5HYJD

1e6 tcr in complex with hla-a02 carrying aqwgpdpaaa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
193
structure length
193
Chain Sequence
KEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A "hotspot" for autoimmune T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 33
structure length 193
sequence length 193
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjD02
4HGMA 3TCLB 4D8PA 3B5HA 5SWQA 1GGIH 2F8VA 3TNNA 4FFZL 2P48B 3MOBH 1QHOA 2KL6A 2R4SL 3E6HA 1QEWA 3ULUC 1W8OA 1G7HA 4XPHL 2VZTA 2R15A 1L9NA 5CEXA 1G9NC 2NY1C 4U1JB 4M1CD 4KKCC 4OD1H 4MD0B 1T6VN 1UZ6F 2UWEE 3DX8B 3HE7A 35C8L 5GS1C 4BZ1H 1O7SA 3ET9F 3L5HA 3H9YA 2DS4A 1OARH 1AGEB 4JR9L 2QKIA 4ZSOB 3GBMH 2GJ6E 3HZMA 3ZYIA 3RA7L 4GG6E 3E6FA 1JGUL 1CD0A 2PCPA 1GZQA 5GGRB 3L9RB 4N5EC 1I85C 3K8LA 4O2FA 3PL6C 5AAWA 4PG2A 2D0HA 1P2CB 1K6QH 1XF3A 1QR1B 5E2TL 1HQRB 4UU9B 5T1KA 3W9DA 2XZZA 4QHUA 5KVFH 2OS7A 4QHKJ 5CEXB 3PF2A 5GS2H 4OD3L 4MLSA 5AZ2L 2I9TA 2E7MA 4DK3A 3T8XB 5E8NB 1NJ9A 1JGLH 4AEIL 5C0CB 3VGBA 3DNKA 4ELMA 3RIAF 1SEBB 2X42A 1V3LA 3QUXC 2CLZA 3VWKC 1KBGH 1GH7A 3VGDA 1IAKB 4ZSOE 3IU3B 3MNZA 5SX4H 4S2SA 5DD1H 5BQ7A 4I9WE 5I8KH 5SX5K 3BKML 3MA7A 1E4XL 2GTZA 4ZXBC 1U8QB 4NUJA 4EIGB 5KANG 5K93A 1ITBB 3IYLW 4MNQA 5I73C 5AEAA 2YMXH 4XVSL 4LVNC 2EKJA 3S37L 4YK4C 3PV7A 3EZ8A 2HJKB 4Y5VB 2E8ZA 4RZCA 1ODAA 5C0RH 1MCLA 3FB8B 2YEZB 4NOBA 4Q9RL 2DQEL 2EDHA 1IM3B 4MX7A 2DL9A 3VD7A 5L8LB 2VB5A 4M9OA 1NBVH 3O3AA 4UT6L 1OPGH 1AIFA 3KR3H 3KXFD 1T89C 3MGOB 3U9PL 3JV0A 3TA3D 4IJ3C 1HINL 1JN6A 1V3MA 2XXCB 3O45A 4I8DA 1FFPA 2FIKB 4JKPH 4YDLC 5EB9A 5FDYA 1XH3B 3WDIA 4OCYH 5LQBH 4FMFA 1JI1A 2Q76B 3G5ZA 4DGIL 1KCSL 2AP2A 3G04A 4JFQA 3JWDL 4XAWH 5BV7C 3B2UC 3K4AA 5F88B 4NQDB 1JWUB 3RTQB 1QNZL 3O3EA 3MLUH 1I1YB 4YC2B 5L9DH 5JW5B 4YDJB 2I9LB 3H9SD 1I1FA 3DTXB 4F9LC 5TDOB 3ILPB 3K2MC 2V2TB 2W38A 4P2OB 3CXHJ 4XPFH 4AH2B 1CICC 4LRIC 3WE6B 2AV1A 4YDVA 4HH8A 2X89A 2EDDA 1JYVA 2FBJH 4HPYL 3S96A 2R1WA 5D1QC 4KQ4L 5MHSD 1FLTX 1S3KH 5C7XH 5IB5B 2HKFL 3GK8H 2GKIA 4HWNA 4M5YL 3SDAD 5LVEA 2XG4A 3ARYA 1KXQE 2Y6SC 4DEPB 2RR3A 1BVKA 1NFDF 4S1SH 5C0ND 1ERNA 2DDQH 4HLZG 4NQCA 4L9LC 2AJYH 4KDTC 5AG9A 4F3FA 5J89A 5D1ZC 5DUML 2YPLD 3A6OA 3QIUA 4IJ3B 3BQUA 1CWVA 4W6YB 3MLYH 2Q87A 1YMMA 2J7LA 4UBDC 1A47A 1NANI 4W6XB 5LGJB 1JUFB 5HYSA 4Z7OF 3UC0L 1CFSA 4QRPA 2A73A 1J1PH 3QCUL 4FHBD 5GGRY 1ONQA 1EERB 1QQDA 3H7BB 2ICEB 1DN2A 2CUIA 1SJEA 1RIUL 4I77H 4X7SH 1FNAA 4KQ3H 5D7IB 1S7SA 3QT2A 4K3HA 5DYOA 1CT8A 3WFHA 4HIEB 1JJUA 4PRPA 1FVCB 1UB5A 4FQXC 4HJ0D 1B4JL 1OW0C 1I1AA 4J7RA 4DTGH 2AV7B 4QGYA 3GBNL 3KPMB 1QZ1A 3O6FC 5SWZD 1UGNA 1HQRA 2CIKB 4RAHA 3W9DB 3QIWB 4C4KO 5GGVH 4K3EL 5JUEL 3ZDZF 5I73B 5T3ZE 3ROOB 3TO4B 5KN5B 2OL3H 2ENYA 1FSKC 4HK0B 4HC1A 1RJZB 1DLFH 2XQYK 2P7TA 4NKMB 4FN0A 1UJ3B 3OAUL 4I3SL 2ESVE 4R97B 5T3ZH 4X8XA 1FZJA 4MCYB 3D25A 1BJ1J 3L3IB 4FQPA 3BMVA 2B5IC 4PJEE 4NRXB 2G75B 1ZLSH 2C7UB 3HCVB 3F7RA 3IDGA 4K7FA 5CJOH 3BZFB 4ONFL 3EDEA 4A6YB 1N5YL 5KVGH 5I16B 4WHCA 5GS0C 3QXWA 5J11B 4WFHD 3RWFA 1MFBL 2XQBH 3RWDB 4OLEA 5JNYB 4LHUG 2Y5TA 1BLNB 4LF3B 4Y4HB 3ZHLA 1DVFA 4LKCA 1EUUA 2F5AH 4YR6A 4IEFB 3BE1H 5CLTA 3RVXC 2FIRT 4WUUB 3C2AH 3QA3A 3ARWA 5EORH 1DJSA 1PGRB 2JB5L 5ANMA 4NC1C 4Z76B 4OFPA 5ICZA 3T77B 4NHUA 5DRNB 4X8JA 3OSKA 2XA8L 4OJFL 5CP3A 4WY7H 4P2OC 1BGXH 2APFA 3LH2L 4LARL 1ORQB 1EMTH 1FG9C 4ZFFB 3KPSE 3BPNB 3QG6A 5F7WC 5EOCJ 4C83A 4M48L 1I3GH 4IOIB 4PRBA 4KZDH 3LOWA 3JV6A 2BXZA 2YKLH 5JR1L 3ULVD 4XNXH 3UTSD 2EDQA 3CVIL 1P7KA 4G8IA 5TJWK 3QBTB 3MA9L 4MMXC 1WISA 3EFFA 2N7BA 3ZKXB 3FRPA 4X98A 1F4AA 4HBCL 1Y6MR 3EHBD 1DUYA 5C07B 4R9HA 1F11A 1N59A 1T0NB 4IRSD 4QHUB 5E2WH 4KGJA 3Q6GH 2D9CA 1ZV5A 3QDGB 4V2BA 1A7NL 4Z7UF 3VXSA 5E2WL 1MIEL 3GSXA 1KF9B 4EDWH 5J56B 4I2XE 2QSTA 4XC1H 4G6FD 5TF1H 3ZT7A 3SE8L 5GGVY 3CCHA 3VFWA 1KLUA 4AQOA 4O51B 4P2YA 1ZXQA 4NQCB 1ZT1B 3SE4A 4QCIA 5LCVH 4L4TD 2VXVL 4NZUL 3S4SA 1CGWA 4ODXA 4PPTA 4L3EE 4Z5RB 4N1EA 5K59F 2NY3D 4WRLA 3RPKA 4UQ2B 5C08B 5IMLA 4MXVE 3KPMA 4HFUH 5C0BA 1DEEA 3HRZB 3LN9A 4TRPL 3HZKB 4WI2A 1WITA 1BD2D 4Y1AD 1QRNB 5A2LH 4KK9D 1QSVA 2BMKB 1PSKL 4OV6F 5E1HB 4UTAL 2VDOH 5E5RB 3LHPH 2PYED 1KJVA 4GXUM 1N0LA 1I9JH 4NGHH 2R0WH 3SGDI 1SEBA 2NPLX 5L0QB 1WBXA 5EBWA 1U8HA 2D31B 3GJFA 5I1JL 5KSAA 3MUJA 2NY5C 3P2TA 1T1ZA 3FFDB 2ZJSH 3OPZL 3LKPB 2NY5H 5CKAA 3MJGX 2WZPD 4CJ1A 1KTKE 4JFHE 1I9IL 2ICWB 1IAMA 5DWUH 1C7TA 3BO8A 1S9WA 4JKLA 3CK0H 1NC2B 1RZGA 2JJSC 2A0LD 1CF8L 2OR9H 2PXYC 2GIYA 4HPOH 4R4FL 1FL3A 1A14L 4YHOL 1KYOK 4NWUL 4CN6A 1FZKB 4X7DC 1VKXA 1ZEAL 2CQVA 2EXWD 5DJYA 1WWBX 4WU7B 5CWSB 2R2BA 2VYRE 3P9WB 5EO9A 5AYUH 5B4MD 1KLGB 4XP6L 4LVOB 4PBVC 3WIHA 4PGDB 5TDPA 1TENA 4MXVF 5D5MB 2PR4L 3BN9C 5SWZA 4UOW0 6CGTA 3ARED 4G6AD 3WXWH 3MLTA 2AGJL 4EUPB 1NBQA 4J4PC 4KTDH 2QQLL 4QXTB 3MO1B 1N8ZA 3V0AC 4LCIL 1IT9L 1YMME 1XR8B 3FB5A 3KPNB 2P42B 4ZG1A 3LB6D 4GXUN 1LDPH 1L6XA 3IU3A 4NQDA 4K71B 3QA3B 2DI7A 3P0YL 3FQRA 4G8GD 1GCFA 1LDPL 1BFVH 1MCSA 3TCXA 1OGAE 4HWEH 3O2DH 2Q3ZA 4HXBL 5I15H 3RFZC 4TNWF 3HAEH 4FTVA 1PKQB 3TZVA 1J8HD 1JE6A 2BNRA 4EDWL 