 4MNHB 2W38A 3MBEA 5F9OH 3QHTC 3DWTA 4L4TA 5CGYD 3VFWA 5DD3L 3MQIA 4X9HA 1RIUH 4GOSA 4G9FA 4MAYB 3T08A 3HC4H 4M43H 3D0LB 1K8DA 4PJHF 2BSTB 5F70A 1Q38A 2HN7B 4L3AA 5DA0B 3WDHA 4NKDB 4WIQA 1RIUL 1WBZB 4X4YB 1YZZA 5ITBL 3I75A 2DQJL 3IJYA 5H2BB 5FO7A 5FDWA 2XZCH 5A2FA 3V6OA 2A6KB 4NWUH 2KDGA 5K9QG 4M1DL 1HZHL 3AREA 3TC9A 1HYSC 2ESVD 3UYRL 3WLBB 3FHQA 2YC1A 3FAXA 3U48A 4NKOB 2NY3C 1CXEA 5DHXB 2ARWA 2A6KA 4APQC 4CUCA 5IFJA 4JPKH 5C6WH 1B6UA 1FDLH 4UIKL 5JW3H 4BUGA 2NW2A 5I1GH 4KQ3L 3LKNB 1F6FB 3UYPA 2WBWB 2ARJQ 3VWKD 4P9ML 3ZTJH 2E7LA 3GB7B 4XH2B 3VXNB 1T1WB 2ITDB 3V4VL 1BMGA 5DMYA 1JK8B 5F7NC 4D94A 3ULVF 2ESVB 1PG7L 1DVFC 3K2UL 5T3XH 4KK8C 3HZVB 4MA3A 3REWA 3P0YL 2CXGA 1IGTB 4FFVC 5EO1B 4WO4C 2XZQL 3H9ZA 1MJUH 4XBPB 1P53A 3ZHLA 4P5MB 4YFDB 3REVB 3ARFC 4RGNC 1SJHA 4BFBD 3IXAB 1I7ZB 2W92A 1AXSA 2J6EH 3KAAA 3WBDA 4N1HB 2A83B 1J1XL 4WI5A 1A1MA 3KPOB 3MUGA 4KK6D 5DXWA 2YUZA 4X4MA 1CQKA 4YHPA 3F7VA 4XXDA 3S7GA 3CU1A 4LDOB 1T03H 5ICZA 4DKFL 3PWPD 3UYOD 3MMEA 4W70A 4PG2C 3LVEA 5TQ0L 3PWUA 4YDLB 5C0FA 1D5ZA 1JYXA 1P7HL 2P8MA 4XVUD 1A14L 1INDH 3F7QA 4Y1AD 4HH8A 5KSBE 3UJJH 1TVBA 3RWHB 3MV8D 4F2MB 4O51B 2DM3A 3TZVD 1I3RB 4OCLC 2R0KH 3G5ZB 4K2UH 4NQUA 1A6AB 5TDOB 1U8HB 3CFIC 4YZFF 2I5YH 4KTYA 2ICWJ 3RWFB 4ZFFB 5B3JE 3HLAA 4KJYB 5I17A 1NFKA 4GMSL 5FYJE 3QPQC 4P5KB 3S37H 4TSAL 1NGQL 4NQVA 1T5WB 4X8JA 1MJJB 2J8OA 5IESH 1RIVH 4NZUL 3PQYA 4ALAL 3MRBB 4MSWB 5F7KC 1NUNB 4JDVA 1CYGA 3FOLB 2L7UA 4G9DA 4YBLC 4L3EB 4XP5H 4DKEH 3STLB 1GGBH 1XR8B 1CBVH 4XPAL 4Q2ZA 5LJYH 1OSZB 5DTFB 3VDBA 4M8QA 4D8PB 3HAEH 1YJDC 5ENWB 4BFEA 4HCRH 2RFXA 2IMNA 3IXTA 5HHQA 2XZQH 4F7MB 1I7UB 1IAII 5ALCH 3GK8H 5DT1L 1XZ0A 1C7SA 1Q8MA 3AS0A 3MLUH 3CC5A 4MLSA 