2VXUH 1C5CH 4NO2A 5JW4N 5ESQA 3IKCA 1IZJA 4C55A 1P4LB 3FB6B 4RAUA 2IH3B 2ITDA 1EIBA 3UYRL 5IHUH 4HKXA 5JXEC 1PDKA 2A77L 1UJTA 2EO9A 3F62A 2OP4H 3AM8C 4KTEL 3VFOB 4LLVA 5DR5L 5DJDB 1H3UA 1AGDA 2C26A 5IB2A 3FL7A 5J7CC 5H37G 4X5WA 1KCUH 1NCCH 1S7TB 4XVUD 5ECJE 2A74B 1PG7W 4LP5A 5GJTL 1AO7D 1MFAL 4LKXB 2HTLD 4LGSB 4TRPH 1T0MA 5FGBC 3VCLA 4YHYB 3BGFC 1DEDA 5CINH 3MRJB 5IGXL 3BP7A 4P2QE 4PJGB 5ITBL 5F1NB 4X9HA 5KSUA 4KKAD 4AL8L 1G7LB 1HILA 1UB5B 4N68A 3X12B 4FQ1L 1L0XA 5C0RL 4NZTL 5I1EL 4ZUUA 3TBSA 4JRYD 1QSFB 3TYGL 3ARFD 1FFOA 2FEEL 3T08A 3LPGA 3C5SA 3QI9C 5ADOH 3WV0A 4JPKH 2PTUA 2DM7A 5C0BB 5GISL 4K3DH 3KPTA 5TE4H 2DL2A 5TDOA 4E41D 4XCEB 3DVNA 1ZLUK 3SGDH 1LEKB 3T09A 4PY7A 3GSVA 5L2KE 2VR4A 3D39D 2X4OA 3RNQB 3JXAA 3OKEB 4ODHH 4U49A 2DKSA 3B9KC 3NAAH 4WGWB 4TVPD 3MLUL 1F4WL 1LEGB 5H35A 1XIWB 1N0XL 1XFPA 5DO2D 3ZL4H 3QWRD 3IF1B 4YEFA 1QP1A 4M8QB 1U8NB 1YC8A 3PQYE 1VFBA 2R0ZL 5GJSL 1SYVB 1T1WA 4Q2ZB 4NCDA 4Y8DC 4DFIA 4PJXA 5D2NC 2DRUA 4JN2B 3NFNA 5EU7C 5IFAH 3Q1SL 1FPTH 4XBGA 4D8PB 3AS0A 3T2NL 1P7KB 4Z7UB 3IFLL 2JTDA 2R0LL 5E8OB 2JELL 4BFIA 3FQNB 5HYEA 3VXRB 3ARFA 4OCWH 4KMQA 2OSLB 4F7TA 1QNZH 5INCB 3BHBA 1A1MA 5F9WB 5EZIL 1D5MA 3P4MA 3UZVB 4GRLD 1HWGB 4OCWL 1HZHL 1INEL 1JBJA 4NQVB 3DI3B 4OQ1A 4U1SB 3GRWA 1Y6KR 5IK3B 1WUNT 1IQDA 4NQXB 2NW3B 2DI9A 4OUUB 3UYRH 5D5ME 4AEHH 3DBXA 1T20A 1RZKL 4IS6B 4JFDA 1C5BH 4Y4FA 4GH7B 4KK8D 1XR8A 3X3GH 1A6ZB 3QXAA 4NZUH 3ZE1E 4NN6B 1FBIL 1NPUA 2CJUL 4X99B 3UTOA 4MJ6A 3P0VH 3LRSA 3MROA 4DW2H 4EVNA 4FFVC 3LPWA 3CU1A 2NXYB 1JPFA 4NSKB 1XCTB 4WUKL 5JDJA 1HHHB 1YEKH 1NDMB 4EEEA 4BKLA 5E2UH 4QRTA 3P73B 2W07A 4R6UA 2HG5A 3TO2B 2A1WL 4TOYH 5DD6B 4WCYH 1MFCL 3S6CA 3LN5A 5CEYB 5I1CL 5E24E 5GGSA 2GK0B 5MERA 4G8GA 5DC9B 1FZMB 5EOQL 4PLNC 4ZOCA 5IM7A 2C4FT 1CLYH 3DURA 3Q6FB 3G08B 4I18C 3OF6D 4R2GC 3MRNB 1ROWA 1Q9LB 4G6KH 4KI5E 2YD3A 4GW1B 1ZHBB 3R1GL 4UAOB 4X6DB 4PB9H 3CSYA 5DVMA 1A7PH 3VJ6B 5DC0A 2V2WB 4G6ML 4OFVA 4NQSB 4Y4FD 3WS3B 1I7UB 4S0SD 4FQJH 3SQOL 5DVOA 4L8CB 1VFAB 3V0VA 1DCLA 3DUUA 3FN3A 2VABB 3KLHD 1FL6B 1IAKA 1S7SB 3HMXH 3EYVA 3ULVL 3K4ZA 5EO1B 4N0FA 4R7NB 4WDIA 4Y4KB 2EDNA 4U3XA 3QDGE 3MJ9L 5E7FA 4TUOA 1UXWB 4I2XB 2XPGA 1A64A 1DANT 3BIAX 3W5NA 5FO8A 1G0YR 3MXVL 3QH3A 4Z7QF 4LVEA 1CXFA 2DMBA 1S7VA 3BWUC 3KPLA 5L8KB 4U31A 4EUPA 4HWBL 1BQHG 1ZA6B 4EQ3A 5T3XE 3BIKB 5DRXB 3CH1B 4ZO6A 5BO1H 2XTLA 5ALCL 5D70H 1MLCA 1KN2H 1QSEA 2EC8A 3QUYB 1IGJA 3V5KB 2ATPA 1ED3B 2IAMA 2JELH 5JORA 4MX7B 4I0PB 3FTGA 5DVNA 1TNNA 3DX6B 4POZC 5DJYB 5CD3A 3I6GA 1DE4A 4GAJH 3AS1A 4TUKL 1S7UA 2WWKT 4OZIA 1BEYH 1FZKA 4W70A 3O4LA 5KVEH 1P1ZA 1X7QA 4LCCB 3N1FC 1OWWA 4LLAA 5C9KA 1FJ1A 3RGVD 4HK0A 3IDMA 2X7LB 4FABL 2W60A 3UPRA 1EAPB 1T5XA 4LLMA 3IVKA 1UVQB 3NA9H 1PD6A 1GGBH 1JTOA 3ILQC 4QGTA 4HFWA 4ZUSB 4FABH 3D85B 4M6NH 3GHBH 4ZOEA 3WO4B 4H25B 5F7FA 3BKYH 4LBEA 3BZEB 3VGHA 1LE5B 5MEPB 5GSRA 1I1YA 4LDEB 2VDNH 2LU3A 4YDJA 1ZA3B 1IC7H 2FEDD 3DHMA 4NN5B 3RWGB 3TCLA 4IRSB 5DJCB 3RVUD 2JIXD 5E99H 3FQNA 4MJID 1CFTA 3MJ8A 5JOFB 3WHXB 3BN9D 4LNRB 2C3WA 1NMAH 4ZO7A 3TBWA 5E2JA 3TJHD 2QJDA 1SYSA 1RURL 1OT2A 3CFJB 4ISVB 4PJIF 4JR9H 4TSAH 1FE8H 1IAIH 5E2UL 3UTSE 5KW9H 5EU6D 1T2JA 3MRPB 4LSUH 4UQ3B 4JKMA 2VQ1B 2FB4H 1NUFA 3HI1A 4PGCA 4QRTB 4XCCH 5HHNA 4CRPA 3MRLA 2E5EA 4OLVL 3BEVB 3STLA 4DUXA 3R4DA 3ARBA 3QPXL 3BAEL 3O6LH 5C71A 3LEXA 4OCSH 3HI6L 1J10A 4W4OA 5DC4B 3TT3H 3UJTL 2NY4D 4WU7A 1CLYL 2K7PA 2XRAH 4OCSL 4U7MA 4JPVH 2NXYC 3O2VH 3VMOA 5LBSL 4KH2A 3BGFB 3EO1A 5I1JH 2V5RA 4JZJB 4P5TC 4QKXB 3D85D 1X6LA 1XR9B 3B9KA 1HHHA 4FQCH 4V2CB 2Q8BL 1OD9A 1JL8A 1FN4A 3C6LD 4K23L 5E8EB 5TPWL 1EVUA 1BZ9A 3UTSB 4FQJL 43CAB 5F1SA 4N9GA 5FYLH 3S8WA 4PGJA 1DQQB 2A6DB 3QYCA 3EDJA 3X13B 3T0ED 1JPTL 1PLGL 4BJLA 1IKFL 1V3JA 2ZNWA 2VXQH 4MCZB 4OFKA 2N1KA 3NACH 1KC5L 4KWUA 2VLJE 1AR1C 3GMLA 4DUVA 4YQXL 4YXLL 5EU6A 5FO9A 2GCYA 3HR6A 1W72H 1JZ5A 2COQA 4GSDH 4LLYA 3WJJC 5TE6L 4IRZL 4MQ7A 3FOLA 1JGLL 2XTJC 2GJ6D 5E9DB 5AYUL 5CBEA 4JN2A 4X6DA 3HZKA 5HYJA 5CSBA 3ZKND 5IMOA 4P46A 1MEXL 2AJVH 3VXMB 4HZLB 4DGYH 4M4PA 4LAQH 2HAZA 1U2HA 1MRCL 2BXYA 1WZ1H 4HJJH 2YPLE 3NCBB 4QLRA 1DVFC 1DE4B 5DSCB 3MNVB 2WSKA 4U1LA 5GGVL 5JUEH 4BA8A 1CFVH 1FG2A 1HXMB 5GIRA 3HTLX 5FGBA 4C56E 4ZYKA 1HKFA 2AJUL 1OF2B 3RY4A 2R0KL 1WVZA 2VSCA 1FORL 1FQ9C 1KJ3L 1E4JA 3C6LA 3ALPA 1XF2B 3QJHA 1OTSC 3QQNA 3AUVA 3O2DL 1EZVX 4LMQE 1JMZA 4HIHB 1T1ZB 4BQCA 3BJLA 2NZIA 4F3FB 3MODH 2OQJB 4NO0D 5I8CA 2YUXA 1A1NA 15C8L 4KAQL 2O5ZL 3IU4H 1AJ7L 2YBRB 3VXQA 3TZVC 3QUKA 1U42A 2O5ZH 3BDXA 1AQKH 1I7ZB 2X4RA 3O6FA 1BMGA 5DGQA 1KCVL 2BNRD 1KIPA 1A0QH 3BKCL 3CXHK 4YO0A 5L2KB 3L7FA 4JY5H 1YEKL 1IQWL 3CFBB 5BZDA 4PJCB 2FX7H 4HFWB 5M94B 3QO1A 3ZE2F 1LP9B 4FQXA 1CIUA 5EO9B 4UV7H 3U48A 4LHUB 4WGVB 5HI4C 3WNLA 1U8MA 2Q6WA 3VWKB 1NFIB 2R8SH 3CUPB 5FYKU 1JZ8A 4M3JA 4BFGA 3L95B 4PGZA 2WP3T 4L8SC 1G7PB 1DQLL 4U1NB 1I1CA 3E3QE 1XF5A 3Q5YA 5D1XD 2E6JA 4ALAH 2A9NL 2PO6B 4NYLB 1MRDL 1DBKL 4M1DH 3V4VH 4KJYA 3UEZA 3KWWB 4MA7L 1NMCC 1C08B 4MB4A 1RJCA 4PREB 4WW1A 4X5XB 1TJIH 4LSRL 1YDPA 1UM5L 5FA4B 4JFYA 4J2XA 1ZE3C 3HE7D 2GITA 4PR5B 3V8OA 4XCYA 2VZOA 5D6DC 2JIXA 5AD0A 3FOMA 1KC5H 3ZDYE 2J88H 1FO0A 5FUZH 3MLPA 1HN1A 2AEPL 1RUAH 1UA6L 4GRLC 4L3ED 2HLAA 5ID1B 3NBNA 4TN9A 3JBG7 4CU8A 4PJHB 1CICA 2N56A 1RUPL 4PJ5D 2VXTH 4GO6B 4Y1AE 3ULSA 3MJ7A 4YH6A 4X6CF 4JZNA 2VDPL 2X10A 2HT3C 2V9QA 2Z4QA 2PETA 1L7IH 3OKOA 5MEOA 3BPLC 4WHTA 2CXGA 4X4XB 4DZBB 1T2QH 2DTMH 1MUJB 5D7IE 3X12A 3LAFA 1V7NL 1IEBB 5IFHL 4KRPC 1K9TA 5F1NA 5JZ7D 2YMXL 1VEMA 3QDMD 5JTWA 5MENA 5FYKH 1T1YB 3FFCE 5LQBL 1NMBH 3U0TB 1U3HB 3G6DH 3QRGH 1Z0MA 3V5HB 4J3XA 5GXBB 3D69A 1T89A 2YD4A 1CXHA 3SE4C 4HZLA 4OM1L 3KLSA 3U0PB 4MDJA 2BVPA 3W0WA 4DEPC 3SN6N 1MHHB 2W65B 1A2YA 3C5JA 1QA9B 2OK0L 3VGFA 3KS0J 2OI9B 2YPVH 3M07A 4HKBA 1PAMA 1WZLA 1ZS8B 2WBJB 3P11H 5F97E 5GIRB 2YEZA 4OF5A 1A1OA 5HYQB 3V7AG 2Q8AL 5GS2D 3EYSL 4U1LB 4JHWL 3GNMH 4JANB 3T0AA 3P4OA 4CNIA 1WC7B 3GRWL 1NDGB 4KJWD 4M62L 5KANI 5E6ID 2NY4B 3JTTB 2Z9TA 3GJFK 3QCTL 1RZ7H 1M7DA 3KXFA 4LL9A 3L3HB 5CLWA 2Y07L 3VG0H 2WUBH 1XGUB 1EH9A 3MUZ1 3RHWF 1OP5K 2K9UA 3U7YL 4P5MA 4P2RB 3K1DA 4AIXA 2BSRB 3WDHA 5EO1A 1EEZA 3JVGA 5DUMH 3NA4A 4JREC 5D7JB 5MEND 5DMIL 3RU8L 2XRAL 2R1XA 3RWGA 1E0OB 2HT2D 2QLVB 1MNUL 2R2EA 3BKJL 3BPOC 4OGYL 3DUHA 4HV8A 5C0AA 2V5YA 5CP3H 3ETBF 4XC1L 4RBPH 1QPXA 4DGVH 4X9FA 2Y7QA 1R3KA 1S3KL 5C7XL 4O58L 1W0YT 3PJSB 5IVXF 4LRNH 4U7SA 2VDKL 1JYNA 1YN6B 1EJOH 4LSTL 3HLAB 1BFVL 2HVKA 1A9EA 4I48B 3TLRA 3CFIC 4GRWB 3PWLA 4DZ8A 3O9WB 1E28A 1B0RB 1JVKA 3RA7H 3VXPA 4QTHB 2VZ3A 1QFOA 3VD9A 3MV8B 3L95A 2ZUUA 5GS3A 5IB5A 3CU7A 5GS1A 1YY9C 4UUJB 3BD3A 4XP1L 1GVIA 4QRPB 4WFED 1UACL 4PV8A 3KPPB 4U2YA 3NMEA 4IRJB 4XCEA 1YMMD 2X9YA 2XZQL 4P9HH 5BJTA 4H25A 1I9JL 3MV11 3DI2B 4GRWH 4W81A 5MHSE 2VXVH 1P84K 5D7KE 3GI8H 1MCCA 3LEYL 5JHDD 5LAXB 4LOUD 4XP5H 5F70A 5I1GL 2QADC 4XNZC 1CFNB 4ZUUB 4NNYB 1D6EB 4YHML 4KVNL 5I75C 2HJLA 5D1XA 3WD5L 1Q9WA 5I2IA 3BYYA 2W92A 1XGYH 4JJ5A 5DUBA 2R0KH 3G6JB 1OW0A 1FAKT 3MRIB 1KJ3H 3ARUA 4N5ED 2VKWA 3SKOB 4JQIL 4G8FB 2ZG1A 3IDYC 4F9PC 1Q9LA 2JK5A 1UENA 5IBTH 3P11L 2VUOA 1VEPA 4NRXA 5J6GB 4YBHA 1DL7L 2YPKB 3RGVA 5HBBA 2GSGB 4F7PB 1KPUA 4YXKL 1JPSL 1CD9B 2F19H 2BVYA 2UV3A 2DTSA 3U9PH 4U1GC 4UDTA 3P9LA 1ZANL 2D7PA 1Z9OA 1NCDH 5SWSE 2ZCLL 3TESA 4M6MH 3MBEC 3W5MA 1NGYA 1TVHB 1T04B 3D3VB 5D1ZA 4F7CA 4JDTL 2B2XH 2DM2A 1BOGB 3L3GA 3TA3C 3V5HA 4TSBH 3CH1A 4Q0XH 4ZNEE 5DQDH 4GG6B 1OTUC 3LN4A 2OTWB 3QDJE 4Y5YC 3IDGB 1WBXB 1WCBA 4ENED 1I1FB 1UH2A 4O5LH 5F1IB 3NPZB 5L9DL 4MD4B 5AZEH 1M1SA 3IFNH 3QFJB 1GGYA 4OAWB 5D72L 1YEIH 4G9DB 3BXNA 4WJ5A 4AQ1B 1CGSL 3O9WD 4GAGH 5CUSL 2CKBH 2VC2H 1NFDE 3VD4A 4TYUA 1ORQA 2Y36L 5F71A 3WBDA 1LILA 5ESVB 3BYTA 1SEQL 2JJVA 5CUSH 3SO3C 4OI9A 4PRHA 5TE7H 2R69L 4ODVL 4URTB 1R0AH 3IDMB 4LSSL 2DN7A 1S8DB 4NWTL 5E8DH 4YGAB 1W0VA 4GRMB 3BN3B 5JIKA 1C1EH 2BFVL 3L5JA 1EHNA 1YMMB 1OCWH 3KYOA 1DDHA 3RQ3A 2ARJA 4NJAL 3O0RL 5D9SA 3RAJH 2CKBB 2KKQA 3VFNB 1YJDL 1SMAA 4ZPTB 1X44A 2DM3A 4AG4L 4Y5XC 5CJ5A 4G43A 5CD5C 1RZKH 1INQB 2Q86B 5FGCB 3TGXA 1NGPH 1D5XB 2QADD 3DX9A 4GKNA 4L8SA 3MRPA 2A73B 1CD1B 2GAZA 1YN6A 4Y5YB 3BQUD 5HGBB 1OQOA 1KTLA 5FKAB 2EH7H 4GLRI 1JRHH 3UYOD 1KB5L 3PDOB 1YMHA 1NBYB 2NY4C 2P5WA 4Q6IB 3LS5L 3BUYB 4YPGB 1Q9WB 1FL5A 1IC4H 4NO2B 3UBXB 2GJ6A 4XWOD 5JIPA 1MAMH 2FJFA 4OZFB 2VLKA 3BWAB 3CSYB 4QHNB 1HH6A 3RUGE 3A6BH 1WZKA 5F9WC 1KENL 3PNWA 1SMOA 1YNLL 4NWUH 1DEEB 4M00A 5CILL 1FNSH 1I1AD 4AH2A 4Z7VE 2W59A 3A6BL 4JFFB 1WLHA 1F4WH 1LNUA 4PJBF 1GPOH 2BHYA 4YHPA 2FO1A 3WFDH 3T0VA 4L5FH 1S9KC 2AK4B 2DB8A 1BM3H 1HQ4A 4NIKB 2GK2A 2L7UA 2PYEA 4GXVH 4LOUC 1JNLH 2X2YA 4JM2B 5F7LB 3RIFF 5DJXA 3B43A 2VLME 2IANA 3ULUH 1A6AB 3I02B 5F6HJ 5KSAD 3BZFA 1X5KA 2A83A 1QFHA 3BQUB 2AJUH 4X7TA 2NX5B 2VDMH 2V17H 4QXUH 2WUBL 4C56D 1OLLA 4MA3B 2UYLA 3OHXA 4EN3B 3NCYP 2HFEB 5A2JH 2FHBA 2GSGA 5HPMA 1RVFL 4AT6A 2ADJB 4PGBB 3WJJA 5IQ9A 3VFVA 3UTPD 2P49B 3UPCA 5DFWH 4R26L 5HI3D 3VGAB 2CK0L 4P59L 2R1WB 3QDAA 3UTTE 3UDWC 3IKCB 3ARPA 3D3VD 2NXZD 1H3GA 1R0AL 4JEGB 1I1AB 2F5BH 4NWTH 2XQYG 4PJEA 5E8DL 4Y2DD 1A0QL 3BKCH 3U1SL 1AE6H 4LLDB 1YN7B 3C08H 1JN6B 4Z7UE 3VFSB 2OTUA 3JWDH 3RL2B 3WIHH 2EEAA 3FN0L 5DXWA 1KIQB 1SBBA 2A74A 3GHBL 4U0RC 1JWSA 2IEPA 3CMOL 2QQQA 3CXDL 2PO6C 3MUY1 5E8NA 3ZDXF 5JQ6H 4X0KB 1U91A 1NGPL 3UTSA 2H8PA 4Y7MA 4BKLB 1XZ0B 2YOCA 4WCYL 3X14B 1CFQA 4ELMF 3I3EA 5AG8A 4LCWD 4Y4HD 4HUUB 4OD2A 4P57B 4XPGH 1WT5A 3ARBC 4LNVA 4LK4A 3ZE0F 5DRWB 4MNQD 2ERJB 4PRNB 4FTVD 3QWOB 1FLRL 2QHRL 3H42L 1AXSA 4PLKC 2BSSA 3CFCH 5IG7A 2ESVA 1OY3B 5D1QD 1GZQB 1XF5B 4P23C 5CZKA 5FCSH 5H2BA 3WD5H 1I1RA 3VFPA 3H9ZA 4ZD3L 4LSPH 4OUUA 2V7NA 1A3QA 3DROA 2ZG2A 5EOTA 3I2CL 4OIIL 4XTRD 1G7JA 4PJXF 3INUH 5K9KB 3DYMA 3Q0HA 2VN4A 5I1LA 2HN7A 1GGCH 2MQ3A 3MR9A 3QCUH 1F3JB 1CG9A 2VDRL 1RHHB 5KSAB 4PTUB 3KG5A 3INUL 1UM4H 3F12B 5C2BH 2EXYC 4DVRH 2E8YA 4KRPD 4WEBL 2JJTC 4NT6A 3QEHB 4KV5F 4C83B 1FNEB 4UDTB 2E7HA 4JQXC 5EU6E 4LAQL 3VWJC 5GZOD 2NTFB 3HPJA 3QUMH 5JMRA 4NKDB 3TYFA 3BH9B 4D0DA 4WEMB 2FR4B 3I6GB 2ZCLH 3DMMA 4QWWC 2GFBB 3GHEL 3PWUA 2OQJA 5EA0H 5I6XB 4DOHE 5D2NE 1NMBL 3QCTH 2YXMA 1ZVHA 4BSJA 3BISA 2X7LA 1DQJB 2NXZB 5KOMC 5JQHC 