2HFGL 3M17B 4QHLB 5MEND 3ECBB 4ZPVB 1OQOA 4ONOA 4TSBL 4Y1AE 4D9LL 3GMOA 1LO3L 4PBWD 1LWRA 5EC2A 3MV8E 1C5CL 3V4VH 1I3VA 3CK0H 4JO1L 3RWDB 3VI3E 4XVTH 4LKCA 4H26B 3MUZ1 4A2MA 2H2PD 5A1AA 4XCCL 4JY6A 4GAJL 5T1LA 2R2BA 5I75C 1F11A 2EE6A 5C07A 2OL3L 2QV2A 3TBTB 3UTPD 3X12A 1IC4L 2JB5H 4K94L 4NO3A 4X6CA 2AXGB 4P5TA 2FEEL 2AK4D 1QSFA 1CVSC 5AZ2H 3HC0B 1RVFL 2G75B 4O2FB 3UTQB 3A67H 4HIEB 4ZO9A 1FE8L 5FYKH 3RNQA 4WCYL 4R4BB 2QHLA 5DJ8B 3BIKA 1EXUA 1C08A 3SGEI 1EH9A 4LPVA 2D7TH 2AEPL 2K1MA 3KHQA 2X4OB 1ZANH 3QIUD 2DQJH 1W0WB 4ZSOB 5BVPL 3P30H 1XGYL 4NQCA 1NDGB 1GOHA 3JUYA 4LGPB 3BZFA 3TBYB 5HI5D 4HGKC 1YYLH 4Z7VF 5CZVH 2UZIH 1JHKH 3BPLC 5F3HB 4PLJC 1GJIA 5TF0A 1QFWI 3GJEA 4XNZB 3FB5A 2DIBA 2FJGB 1S9XA 4YIQA 4ZS6C 4FA8A 3DMMC 5TQ2L 5JXED 1KIQB 2IQ9H 3Q3GB 5FKAA 3L7FB 2Z4QB 4OZHF 2GIYA 3IFLL 5HDQH 1DLFH 1FNSL 3T4AA 5ESVB 4Y16C 1CR9L 2CLZB 2ZUWA 3KPLA 5CMAB 2VDNH 3VFRA 3B2VL 1OCWH 3UTPE 4MJ6B 3VU2A 3RTQD 4MJ6A 3EW3B 3PWNA 3EO9H 4KJQC 4JQXC 4N9GB 5J9PA 3EFFB 1Q0YH 3WE6B 4I3SH 4HC1A 1IQWL 1X6NA 1UG9A 5EZOH 1G7LA 1YN7A 4R90H 4OLXH 4R7DB 2VIRA 3TA3B 5DFWH 4I0KA 3VXUA 2LTQB 4Z78B 4KY1H 2R56L 4MXVF 3FB5B 3QQ3B 1B4JH 3RAJL 1E6JL 1CGSL 2YD6A 1YQVH 3VJ6A 1BZ9A 1O7VA 4HMCA 5E08H 3LMJH 4JG0H 4YLQT 3S96B 3TO4B 3VGHA 4OFDA 3U9UB 2AKRA 2BY2A 3CDYA 1YNLH 4LBEB 4FQXC 3THML 1FFRA 2DQTL 3WSQH 1WBXA 3F65A 5AD0B 4U1SB 5CD3B 3QNXB 5D7KD 3VRIA 1QLFB 4P3CH 1PG7X 1OD7A 5HHPA 5MENB 3RNKA 3WO4C 2ADJA 3BKCL 1FVEA 3O9WD 3CAFA 3O3DB 4I0CC 1YEGL 2E6QA 3IS1X 1MWAL 2VDMH 5I1CH 1CR9H 4FQLL 5EZLA 4YR6A 3V52H 2IEPA 4TRPH 3DUSB 5DS8B 3WIFB 5F3BA 1T83A 1OD9A 3SJVA 4JHZA 3MRHA 4P23C 4HUVA 4IOFC 4NO3B 4X6CB 5IG7B 2A73B 2HJKA 3VGEA 3MLWH 5CS7A 3WMSA 4MXQC 