2HRPH 3FRPG 3WFBH 4G7YL 4ODXB 4P4RA 4Y2OA 4M7JH 2FH8A 3QUMB 3ZL4L 1RZJL 3BT2L 3L3OA 3T0BA 4M6NL 4YHIA 2VLKD 1OTUD 4GW4A 3NIGF 4MJ5A 5TQ2H 1KPRA 4WI6A 5CGYD 1C8PA 1VFAA 3F65A 3V0VB 5HY9A 4J1UB 2ED7A 5F9DC 5D93B 1O7VA 1BEYL 5DF0A 4P5TB 2XIDA 3JWOL 1EFQA 1JPGA 4XNQB 1EBPA 4AMKL 5DA4A 5DA0B 1WICA 3BXNB 4JFED 3JUYA 3QIWC 1MJ8L 3HZYB 5A2KH 5INCA 5IVXA 3AMKA 1IQWH 5C0AD 4YHKH 1WSST 3G5YA 5FO7A 3DMMD 3NPSB 4N0YH 1KJVB 4NO0B 3TNMB 2OM5A 3S35L 3BP5A 3FRUB 5HYJE 4HKBB 3RVXD 4MSWA 1LWRA 1YDPB 1Z5LB 2J5LB 2MFNA 3CCHB 4JJHA 4KZEH 4CVZA 1KTLB 4LP4A 3WLBB 2FSEA 3VI3F 1JZ4A 4GJTB 1SVZA 3W9EA 1X7QB 5BZWB 2HYMA 4X5WB 2A77H 3AFLA 1HHGA 1BJ1H 1NLDH 1J8HA 2ZPKL 1JGUH 1TJHH 3EJJX 3V7MA 4PJBB 2V5MA 2WANA 3V5DB 1S7RA 2VZUA 3LQZB 4OTXH 2WINB 3UBXG 4QRRA 3IXTA 4PS4H 1CFSB 2I25N 2FBOJ 5IVOA 1CK0L 1QYGH 4NUGL 1EEYA 4NSKA 1UFUA 3E6HB 3ZKMC 1U8HB 2D31A 3GJFB 4IHOA 5C09E 3S5LG 1JIBA 3KPQB 4S2SB 5BQ7B 1QFWM 1WWCA 1W2KT 3ME0A 5GRWA 3RKPA 5E9DD 2NNAB 4OKDA 5JHDB 4K07A 5E6YA 1I4FA 3T65B 4Y16B 1MJJA 1EUTA 5TPWH 2R1YB 2YD6A 3FQUB 3GSRB 4PP1D 4YXKH 3ES6A 5I8CB 1DVFB 4LKCB 1WQVT 4J3WA 1IKNC 3VFRA 3OF6A 4GW1A 4X4MA 3FCTB 5FAAA 4HF5H 3GJFH 3MR9B 1OWRM 5I18H 4KKBD 3G08A 4CW1A 2RAMA 1NGXA 3ARRA 3TIDA 1OP5H 2R2BB 1U58A 4XNMA 4XX1E 5I0ZA 4HGWA 3VFVB 5TE6H 4PJ5B 4EBQH 2W0KA 3ZSTA 5JZ7C 1VPOH 2J4WH 4JO1H 4OGZA 1HDMB 3V4UH 1NEZA 1OGAA 3SDDD 3A0OA 5E8EA 3ZE2E 2ADGB 5BV7B 3KYOB 3D69B 2Y72A 1VPOL 4GAGL 5HYFA 1KN2L 2ARJQ 5I1AA 3HPLB 4XVJL 1ED3A 2IAMB 4PJFF 4Y2DC 4KROC 3AREC 2HKHH 4CVWA 3MYZA 3GRWH 4R8WL 4RNRA 5J1AA 2R0LH 3VXOA 4P5KB 5JXED 2CXKA 5F7YC 4RCAA 1S7VB 1WFTA 2B8OT 3IDNB 5T3XH 2BC4A 3OB0K 2IAMD 4EI5A 2WIIB 1RMFL 1FFQA 3PGFH 5BV7H 4TSAL 1N4XH 2C3XA 5DRZA 5JHLH 1X5FA 2B1HH 5T1LD 1J1XL 4PGCB 1NFIA 4PTTB 4L4TA 2NY0D 4NPYB 1IGIH 4D94A 5H37H 3SBWC 3C5ZD 5ICZB 4MXWH 1D5ZB 3EYQC 2BVOA 4AM0B 1N64H 3FO9A 4WHDA 2XZAL 4P4KC 5KSBF 3CDFA 3OKLB 2XXMB 1GSMA 4KTDL 1F3RB 4Y1AA 1BWMA 4WWKC 4JPVL 1TJHL 3KWWA 1JF5A 4HWZA 3C5ZB 1U8JB 4NCC1 3VFPB 4HQQH 3CLFL 4K9EH 5D7IA 3TA3A 1QBLH 2Q8BH 1FN4B 1I3VA 2A38A 3QAZB 5FDWB 3NFNB 5FHBH 1QLRA 2IF7A 4LSQL 4OZHF 3T3MF 2IG2L 4ZTOL 2CUMA 3OAZH 1R24A 3FB7B 1GAFL 1RIUH 4I77L 2NY3C 1TIUA 5D2LB 4LEXL 3OQ3B 5C2BL 4X7CC 4I4WA 3M45A 3EOAB 3QQ9C 2HJFA 1J1PL 4JJ5B 2CKBA 4FRWA 5DJZA 4DN4H 5F7HA 4LPYA 1RULL 3OWEA 1Z0NA 4PJ8D 3FAWA 5MEOB 2UZXB 5A43C 4YXHL 2YC1A 5I30H 2NY2C 1JGEA 2IPUK 5L2KD 2XTJE 4TQEH 5AUMA 4HT1H 1FL6A 5GJTH 4WFFE 1W72B 2XN9B 3T0WA 4NQSA 5IJVA 4XXCC 5D1XC 4PJ8B 4KPHL 3QXDA 1PZUB 1CFVL 3BP4A 4H26B 3WUZA 4EXPX 3ISWA 3B83A 3C60A 3MZTA 3RPIA 3AU1A 5CD5D 3G6DL 1D9KD 1P4BH 6FABL 3MQIA 4NQUA 4RFNB 5IUSA 2UUDK 4OLUL 2J8UE 4JKKA 3QIUD 3LIZH 3ZHKA 1XIWC 1NGQL 5J12C 4NQDD 1SY6H 4DQOL 4HD9A 1WCQA 4K8RH 5C70A 4CADA 3MXWL 3UZQA 5BVJB 1T2QL 2DTML 3QG7H 4NC0B 1CLCA 2NCMA 1LMKA 2VL5A 3C5JB 4ZQKB 1DP0A 4PRIA 3U2SA 1FJ1B 4RGMB 3X17A 5C0FA 3U7AA 3A67L 1MLBA 1B0GA 5IR1A 4ONFH 4LPCA 1N5YH 3NFPA 5E9DA 1PG7L 3NN8B 1B2WH 3BD4A 1RMFH 4KKCD 4NM8H 4HPOL 1FORH 1BVZA 4HX1B 4XRCB 3BP5B 1D5BB 3WLWC 3V6FA 2LTQC 4X6DF 4N0UB 3P0GB 2ITDB 3TV3L 2V5SA 1A4KB 1P84J 1KUMA 1S78C 1HSAA 1PKQE 4MQXD 3T0EC 4UV7L 2KZWA 1AC0A 2CK0H 5I1LB 5ESAA 3F5WB 5IB1A 1CG9B 1AO7A 3IJHB 3I9GH 3PGDB 1ZHBA 5GJSH 1FV1B 3LKRB 3DV4B 1L9MA 1XT5A 1A6ZA 2RB8A 1NCDL 1OP9A 4M5YH 4OCRL 3M1BA 1TZIB 4WW2A 4WY7L 3KDMA 4N8CL 3LH2H 3IFLH 4L29A 2FECI 4M1DL 3MJ8B 4MA1C 5JOFA 1RQ5A 3QDHA 5D96B 1QSEE 3SY0A 3BRGC 3FN0H 3RJQB 4LCWA 4Y4HA 3U4BL 4AENA 1HILB 1BQLH 4XPTL 1NAKH 4QRQA 4WUUE 3G6AA 1QA9A 2J1KA 5FA4A 1R5VA 3VXRD 5JORB 2VOTA 5D72H 4AG4H 3GIVA 1MWAB 3R8QA 1OAXH 4WU5A 3RU8H 3D48R 3MRLB 3ZYOA 5DHVH 1FH5H 1W0WA 2IJ0C 1OD7A 3BIKA 1DN0A 3CPLA 1YQVH 1KJ2B 2GFBA 1DQDL 3PWUB 2VWEC 5J12B 4E41A 2IBZX 1C5BL 4ODVH 3PP3H 3KYNB 3VXUE 1BZ7A 1YYLH 8CGTA 3ARBD 1TCRB 3VFOA 1F5WA 3ZDZE 2G2RA 4ZS7H 3JV6B 1RURH 1BHGA 1MWAH 4JPWH 4LPTA 2VLRD 3DUUB 3TIEB 5DHVB 4F15C 2J2ZA 3CDGA 3RJDA 1RAMA 4YWGH 3FT4B 3LRSB 4EVNB 4FXKA 1WFNA 1HH9B 1KJ2H 4KVCL 4KMTL 5EZJA 5GGTH 2IALB 4UBDD 3QFDA 4O00A 3D85A 4I2XA 4RA0C 4NDMA 3OX8B 4KVCH 1EGJL 2B0SL 5FGSA 3WHE1 5I2IB 1JWUA 3C09C 4LLQB 4Y4KD 1NJ9B 4JLRB 5L8JB 2BSTA 1GHFL 2RQ8A 3T0EA 4AEFA 4P2QD 3EDKA 2D7TH 1F90H 5DMJB 5B21A 3N0PB 2H9GA 2B20A 2G5BA 4XVJH 4QY8A 1RZIA 1U8KB 3STZA 4YHMH 1J05A 4GRLA 3RDTB 1ZGLB 5HJ3B 3D5OF 5EUKB 2PXYB 4S1RL 2BNUA 4IDLA 2CR3A 5C0DA 4IMLA 1U8OB 3RVUC 2DICA 3IJYB 1NGYB 4Y4KC 4F7CB 1E4KC 2ZOLA 4PRDA 1QRNE 3IDXL 3SHSA 3C87A 5IHZB 1FG2B 1HXMA 3MOQA 3WHE0 2VLRA 2ZCHL 2Z35B 4JRXE 5IEHB 1CR9L 5HHVH 4N0CC 3ZLQC 4GRMA 3HG1E 4N0FB 1N3NA 2CH8A 1ADQH 1AKJD 1K5NA 2NY7H 1VFBB 1OQXA 5TDNB 4HWBA 1JZ7A 1UM6H 4MNGE 1RU9L 1BM3L 5B8CA 2HTLC 3S7GA 3U2SB 1M05A 2BDNH 1F6FB 4I18B 4LGRB 4X6BA 4KAQH 3V52H 4G43B 3DMMB 4YHYC 4FTVB 1YEGH 3AS3A 4JAMB 4K55A 4M6OL 4MAYA 3MRIA 4XVTL 4MZ3A 4G9DA 1BAFL 4NKOB 4MD5B 4P99A 5EDXA 3O41B 4HQQL 2CLRB 2ITCA 2QQLH 2H32H 1MPAL 3CFEB 3U4BH 3QJFB 4I3RL 2WLYA 1BAFH 2Y07H 4U6VL 2NY6D 4JFEE 4N1CA 2YZ8A 1Z3GL 1CDHA 1IRAY 4HAFA 1MCNA 4OLYL 3BPOB 4N1HB 5E6IA 3DV4A 5DRNA 5E08L 5B38G 1AO7B 3SDCB 3EYUL 2CRYA 5E1AA 4KZEL 4N90E 4TTDD 2YZ1A 2AK4D 3V4PL 3SGEI 5DR5H 1YEDA 2BOBA 4X7SL 1M4KA 2DJUA 4DGVL 4MJ6B 5EIIA 3I6KA 4JVWA 2CRZA 5IHUL 3VXME 1BVKB 1BF2A 1DFBH 3H7BA 1TTFA 4HIHA 4MDIB 2R29L 4XWGH 3GBML 4PJAB 4JFXB 1YEEL 4DTGL 4KHTH 3D2UA 4TSCL 2P8PA 4PGEA 1TVBA 2WWMC 3QEQE 2ZKHH 2DLIA 3OKKA 5BRZA 3VD5A 3WKNA 5C0EA 3MCKA 4ZD3H 4MAYD 2EYTA 4XB7A 1YNTA 1EO5A 4UQ3A 4LEOB 4D9QD 1PBYA 4JG1L 5DHYA 2VAAB 1I8LC 4LRIA 4ORGA 1HYSD 1JGDA 4LCCC 4MMZC 3U30B 1NAMA 4QTIL 1NGQH 3DVGB 1MHCB 1LP9F 2VXTL 3VXNA 4X4XA 1G6RL 3TZVD 2CIKA 4GQ9L 3L5XL 1KBGL 1UZ8A 2IMMA 3FT4A 4Y88A 1ZGLP 2DLGA 3E8UH 4FOMA 1HH9A 4K7PL 5I76B 3CK0L 3QCVH 3TPKA 5ISZD 5I1DB 2KQMA 2EXYD 2IMNA 4NPYA 4ZAKA 3N9GH 1DANU 4G80B 5JHDA 1DBBH 4X6CA 3OJDB 3GM0A 2NTSP 2R23B 4F7EA 1KV3A 2FGWL 2VLRB 2DMCA 5DHYB 1M7XA 1KEMH 1VDGA 5LG1A 1K3ZA 2HFEA 3U36A 2HMID 4HKJA 4P5TA 3D0LA 1CLZL 1JI2A 5LXGL 2YSSA 4P9ML 5CZVL 4Y5XB 5KJRH 1F02I 3LQAL 3QHFH 4P3CH 4CL7A 3TH2T 1OPGL 2BNUB 2EYRA 4YDIL 1BGXL 4HWBH 1LO4H 5HJ3A 4A6YA 1EEQA 4M6OH 3W81A 1BF8A 3BDYL 3BIBX 1KEGL 5JOEA 3L3OB 2H8PB 3VFWB 5T5FL 4PJHF 3P0YH 4ZXBA 1IKNA 3EJZC 3MACH 2L0DA 4G80A 1HCVA 4KROB 4X6CB 2VLRE 5FA3A 3GMPA 5D7LA 1U8MB 2Q6WB 3VWKA 4WTZG 3RWCA 3ALXA 3H0TA 4OIAA 5C86A 5FFLA 2F54E 4F57L 4ZTPL 3VXUA 1C5CL 4IRJD 1FRGL 4YPJA 5MENE 2J8UB 4RNRB 3EFFB 5F7MC 4ONGL 2Z31A 3DROB 1MIMH 3G5YB 5HGDA 1HOCB 1TZHA 4XVUC 1CGTA 3DGGA 5F88A 2BVQA 5FYJH 5FB8A 1ZA3A 3TFKD 5I1HH 3V95A 4NKOA 4O2CA 2PF6A 1U0QA 5EZLB 4UDUB 1LO3L 1KELL 5DK2B 1RHHA 3B8YA 3MFGB 3RKDD 4G8GB 1I85A 2LU7A 5C92A 3O9WA 3RVTC 3TO2A 2W9LA 1JHKL 4XCYB 3WIHL 4IHOB 5DEGB 4TTDC 3WFCL 4CMMB 5DRWA 1MHPH 3QUZC 4BQ9A 3OKKB 4MJ2A 5BRZB 2CRIA 4ELME 1BVLA 5C0EB 1G7QB 2FX8H 3VGGA 4OGXL 4Z6AT 5CAYB 2VR9A 3S4SB 1JP5A 5CP7B 3TBVB 2BNRB 4CBPA 1OAKH 2APVA 2H3NA 5H94B 5A2IH 1KB5B 2CSPA 1ZT1A 5FGRA 4J3UA 4OLVH 3BSZL 5F21B 1YUHA 1DDHB 2F15A 3SOBL 4UMGA 1VKXB 5KG9B 3BSZH 4Y1AB 2VDQL 2MHAB 2SEBB 2ZPKH 2XG5A 1INDH 1U58B 2DQFA 4OZFH 2ZOKB 3QH3B 2G75A 2WQRA 2E9WA 1G7IA 2YRPA 5DWUL 3SE3A 3BH9A 1P5VA 5K9QI 2LV4A 4OSUL 3WN5B 3N9GL 3FFDA 3Q2CA 3KJ4B 4OQTA 3I6LE 4P4KD 4YHZL 4HS8H 3ULUL 4K3EH 3GMQB 5EULV 1FVEA 1X5LA 5GSVA 3QNXA 5F9JA 4HS6B 2ZSVA 2Y9RT 3BUYA 4YPGA 5JNYA 3L3JA 5CBAA 1CI5A 3OAUH 3EW3B 3QFJE 4PYGA 3RZCB 2RJMA 2P5EE 3OHXB 4I18A 3SDAC 5E8PB 4ZOAA 3TH4T 2BRRL 1J1OL 2BRQA 3IVKB 3Q5TA 5IKCA 4WI9A 3R8BB 3GMMB 4B50A 4TUKH 1S7QA 3HZMB 1I8KB 3LB6C 2YA1A 2PCPB 1GC1L 3R06A 2EC9U 2VL4A 4HKXB 4U1IB 4ZYKB 3TFKC 1EA9C 3JV5A 1B3JA 3OJDA 3IFOA 5IHZA 3RNQA 1R3HB 3LDBB 1DZBA 3KVQA 3VI3E 1WFOA 4YGVA 4KTYA 1R3LA 2X4PA 1U2CA 4JFOA 5C09A 5TGBA 3U6RA 4JQXA 3TV3H 2YSSB 1C12B 3REWB 1NL0L 4F8TA 2CDGA 3W39B 5FO8B 2OMNA 1JWMB 4Y4FC 3SBWA 3LDBC 3CZJA 2HWZH 4Q9QH 2ICWJ 5JQ6L 1T7XA 1AHWB 3H9HA 1AQDA 1AR2A 1CGSH 1QVOB 3VGAC 3G6JF 4CN1A 2GHWB 4R0LB 1ND0A 5FYKE 1RK0A 4M3KB 5EC2A 1MVFA 5F9AC 3VXRA 1ETZB 2ZUXA 1EHLH 5C6TH 4YDKH 3NTCH 2VXSH 3WNKA 4PP1C 3PWJB 4ZNCD 3I75A 3OX8A 1J12A 2BJMH 4JHAL 3RL1B 4PV9B 2YD9A 3MCKB 5DEFA 4UOW1 1IAIM 2EEDA 5DQDL 1QSED 5KBNC 3LKOB 1T3FA 1J1XH 1NEZG 2ID5A 3IJSA 4O4YH 4LDOB 5IVZB 3NCMA 2CDFA 4F33B 5GRJH 3O45B 4Y2DA 5KAQG 4KMTH 5GGTL 4CAGA 1I8MA 3MRDA 4PRPE 3JTSB 1MFEH 4KI5F 1A7NH 4MXWL 5F7EL 4OM0H 5IFJB 4ZXBD 3DSFL 3K8KA 1N64L 1KN4L 3GSQA 3RI5K 4KK9C 4TVPE 4OZ4B 2FJGA 1ZHKA 3HB3C 3VWKD 4UNUA 4GG6F 1RUKL 4OLZH 1WAAE 3HUJF 5C0AE 1ACYL 5C1MB 1N7ML 3HB3D 3BGMA 2NYYC 4OZHB 1G7QA 4FNLH 1JPFB 4DWHA 1G7MB 4OF0A 4OD2B 4MA7H 3OXSB 1LEIA 1N7MH 1C1EL 5JIHA 1V7ML 3TNMA 1B4JH 4RGOL 3PP4L 3HMXL 2R4RL 1IFHL 4OCNC 2NY2B 3CDCA 5FYLL 3D87B 3FFCB 5HXMA 1BPVA 1T7VA 4NZJA 1SJXA 2W9EH 4BQ8A 2HFFA 4TPRL 4P46B 2BNQA 5KG9A 2X1WL 2DQDL 5IW1A 2PW2B 2VITB 4HUWA 4YE4L 2P5WD 2X05A 4Y16D 5E6IB 1XF4B 1BQHB 1BX2B 2VQTA 4FQIL 3PP3K 4DGYL 4ORZC 1DLHA 3ABZA 1IAII 4LVNB 4YDIH 3M8OH 1KLFA 1AXTL 4FXLA 4N8VB 4V1DB 5IB4A 2PR4H 1HNGA 3CJJA 1LVEA 3QWQB 1T2XA 3Q1SH 3IXTB 1Z9MA 3QUXD 4QRUB 5JHDE 2XN9D 3RY6A 1CE1H 4U1IA 5JW4M 5F3HA 2E6PA 3QNZB 4HF5L 1MJUL 1EVTC 5HHOE 2VR5A 2JF1A 2FJHB 2X4TB 3LN4B 1LE9B 4XVSH 1OTSD 2R56H 3FMGL 3TPUA 1MCFA 3S37H 1K4DB 5HGHB 3B9KD 1KOAA 1SYVA 3V0WH 2CMRH 4MAUL 2G5RA 3RVVC 2ED9A 5CILH 3S9DB 5BV7L 1VFOA 3DX8A 3HE7B 1S9WB 5HVGB 2FR4A 4POYA 2P5EB 1MAKA 4K3GA 3O2WL 3O8XA 3ZKQD 3KYKH 3LKPA 3ZTNL 5T33L 2QKIB 3TBYB 5ANME 5FYJL 2O5XL 1QEWB 3ZYZA 4CVUA 1AGBA 1QBMH 4M93C 2HKHL 1CGXA 4XAKE 3ZKNC 4IMLB 5DUPH 3VXSE 1ZT4A 2E6QA 5K9OB 4HKZA 1QBML 3JV4A 4DGIH 1MPAH 4YHPB 5HYJD 3WN5C 1XGTB 3FO9B 1B6UA 4BFBD 1IM9A 3KPOB 2PYFA 1CYGA 3WCYA 1OP3K 5DTFA 2AEQH 2N7AA 3TVMA 5CJQL 3VJ6A 1TVDA 1TVHA 3D3VA 1AH1A 5EU7E 1KPRB 4K8RD 2H45A 3NCYS 2YUVA 3DIFB 3E1F1 5L6YH 5D6CB 2WQ8A 3UP1A 1J9CT 1FH5L 2Y5TB 2A9NH 2HT4D 2GTWA 4NBYB 4HKJB 3BW9B 1OLZA 1IGCL 4Z7VB 1KXTB 1AXSB 5KS9F 3X3FH 2Y6SD 4P5KA 4OI7A 3VA6A 2YXFA 1I7RA 4P57A 5EBMB 4G6KL 4U1MB 5I19L 3HLAA 3BGMB 1FNGB 3OTTA 1YEFL 3HC4L 1RY7B 3HAEG 4CMMA 5TE7L 1UKTA 3PJSA 4Z0BH 4KKLC 2FSEB 2AXGB 3QUZB 3V4VL 1NCBL 1NDMA 5CIPB 4X7EC 2NY0C 2D03L 1JFQL 2MTPA 4QTHA 2VERN 