4FFVD 3B3IA 4RGOH 4DUVA 3KNBA 1AQKL 1AKJA 4TVPE 2NY4D 5EUOE 4ISVB 5DJ2B 2I60H 1A7PH 2BCKA 3PHOA 1N7ML 3RA7H 2CMRH 4M48L 5ISZA 4ZD3H 3GSVB 4MDJB 4N8PA 1JNHB 3V6OE 1M4KA 2XN9B 2DLTA 3MLSH 1IBGL 4UOW0 5A2LH 1WCBB 3WXVH 3QIUB 3SE3A 1RURL 1F8TH 5BRZB 2PTUA 3QUKB 2BJML 3M1BA 4Y5VA 5B3NA 2FX9H 1EAPB 4LSQH 4XC3H 3FONA 2I9TA 4ZUSB 3O0RH 2Q87A 3JTSB 2EDLA 4XNQA 5EA0H 4ORGB 1HHKA 4OBSA 2XTJE 4XXCC 1FZKB 2NY2D 1GOFA 5CZXC 2ZUXA 4EEEA 2ADGB 2CR6A 4GKSA 5F7DA 3MLZH 2E7CA 2L7JA 4Y16A 2WUBL 4OM1L 3CLFL 2BY1A 2F54B 4JB9L 4Z76B 1KTDB 1J7VR 4HT1H 1WTLA 2EE2A 2FO1A 3TNNA 1U58A 3P2TA 1MLCA 5IVXA 4KJWD 3HG1D 5D4QA 3O11A 2PYFB 3MZGB 5J56B 4DAGH 5KS9E 3L3OA 4EXPX 5J1SC 2F54A 5E5UB 4Z76A 4I18A 4H8WH 1Q9KB 3MOBH 1RK1A 3PHQA 5TFSH 1FZOB 4LEOB 4DK3A 5F7HA 1FHGA 5EOQL 4QY8B 5C0DA 2Q7YB 1A4KA 3KG5A 5TE4L 5FA3B 1YECH 2O93L 5D2LF 3JZ7A 4RGNB 2F53D 4X4ME 2B0SL 2UZYB 2QLVB 2K7QA 4ONHA 4QRPB 5TE6H 4NZUH 1RZGB 4XB7A 5KSAA 2BXZA 2IAMB 4LEXL 4P2OC 2CD0A 2X4QA 2Q8AL 5GS2H 1SHMA 4RGNE 1YEHL 3PL6B 1UZ8A 4NZDA 5I8KL 1LGVA 1Y6KR 2P5WB 4Z95H 4Y5YC 3LD8B 3BUYB 4MB4A 4OIIL 2X9XA 4PD4K 4WI4A 5ILTL 2XTJD 3VWKA 3D0LA 1HHJB 4GQPH 3W39A 4EJ1C 4LHUB 1JTPA 4Z7VE 5GPRA 1KULA 1HSAA 1DBAL 3QXAA 1FLTX 1UACH 3SY0B 5IJVB 4NQDE 3H3PL 1ADQH 3O6ML 5GHWH 1IGMH 5I1KL 3QDMB 4QF1B 2MCPL 4Z6AT 4LHQB 1K2DB 2B5IC 3VFMA 3QQ9D 1A6TB 2Y5TB 4JZJB 2DQTH 3KVQA 3WSQL 4F7TB 1F90L 1BFSA 5KTEH 4OCNC 2GKIA 4PJ8C 4UOJA 3MRFB 4LOUD 1YEDA 3RGVC 3L3IA 1ZGLA 1QBMH 1A14H 2CJUL 1RIHL 4B7LA 3BKML 3QDJB 3O8XD 1E6JH 2CDFB 1MHEB 2M26A 3REWB 2WK2A 2FL5B 4X99A 2XWBA 3P4NA 2NPLX 1CXIA 1FFPA 5IHUH 4HDIB 3BE1H 1I8IA 1FFPB 3O3AB 3VE0B 2D0FA 3MRMA 4ZNEA 2XTJB 5LCVH 4APQA 2BK8A 5DC0A 3CLEL 4WUUA 3ZYIA 4UNVA 5I1EL 1J1XH 3EHBD 1LP9B 1Q9OB 2NR6D 4RAUA 5DMKA 1NGYA 5JORB 1KFAL 3Q5YA 5CJXC 2OR9L 1TJIH 4JRYD 5IB4B 1ED3B 1RZ7L 1ACZA 1G6RH 5BQ7A 1MQKH 4MAYC 3DXAA 4NM8H 1ZVYA 5TQ2H 4EI5B 3ZE0E 4QF1A 1FNFA 2PO6B 3E6HA 3R0MA 3RWGB 3M07A 5C08A 1RY7B 5E2VL 1AR2A 2MKLC 1T66C 3D87B 3WIIH 3WKML 5JXEC 5DC9B 1G9NC 2PYEA 2WAHA 4PJDA 1F3RB 1RULL 4BYHA 3L5XL 3H9HB 2BSTA 2WSKA 3F62A 3S3JA 4JFDE 4JDZA 3NCBB 1RUAL 1SBBA 4WNQB 4ESKA 2FJHB 1FL5B 2XIDA 3R06B 5CEYB 2EDXA 4HHAA 4Z5RA 2PCPB 1T0NA 3KPPB 5GRVL 4NC2B 5DEFB 4LOUC 3QEGL 2VWEE 3GMQA 5J6HB 1N2RA 4DWHA 3QEGH 1M6OB 1LMKA 4Q9CA 4LNRA 2JB5L 4K94H 3ZKSD 4A6YH 1PZ5A 5DK0A 1R5VB 3X11B 5JQ6L 1FN4B 3HMXH 3C60C 2VXSH 5FUOL 4MD5B 2RCSL 1A1NA 3OBAA 5EU7E 3P40A 3GSUA 2H8PA 4JDZB 4JRYE 3OL2A 4MNQD 4UTAL 4GAGH 4L1DA 3JTTA 3INUL 4HS8H 5GGSA 4KKCC 3UJIH 5GRJL 1GHFL 2PYEB 4KROB 3A6CL 2XN9A 1OARL 1QUNA 1EK3A 4NQEB 1NFIA 1GZPA 5L2KB 4OF6A 1I1YA 2HFGH 3F7PC 3OKMA 4PJ5A 4DOHB 4XT1C 3GK8L 4Z7QF 5DT1H 4LCWB 2H6PB 1MPAL 4Z18A 3EYQD 2F15A 4GW5B 4HXBL 1A7QH 4GRLD 4D9RD 2YSSB 3UTSB 1D6VH 1OP5K 1S5IH 5DUPH 4KRPB 1A6UH 1B0WA 1H3GA 1WISA 2P5EB 4Q97A 3SKUD 1QSVA 5FECB 4XPAH 2OK0H 2FO4A 3KS0J 2HWZH 3J8F7 3ARDA 1U9KA 2W07A 2EC9U 5DVMA 1WGOA 3OB0K 2A83A 1PG7W 1AXTH 3VE0A 2HKHL 3H3BC 3EOAB 1KJ2H 1K85A 4S2SB 5F97E 3UDWA 2VLME 2NTFB 1U0QA 2C3HA 1LD9B 2ADJB 2X1OA 5E7FA 1MCJA 3TJHC 5DQJB 4JHAL 5IBLD 2VABB 1RIHH 1UA6H 2CJUH 1FYHB 4ZFOB 3HMWH 4K2UL 2DTMH 3JV6B 1I8KB 1JNNH 2N7BA 4D0DB 3HNSH 1I3GH 1GZQB 1CFBA 2HVJA 1GH7A 2H1PL 3WL9B 1T04B 1FVDB 5FUCC 2DQUH 1TVDA 1KLGA 3RRQA 1HKLL 5H94A 1P5VA 2ERJC 2H45A 4ELME 5LGJA 35C8H 1VCAA 4Y4HD 4Z78A 5FO9B 5CILH 2MCG1 3MBXL 2D7QA 3PDOB 1IQDB 1S7TB 2PW1B 4NFCA 4G5ZH 5JXEA 2ICEB 