2JJSA 5IFJA 3EO0A 2IANE 2AJXH 5JW3H 1YJDH 2V5TA 3MRQA 1B6DA 1DBAL 3S88L 2ARJB 3UPAA 3CGTA 3TF7C 1YY8A 1KCKA 4LEXH 3LZFL 2BK8A 3O6ML 3WXVH 3LV3B 1P5UA 1IE5A 1DQML 4QRRD 2FCBA 2IH1A 2LVCA 5AZ2H 3QXDB 1YQ2A 1G6RH 4RMRA 5C8JB 4ZAKD 2QHRH 4ZS7L 4YBQC 3QQ4A 3GMPB 4MGXA 1Q94B 1G7IB 1CD1A 2GAZB 4Y5YA 4WDIB 2CPCA 1UWEL 1CE1L 4G6AC 4PLOB 5J9PA 3GMNB 5CGTA 4ZUTA 3TBTA 3D9AH 1HSBB 1CFNA 4FZEH 1JNJA 3K74B 4YLQT 2B1AH 2DM4A 4YNYB 4ELMB 4GW5B 2FJHA 3KPQA 2ILLA 3VG9B 5GS0H 4F58L 4K94H 2D7NA 4PRIE 2FIKA 3PWVB 3QWOA 5CD3B 3D6GA 3TO4D 5IG7B 3IS1X 1G6RB 5BVPL 5JA8B 3GIZL 3SE9H 1KENH 1BBDH 5C0DB 1KIRB 1BWWA 1XZ0A 1KNOB 2A0LC 4PRHD 4V1DA 5IB4B 2CUHA 2J4WL 5DJ6A 1FC2D 1D5BA 5E5MB 1MCWM 3MXWH 4ZDHA 5IV2B 1OOAA 1D5IH 5E7BA 3V52L 4KI5D 1N26A 2BNQD 1F4XH 4MWFA 4I9WD 2MKWA 2YWZA 1IGFL 2BP3A 4PJ5A 4D9LL 1IEBA 4KGLA 2UY7A 1RJYA 2FBJL 1UADC 3F12A 1FV1A 3LKRA 4GLRH 3ARDC 2GYSA 2ZCHH 3O6KL 3TWCL 1L7TH 2EDKA 3IDJB 4YHNA 2UVEA 5BOPA 1G7JB 3S3JA 3MOAL 5A3IC 3SGKA 5L6YL 5C2UB 5BS0B 4L8DA 5JW5A 3S4SG 1MF2H 1ETZA 3QNXB 5F9JB 5D7IF 5F7EH 3HE6C 3QXVA 5I15L 5D1QB 4MCZA 1QVOA 2F58L 4JFEA 4G9FE 1CT8B 1ND0B 2M26A 2X4SB 3HI5L 4XBGB 5GZND 3DO7A 5CEYA 5B39G 2XOTA 2NLJA 3JZ7A 5T1LA 5JDSA 1AGEA 3K80A 3W0WD 4YFDB 4DKEL 5ID0A 3H9SE 3HI5H 1EJOL 5HD8C 3GK8L 3MRDB 5JR1H 4EUPG 3MREB 2VNCA 4UB0H 4F7TB 1IGTA 4U6VH 3L9RA 1TJGH 3KPSB 4P0DA 5B3JE 4KUCF 4QRRB 4GW4B 3OG6B 2X89D 1NAKL 1TLKA 3VE0A 3HAEA 4OSUH 3IFOB 4B5EA 2PN5A 1FGVH 1D7FA 5D9SB 4U1NA 1AI1H 1FZJB 3EHBC 3GSQB 2R4SH 4BSVB 4IRJC 4XNYL 4JFDB 1MCBA 1S9YB 4M61A 4JGMA 1FAIH 4U1JA 1PSKH 5E2TH 3MLSH 1EGJH 3FZUC 3DGCR 2Y25A 1UCTA 1HIMH 1VFMA 1KG0B 1UQSA 3R0MA 3JVGC 2D4FA 4PJFA 32C2B 4N8VG 5ICXB 3PHQA 3SO5A 2NW2A 1A7OL 3WNPA 2OZ4H 2DQCL 4YX2L 4MCYA 2B7DT 5IF0B 3SKMA 4S10A 1RUQL 1BQUA 3HHRB 3N1GC 4K7PH 2NY5L 2AQ1A 2O61A 5MI0C 1FO0B 3T0DA 5IW3A 3NIDF 4HAGA 4NOFA 1NBYA 4DCQA 2IBBA 4OLWL 4UAOC 1VACB 2GSIB 4HULB 5CJXA 3MV8A 2AEIT 4C57C 5CSZB 4A6YL 4YO0B 5L2KA 3NFPB 3ZZ1A 3LHPL 3L5WA 4NFBA 3LKNB 4M4RA 4GAYB 5MEQA 4XHJC 4LLMB 4WW2F 5B3JF 3UXFA 1FO0H 1ADQL 3N85H 2C3GA 3MLRH 5F7UA 1NBVL 3F7VA 3C60D 1G7LA 3MC0A 3EYSH 1G7PA 1D9KA 4JZOA 5ISZB 2PYEB 4WWKD 3WFZA 1RSFA 4MNHB 4J3VA 1CTNA 4KRNA 3KXFE 5D93C 4DJMA 5EU3B 3KPLB 4P2CG 4W68A 5DQ9A 4L9LA 5DRXA 3VMPA 1MQKH 1JPST 2EDBA 1QSZA 5H8DA 3CVIH 1X6NA 1P6FA 1P9MC 4TSBL 2NY7L 3AAZB 3WUWA 1Z5LA 3TBSB 2ESVD 2DQIH 5D1QA 3PWPE 3BT2H 5EU4A 3TN0B 4HXAL 3P4OB 4HJ0C 4UT6H 3S5LB 4XH2A 5ACLA 3MNWB 3FQTB 4HJGA 4HCRL 2EIBA 4U6TA 4K71C 4HX1A 4XRCA 5HHPA 5IB3B 3MRBA 5FECB 3O11A 4YDKL 5C6TL 3U79A 3SE8H 2MJWA 5B22A 1XGUA 2BFVH 4KZDL 4B53A 2QADB 4FNLL 1R3LB 5HVWA 4BZ2H 1T04A 3DVGA 3IDIB 5KW9L 3MSPA 4BK5A 1UVQA 2ADGA 1K5NB 4RDQG 5GRXG 2UY6A 5CS7A 5GGQH 5CHNB 1DQQA 3GSWA 1X4YA 3PUCA 2P45B 1MHEB 4LIQH 3V2AR 2FATH 5HGAB 4P23B 3F6IA 1KFAH 4G9FB 3P73A 2EDLA 3GMOA 1QD0A 3GSUA 2VQ1A 1RJLA 1UYWH 3KPSA 3WNNA 1WIPA 3MX0A 4MQ7B 4OCXL 4Q58C 5DT1H 2H2PD 4WHYG 3D0LB 4CJ0A 3A6CL 3OR7A 4HJJL 3ULUF 2JCCB 3C6SB 1ZT4B 5D71L 3KHOA 1N6QL 4Y4FB 5C9JB 2F54D 1IGMH 4L9DA 3T4YA 2ATKB 1PYWB 1Q9KB 1XGQB 3JWDC 1N8ZB 1JF6A 4CU6A 1BBJA 4G3YL 1OAZH 3QQ4B 4WFHE 3TVMB 5IJVB 1G9EA 1MAML 1Q72L 4ODHL 3UZEA 2OL3L 3QUXA 4IRZH 4NZTH 4PP2B 5I1EH 5IBTL 3U9UA 3TIEA 2XZCH 4D0BA 4X4ZA 4KQ3L 3KYKL 1JNLL 1UCBL 1H0DA 3ARVA 5MP6L 3NZHH 3WFHB 4U7KA 4P3CL 3LRGA 2GI7A 1ZKAA 2JCCE 3HUJA 4PG2C 3LVEA 4U3HA 3QQ3A 4P4KB 4X6DE 5F6IC 5I9QB 3VH8A 5DD1L 5I8KL 4LEOA 3U0PA 4LASH 3NVQA 1NKRA 2O93L 4OF8A 2LTQB 4RGMC 5DQ9B 1QFPA 4E42B 5KVEL 4YHOH 4G8FA 5I16A 5I18L 4OZIE 3V6OC 3GUTA 4RMUA 4QXGH 4APQB 3REVA 1EHXA 3O3AB 1MF2L 4J6RH 4PRID 1LO5A 3IB4A 3MV9A 3HNVL 5TQ0L 3SDYH 3VFUB 3L3IA 4H5SA 4PJ7B 5BO1L 5FYJU 3VI4E 1NBZB 1DTUA 1L0YA 4R4BA 4X9IA 3WUWG 1DR9A 4AK1A 1JZ3A 2Y36H 2FLRT 2H32B 2AJZB 4ZPVA 3TVMD 2X70A 2RBLA 3VXUB 3S3PA 1DQTA 3RL2A 3WNMA 4P5MB 1E4WH 1PW3A 4NUJB 3LCYA 2E9BA 2WNGA 4OCRH 4J8RB 3KXFB 4N8CH 5D7KD 3HMWL 4BH7A 3V6OE 3IDJA 1HHJA 4PJBE 3QPQD 4M7ZC 1WEJH 4L8BB 2Q7YB 2J3SA 1B4RA 3EOTH 5KTEH 3P30H 1E6OL 5K9QG 3VXRE 3MA9H 2CRMA 1DSFH 3VRIB 2CLRA 5T3ZD 2UUDH 4RIRB 2OR8A 5E08H 4PGBA 5IGXH 4R90H 1WGOA 4BUHA 4AEHL 5ITBH 1ZVYA 2DWDA 3TT3L 1SJEB 3EJZD 5E4IA 3QDGA 5J13C 4JG1H 2FL5B 1PQZB 2VQUA 4L4JA 1BD2B 2PTTB 1JYWA 1BOYA 1PZ5A 1BFTA 1BZ7B 5LCVL 4OLXL 3LS5H 1NLDL 1YEEH 2OX5A 1OSPH 4PJEF 4RFEB 1YPZA 4NZRL 4Z95L 3CMGA 2J8HA 4DZBA 4AIOA 1CBVL 1V7NH 4R7DB 4D9RD 3MJ9A 1HQ4B 4LQ1A 3NGBB 3QPXH 1O0VA 3DSFH 4L4VA 4WI7A 1GGTA 4NFCA 5DD0L 1KCLA 1M7IB 5F96H 4DVRL 1A8JH 1RUKH 3OGCA 1GRWA 3ULVC 1NCAL 1U41A 1UB6B 2D0FA 1NAMB 1MCRA 4NQVA 1NCAH 1EGJA 2JCCA 4JLRA 5A1AA 3GMLB 4GBXD 3OR7B 1L7IL 4E0RB 1DBJL 1YNKL 2DQUL 2OSLA 2QV2A 3STBA 3U4EA 4OV5A 4G6MH 4GKOA 4PLKD 4UZGA 2Q8AH 3SJVD 4IOFC 5D6DA 3O4OB 3QEUA 1MH5A 1EV2E 2XTJD 2VAJA 3KS0H 5HPOA 2XKUA 4WHYH 2AJSH 3FQWB 2ICWI 5ADPH 1NC4A 3FN9A 3L1OH 1YPZF 2NY1D 2XNAA 3BOVA 1NAMH 1PJ9A 4LSVL 1XR9A 4TULH 5IHLB 4KPHH 2IAMC 2X41A 2X4PB 4B41A 1BFOA 2G2RB 4JZOB 4TNWK 5ISZA 3MRCB 1ZEAH 5ID0B 4OZGA 4UT9L 2MWCA 2BHUA 4LLWA 3IAGC 1L6ZA 1IARB 2V6HA 