3NCMA 1V7NH 5IEHB 4MD4B 4WU5A 4D9RE 5CINH 1ORQB 2KQNA 4Z95L 5JW4Q 1U93B 4YAQA 3S6CA 2MMXA 1S8DB 3CFKB 4AH2B 1A21A 3RY6A 5C0EB 2CPCA 5IEKB 4U1SA 5CD3A 1ES0B 4MJIA 1E27B 2W60A 1DVFD 5D1ZA 1F58H 3QR2A 4PGZA 3DROA 4NQSB 3ZDYE 3U7WH 3O4OC 1YUHA 3P11L 4JLRA 1R3HB 5BV7L 3BDYH 2ITCB 3SE3C 4CADA 3MRDB 3O3EA 5JUEH 4F8QA 4YFLI 1PKQB 3FT2B 3QZWA 2H26B 1MJUL 5GGTH 1B90A 5IMMB 2DQCL 3IFOA 1HI6B 4XNYL 1Y18A 2FHBA 3P0YH 4JM4L 4QRRE 3HB3C 2C3XA 1FJ1A 1EO8H 2YPKA 4JJ5A 5HHVH 2AI0H 5GS0D 3WHE1 4HH9A 3O3UN 3ZTNL 2EXYC 1KCRH 5I1IL 1H3PH 1ND0B 4JRWA 1MFDH 1ONQB 3MNVB 4LASL 1DBMH 1U2CA 4XMLL 1XF5A 3WFHA 5B8CA 3KPTA 5CLWA 2C26A 5I18H 2EDBA 1G7IB 3LPFA 3IDYC 5F6HI 3RY6C 1OGAA 1MHPH 3PJSA 1FVDA 4JPKL 1AC0A 4UILL 1EAPA 1OTSD 2A74B 3V4UL 5DO2C 1OGTA 2OI9C 5D7IA 5JQHC 4PJIE 1I8KA 2J88L 5BXFB 5FYKE 5FGBA 4KUZL 3KYNB 5CJOL 3GSNA 5HXMA 2APVA 3IRPX 4JKMA 2H32B 4OIAA 4RMSA 1H5BB 5I71C 4FQQA 1FFQA 4JRYA 3L5WA 1P4BL 3TM6A 4MWFA 3VFGH 1U3YA 4NC1E 2HT3C 3RTQC 3BDXA 4NQCD 2FD6H 2W0PA 4PJGB 4NUJA 4CU8A 5HHNA 1TNNA 4GBXB 4MQXC 5E94B 1EAJA 1MCBA 3L5WB 1N5AA 2Z91A 1U8OA 3HC4L 3TYFB 2LABA 3NCJL 2XZAH 5C09A 4ZDHA 5DD3H 1FSKC 4ODSH 3MXWL 4G43B 1MY7A 5ICYA 1XH3A 2OTUB 5IB1A 1FRGL 2Q3AA 4PGBA 1I8LA 1NBQA 2R0LL 4HS6B 3C5SA 1MAML 4LLVA 4DVRH 1CD1B 5KW9L 4N0YL 1I7RA 3CNKA 5I9QC 4PRDA 5E9DA 3BISA 1BFVL 3S88H 2J8UE 1MEXL 5F7YC 3O2DA 4JJHA 5DRXB 2FR4B 3S5LG 3OKOA 2YD4A 3DGCR 1V7ML 4JN2B 1IJ9A 1KTKE 4U0QB 4Z7NE 3VA6A 4ZUUA 2HVKA 4P2RA 3UBXA 4YAQB 1QLFA 3C87A 2HLAB 5JZ7C 1IGCL 3M17A 5MENA 4I1NB 3RPIB 1N6VA 2GITB 2X70A 3V0AC 5FYKD 1ZMYA 1FL6B 2CGRL 2CQVA 4JRXE 32C2A 1HILB 2E7HA 4Z0BH 3D3VA 4Z8FH 4ZOBA 1HSBB 3EOBA 3THMH 3ALWA 4HK0A 2DLFL 1VFAA 5FFLA 3ARPA 3U1SL