1CXLA 3T4AA 5J6GA 1GOGA 4Z7NF 2D7TL 4F7PA 4ZAKB 4GAFB 1OAYL 2BSED 2JJWA 3QEHA 1JGVL 4K8RL 1U8JA 1KJMA 2NW3A 1AJ7H 1FFRA 1MCKA 5F9OL 1F4YH 4LCYA 2VISB 5DUPL 3FOLB 2VLKE 3QWRA 12E8L 3ZYJA 4CVZB 5F72S 4E41E 4WNQB 4DOHB 5K9JL 1SYSB 3EO9L 1RK0B 2ITCB 1Z9SA 1J88A 2E7BA 4XI5D 3PDOA 3DUSA 3SJVA 1MCQA 4HKZB 4YFLF 5C0GA 3PIQB 1I3RA 5DRZB 2ZZUT 4LLQA 1WTLA 3IETA 1C5DA 4ZMAT 1FVDB 4UIKH 4N90D 5C08D 3WE6A 5IV2A 2O5XH 4POZD 1Q9OB 1QBBA 2UWEA 5M95B 1LK3L 3NH7L 2AI0L 5IEKB 3QJHB 1OARL 1RZFH 4IRJA 1INQA 1TQBC 5IEHA 1T03L 2DQCH 3RTQA 4YX2H 3Q6FA 1FBIH 2CJUH 1D9KB 3ZKMD 4S1DC 2GT9A 1KB5H 1INDL 1IZKA 3PXHA 4RRPG 4LLVB 4H1LA 5HGAA 1CBVH 4PLJD 1U93B 5SV3A 4XNUH 1F97A 3HNSL 3DRQA 1MFAH 2XY1A 1JFQH 2P7TB 5FB8B 5CP7A 3OB0H 5E00B 1T0MB 1QKZH 5EFIB 1LP9E 1PLGH 3HNSH 1F2QA 5E6ZA 4L8CA 5FUZL 3U83A 1P4LA 4U2ZA 1KCRH 2HVJA 3FCTA 3EYOA 4JDZA 3DXAD 5BVJA 4XWOC 2ZSVB 1R3KB 3PQYA 4RBPK 3CD4A 1R5WA 4R96B 4G5ZH 1W72L 2DQTH 3FT2B 4FQ1H 3W2DL 5HDOA 2E7LA 3T3PF 3WO3B 3S5LA 3UTPE 4EXKA 3UTQB 3DV6B 2VDPH 3BZEA 3C6SA 5IMMB 4MS8D 4UNVA 4RSVA 1CDIA 3IXAA 1I7UA 4K3DL 3BP7B 4AYFA 1KG0A 1J11A 1UQSB 3B3IA 4PJDB 4MB5A 5K9KA 2QBWA 2BVEA 3OGCB 2D0GA 3HG1A 4M7LH 3V79C 1M7IA 1S9YA 4M61B 1NLBH 4ODBD 1CXEA 1A6TA 3OMZA 1HHKB 3C6LB 1CD8A 4HH9B 1RZ8A 4OIBA 1NGWA 4PJAA 1NBZA 3GSNH 4Y89A 5EUOE 43C9A 3JWNC 4WV1B 1MHEA 3FO2B 4FA8A 1R5WB 1Y6NR 2XFXB 3EKCA 3CFDA 3D1MC 1E27B 4XBPA 4HXAH 5T3ZL 1ACZA 3RDTC 1BP3B 4IIQB 3ZTNH 3Q3GA 4WEUD 4NRYB 1RJLB 2BVPB 2DIAA 3W0WB 5ICYB 1ZLWH 3DXAA 1MHHA 5EU5B 2NY0B 3BDYH 1KEGH 3PQYD 3BZ4B 2W0FA 5EWIH 4ZQKA 2G5BB 4GAJL 3CDYA 3K1KC 3G6JA 4M7KH 3GSNB 4RWYH 4LSSH 5IW1B 5KS9E 2X4SA 4XCNB 2PYFB 1CF8H 1A7RL 5HHMB 2QTEA 3MACL 4KDWA 3WKMH 4JY4B 1J0HA 4RMWA 1ZMYA 3CH8A 1CDYA 2BJML 4Z18A 1VGKA 1Z2KA 2F53E 1UH4A 1DSFL 4D9RE 4P2RD 5EZIH 4PJ5E 5CZXD 2V2XA 1NL0H 2DQHH 4GUPA 1T7ZA 3B9AA 3H3PH 3LEVH 2AERT 4LHUA 4QWWD 5C0JA 4ENEC 3VFSA 1NGZB 3GBLA 3S36H 3OKLA 3PGFL 4XNZB 4PJEB 3LKSA 4NJ9H 3HG1D 1YEIL 3PGDA 4WWID 3LQAH 3QHFL 4PJCA 2Z4QB 3H3PL 3LEVL 4OD1L 4OGYH 2EDTA 3BAEH 1IQDB 2DWEA 4OT1L 1MIML 2HFTA 5ITFA 1F6AB 2YR3A 1FPTL 1TETH 3FB7A 5EC2B 5I8EA 1NKOA 3L3DA 2DI8A 5LWYH 3MBXH 3REWA 4HBQA 3AC0A 1HXYA 4BZ2L 1NUDA 1IT9H 5C0CE 3KLDA 4JFZH 1JRHL 2Z31D 3B4NA 1U93A 5LWYL 4YFLI 3HS0A 3IDNA 3WL9A 2F53B 4BK4A 4Y5VC 1IMHC 2BSSB 4XHJD 1YEJH 3DX7A 2GITB 4MJIA 4PR5A 1YNTB 4WI3A 1A9BB 3OXSA 1LEIB 3UC0H 1V7MH 5ERWB 2GQHA 1W0WB 4P49A 5FYJE 1QLFA 2FRGP 4I0CC 1EPFA 3T04D 5JXEA 3JUZA 3BKJH 4YUEL 1VB9A 1LHZA 4BH8B 4DVBA 5HHXH 1IKFH 3PGCA 1OAXL 3RL1A 2CDEA 4ELKA 1ZHKB 3VRJB 2F54A 1MRFH 5FUOL 1P4IL 4LHUD 2EH7L 2YS4A 4IIQC 2W9DH 3CSPA 4MYWB 4FFYL 5T3XD 4FFVD 4JVPA 4X4YB 1U95A 5FUCE 3C5ZA 1UWGL 4JREB 4BSWA 2X9XA 1G1CA 1MUJA 3P9MB 1LEKA 1MHPL 1FGVL 3DETC 5C8JA 3B2VL 1MY7A 4X6EB 2O5YH 2X4UB 4GMTL 2VIRA 3T1WA 4YAQA 1T1XA 3WN5A 3IAPA 4XP1H 4X9GA 5FKAA 3UJJH 4XNYH 4OKVB 2HVJB 4J4PA 1GOFA 3SKNA 3F8UB 4WO4D 3SCMD 1FZMA 3ZKSD 1Q0YL 2R9HC 4JM4L 5FKPB 4O2FB 1FCGA 1MJJB 2NNAA 1AFVH 2YWYA 1I4FB 4I4WB 1CIDA 2ZUWA 1JNNL 4H88H 2NY2D 2FECL 1AFVL 3RNKB 4WO4B 4BQBA 1UWEH 2AJVL 4NC1E 2RCSL 3R1GH 4JO4H 1JHTA 1FIEA 1HINH 2GW5A 4DAGL 1U8PB 1DUZA 3RWDA 3DXAB 1F4YL 5F3BB 1QACA 5IKCB 3V8CA 4KDVA 3D0VB 4OGAD 2QQNH 3RWHB 3FQWA 1ZLVH 1MFBH 2XQBL 2PXYA 4XP4L 1CQKA 1I9IH 2NYYD 4H1LG 3THMH 4XZUA 3BUTA 4YHIB 5JDSB 2HT2C 1T7WA 3LQAC 4QXWA 3S37X 4D0CA 2AK4A 2XFXA 2DBLH 3EOTL 4IMKC 1KTDB 4P4RB 3V5DA 4OF6A 2ADFH 4N0YL 2VZVA 2YA2A 5FKPA 2WLZA 4PJFE 1JWSB 4XMPH 1T20B 2KQNA 4DUWA 3O3DB 3H9HB 4D3CH 1D6VH 3FO1A 3DGGB 4ZUTB 4XPHH 3C5SB 5I66B 2F19L 1T0NA 1QFWL 3D2UD 4WO4A 5KZCD 5ITFB 5C09D 1K8IB 1EFXD 1IGFH 3L3JB 3WXWL 4MSWB 1JTTA 4JDTH 3MTRA 4K2UH 4NHCH 5DZNA 4WJ5B 4NO0A 3TN0C 3DECA 3SDXA 4YR6B 3MNWA 3ORJA 4S1SL 1WFUA 5DDHB 3O6KH 1FDLL 1Q0XH 3T65A 4HIJB 3ARFC 4O5LL 1I3GL 3UO1H 2HLFD 4JRXB 1MJ7H 3QEQB 5DK3A 1QO3A 4OCLC 2A6IA 1P7QA 5DMYA 4AT6B 4X8JB 5FHAH 4RX4D 4XPBH 1RD6A 5KVDH 1HHGB 4BH8A 5DHVA 3HNTL 3RGHA 2H32A 1WK0A 5IMLB 4XPBL 4AEEA 5BS0E 1U3HA 2MHAA 1OAQL 2AEPH 4PB0H 3OJ2C 4F2MA 4IM8A 1FAIL 5TH2B 5J3HD 4YGVB 3B5TA 4YHLH 1IL1A 5CIPH 5E99L 5KOVC 3HS0B 1FFNB 4RIRA 4U6XB 2GTWB 3NTCL 1YA5A 5I30L 3QB7C 1UXSA 2VDKH 4Z7VA 1L4IA 3P4NB 1PEZA 4PJ9D 2J6EL 2OL3A 4PP2A 2RIKA 3QEGL 4FQHB 1KJ2L 1T7YA 4XP5L 5I1GH 4K23H 3H7LA 5IQ7L 1GZPB 4YAQB 2C5DC 4L4TE 1Y18B 4KK5C 4U1SA 5IK3A 1IFHH 4OIIH 5DS8A 4QHMA 3WSQL 1QPPA 1DBAH 1I9EA 2A1WH 2EEBA 4LLYB 3GGWA 3PIQA 4UT9H 3MUGB 4LLUA 1OM3H 3SOBH 3NFSL 4GG8A 4IBLT 4GRWF 4R7DA 3MRQB 5DJZB 4M43L 4UV4H 2X09A 1NC4D 1HE7A 3EFDL 3K4DA 1BJMA 2I9TB 1PX3A 1T21A 4UILL 1JGVH 2VIRB 3R06B 5CEZD 2JKXA 1QR4A 4JM2D 1F00I 1NFDA 2M2DA 4FZEL 2CGRL 3QRFM 4ODTL 1CU4L 3ZE0E 5TE4L 4XAWL 4BQ6A 4CNIB 1KPUB 4D9LH 5TDNA 3GI9L 4E5XB 1E27A 4XBPB 5F1KC 4PJCE 1T1YA 3HUJB 2GUOB 3Q3GB 3QNYA 1MJ8H 4Q9CA 1MQKL 3TPUB 5F7DA 4WV1A 4KY1H 5DQJB 1GYAA 2XWJB 3FKUS 1NC2A 1RZGB 2B1HL 3CFDB 1WBZB 5T1MB 4P48A 4JCLA 4NNPL 4XC3H 4FQIH 3S35H 1TQBB 4Y19E 2ATPB 1JZ2A 4UOJA 2H6PB 4U1GB 2Q7YA 3O2WH 1NCTA 4GXVL 4L8BA 4ESKA 2QSCL 2YD8A 3G6AB 4R4ND 3FT3B 1NEUA 4L3CB 3RP1A 4J3TA 4CGTA 3DTXA 4OF7A 4XMKL 1MNUH 2IC2A 5CKGA 1OL0A 2A9MH 5C0AB 2PW2A 1SHMA 2NLJB 4JG0L 3MRHA 4P2QA 2FH6A 2V17L 2PYEE 1BFSA 5IJKC 1ZHLB 3PXJA 4HIJA 2R56L 3IDIA 2I5YL 3S96B 4P9HC 2PW1A 1XEDA 1HK6A 1E6OH 3MOAH 3AROA 4MAYC 3LSOB 3OKYA 5DTFB 5IB1B 5BS0A 5AZEL 5GGQL 5J06A 2B5IB 5DLMH 1N5AA 3F5WA 5ALBH 4XX1G 3MODL 1BIHA 4CU7A 3CC5B 4R97C 5TF1L 2FATL 4MDIA 4PJAF 4Q9BA 1JHLL 4KJYB 4EDXB 1S7TA 4Q74A 1K4DA 2VXUL 5FUOH 5HGHA 2ORBL 1IEHA 1MCWW 3D39E 4QNPF 4U6HA 5I1IH 1X5AA 2Z8SA 1KCUL 1NCCL 4JAMA 3BP6B 1BZ9B 3V7AE 5CJBA 43CAA 1LO3H 1A4JA 1RZ8B 5DZOA 1MI5E 4JKWA 5HHME 1E4KA 2E3VA 3BZ4A 1YY9D 4J23A 2D9QB 4CDHA 4NO3A 1UH3A 3GFUA 1TQCB 5D71H 4HUVA 2WIMA 3O9WC 4KHTL 2XKNB 1C16A 4LIQL 4APQD 3L7EA 1TZGH 2VLJB 1AO7E 5FO9B 2EDRA 3HE6D 2D4DA 3ARSA 2FO4A 3IAQA 5CJ8A 1BREA 2OJZL 2ZOLB 4PRDB 5JPNB 2HJKA 4OD3H 3VH8G 3D39B 2BOCA 3CFCL 4OZIF 1P7QD 4KK6C 2Z31C 5ADOL 3WIIH 3NPSC 4RX4A 3G9VA 3NIFF 3WFDL 4OUOA 1UKSA 4TUJA 1UCBH 3IFPB 1CE6B 5FXCH 4XT1C 5LAXA 1F6AA 1UB6A 5SWSB 5BRZE 4K7PX 2AS5M 1H5BC 3KYAA 3UPRB 5EH1A 5IT2L 2OR9L 5E00A 2BNRE 5GGUB 4N0CD 2AJZA 2BHZA 3VRLF 2ZNXA 5IFHH 5ADPL 2J88L 4LPUA 5LGKA 3RHWK 4PYHA 1U8IB 1FYTD 1NCNA 5DJXB 5BMFH 2B2XL 5E8OA 4EI6B 4ZUWA 2CD0A 1FNHA 2I27N 2OI9C 3RUGB 4KJWC 3KPRE 7FABH 3MV8D 4JN1H 5IVXE 1FZOA 3MMEA 3O3BA 2UYLB 1DUZB 4M1GL 1ADQA 3BESR 5MEQB 4LARH 3OL2A 3GJEA 2GY5A 5JXAL 1IC1A 5JOPD 2VC2L 4K2UL 1Q1JL 2AK4E 5DD3H 5DFVD 3VFNA 5D7JD 4WFFD 4XNXL 2C9AA 5C07D 3OKDB 4LPVA 3VI4F 3GKWH 4NP4L 5A40E 4L8DB 3LPFA 1WEJL 2BSRA 1L7TL 4HWEL 5D2NB 1F3JA 1YEJL 1R5IA 1ZA6A 3UBXI 1YEHH 1H8NA 1RZJH 2EO1A 4WW2C 4Z8FL 4JE4B 3AAZA 3ILQD 2EDJA 1SJVA 1HHJB 3AGVA 3KPRB 5D1ZD 4ZTOH 3W39A 5I66A 4LCWB 3DO7B 5DJAB 4ODUB 4H8WH 4PJIB 3UTZA 2MMXA 3DO3A 4L4VB 1SBSH 5EU5A 1J87A 4ODSL 3ARTA 1CXKA 3G5XB 4PJ7E 3O4LB 4JANA 3RVWC 2NY6C 1KGCE 3QJFA 1NC2D 2HKFH 1IC7L 5C3LD 3UJIH 5CFHA 1QSFE 2DLHA 4JY4A 1IC5H 1NQBA 3MLTB 4DN3L 1LO5B 4X6CE 1WJ3A 3P30L 4N0RA 3SEPA 4MJ4A 3BEVA 1ZLVK 1T22B 4YWGL 4QHKI 4GMTH 2IANB 5KSBB 1R3JB 4FZ8L 4XP9H 3RNKA 4LKXA 4X99A 3HE7C 1CK0H 1DUYB 4OZ4A 5C07A 4NQEB 4PJIE 2F58H 4HLJA 3HC0B 3UMTA 1XGRA 5E5MA 4HSQA 2Z93B 3BDBA 1AD0B 1RZFL 4MA8H 3ESVF 3SGJC 3OB8A 3L3DB 2EECA 5FO7B 1B0WA 1A02N 3WYRA 1BFOB 1CL7I 5B38A 5BS0D 4NBZB 5D7JC 4GT7A 5ESQB 3VFTA 4UB0L 1UWGH 1OSPL 3PQYB 2AV7A 1UC6A 3SQOH 3OKNB 4JVUA 1S78D 3MRFA 4PS4L 4PRAA 2ICES 2QQKL 2H9GB 3FO1B 1I1AC 2ADIB 2Y23A 4I0KA 4PRPB 4JDVA 4JY6A 3MJ9H 1CFBA 5FYKD 3N06B 1B2WL 4ORGB 4PD4K 3NIFE 3I50H 1K85A 1DBMH 2Q1EA 4NQEA 3VRJA 3DOSA 2Y1VA 4YIQB 3BE1L 4DFHA 3CNKA 3PWNA 4P9MH 3O6MH 5CZVH 3WXVL 4AEIH 3ZO0A 2Z91A 5ALCH 5TF0A 3QDMB 4FMKA 1DQJA 2FHCA 3F58L 2OZ4L 4JGJA 3SGJA 5A16A 3C8DA 5GHWL 1N6VA 3D18B 2ZCKL 3X14A 1Q1JH 1ZVSA 1KLGA 4EZMA 1M6OA 2WINA 3BQUC 2XWJA 4U6XA 5F9OH 3HC3L 1QHPA 1J0JA 1ZANH 3X11B 2ENSA 5I1KH 4KK6D 4LSVH 4NM8L 3NA9L 4F2MB 3RPIB 1VADB 4EIZC 1H0DB 3WKML 1CL7H 4G8EA 3BVNA 4RQQB 3EO9H 1H8OA 3O3BB 4WWKA 4HC1L 4JO1L 2HFGH 5E9DE 1EHAA 2HWZL 2XWBB 1AGCB 4P3DA 1N2RB 4Q9QL 4P4KA 3S36X 1N59B 3VH8B 3FRUA 1A6UH 4NKIH 2VTFA 4G7VL 2UWEB 4LNRA 2CLZB 4P59H 3DYPA 2C4XA 2ZSWA 4PB0L 5FIEA 1EHLL 1FYTA 3WNOA 4PTTA 4XH2B 1OVZA 5H2BB 3MLXL 2O61B 1CGVA 5DJ0A 4ZXBB 4NRZA 4QRSB 4RAVB 5GZNC 4M6ML 1JHKH 4LBEB 4ONHB 3OZ9H 2DBJA 1ZGLM 4LSUL 2DJSA 4WENB 3MCLH 5EBLA 4PJXB 2AW2A 1QRND 3RWCB 4ZUVB 3VDCA 5AYQA 3BVNB 1UZ6E 1QBLL 2APBA 4WWKB 4NZRH 2FX7L 1UWXH 3NCFB 1NMCB 3AB0C 5L0QC 2VDLH 3PV6A 4YUEH 4POUB 4ZPTA 4JRYB 2AABL 2BC4B 3DX7B 2XY2A 4MJIB 4PJ9A 5T1MA 1AD0A 3DVIA 3BW9A 3GB7A 3WLWD 2VLLA 4QTIH 4PRPD 3O4LE 4R7NA 4HUVB 2YUZA 4X6FA 4G5ZL 4PREA 4WW1B 4E5XA 1R24B 4RGNE 4I48A 2QR0A 3PABA 5FM4A 5HVHC 2RFXB 3ULVE 3RUGF 1NSNH 3QDGD 1T22A 4JO3L 3QP3A 3DSNA 3L3KB 4OZGF 4LSQH 1J5OH 2NTFA 1BBJB 1HH6B 4V1DD 2J8OA 1V05A 2GCYB 3O0RH 3G6JE 2NX5E 2EE2A 4R4FH 4ZFOA 5C07E 5IIEB 2YC1B 4S1QL 3EYFA 5CCKH 2E27L 4LQFH 3TIDB 4ODWA 2XT1B 4UINH 4UT7L 2V9RA 1MQ8A 3F6LA 5C0IB 3K81A 2DQEH 5HHPB 4CUCA 5IB3A 4M1GH 1FNFA 25C8H 4HW6A 5HDQL 2PW1B 4L5FL 4RFNC 1FVCA 4NN5C 2MPAH 1ZK9A 2VWEE 4KUZL 3IDUA 4OI8A 4HHAA 1ZAGA 2BVTA 3B9EA 2VKXA 5IM7B 5EU3A 1G9NL 2AKRB 1WIOA 3EJYD 1HDMA 1CDUA 1IGML 3RUGA 5I1KL 3LD8C 3UJJL 4QXTA 2AJSL 4Z78A 2CO6B 3MFFB 4OLWH 3FB8A 2WP3O 4QOKD 1MCJA 2XN9E 2LE9A 1V5JA 4Z8FH 2W65A 2JLLA 5L88H 3HA0A 5EUKA 4MHHG 2GJJA 4XP6H 1AR1D 3HRPA 4H0HB 4M6AA 2C7UA 1IEAB 1R6VA 2VE6B 3KLAA 4H1LH 1XIWA 1U8KA 1LO2H 5D7SL 1FVDA 1GGIL 1I8IB 4QEGA 3OGOE 5F6HI 3ARZA 3I9GL 3KNBA 5AUMB 3JTSA 5JO5B 4HMCA 4NKMA 2A6JA 4RAVA 1NH6A 1YN7A 1G0DA 1NMAL 1QOKA 5KZCB 4IRSA 5DJCA 5FCUH 4PRBB 1K4CA 3QIWA 5EZOL 5F1IA 1MCPH 2AJ3A 4I3RH 1H5BB 2Z31B 4QXGL 4KI5C 5FOJA 4FG6C 3OAYH 4PV8B 2DQHL 4X5XA 3C5ZC 3VCLB 4BSWB 3O6FB 2I9LA 4Z76A 5FK9A 3UJTH 3SDCC 4Z7WE 1TNMA 5IVXB 3QUKB 4JQVA 1MRDH 3WUWB 4OT1H 1EMTL 2VAAA 5D2LA 3VW3L 1U36A 1OTTC 3VG9C 3AMLA 2FX9L 5C0BD 4UQ2A 5C08A 3U7WL 1E6JH 1YYLL 5AWNL 3O8XD 1T3FB 1JCKA 4LCUB 2WUCL 1DN0B 3RVWD 4K7PY 1IBGL 2DDQL 4PJXE 1BVLB 3BGAA 3QCVL 5FV2A 1FFNA 1VERA 1JHTB 2WBKA 3DMMC 1MVUA 4M5Z