5HYJD

1e6 tcr in complex with hla-a02 carrying aqwgpdpaaa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
193
structure length
193
Chain Sequence
KEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A "hotspot" for autoimmune T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 33
structure length 193
sequence length 193
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjD02
4DUWA 4LHUG 3QPXL 4YX2H 4OZ4B 1JNHA 3ZE1E 1ZT7A 1L0XA 3TVMA 3KPRD 1V3KA 4S1QH 3SGJC 5DFTA 4PGEB 3WYRA 3WUWG 4Q0XL 2HVKB 1HINH 2BMKA 4YHKH 3S4SB 3MV7E 3O6KH 4GKNA 4LSUH 4DZ8A 3LIZL 1I8MA 1G7JA 3PWPA 5LGKA 4YHNB 4GAJL 5GSVA 4LPUA 4JHWL 1DVFA 2G60L 3BGMA 4OCRH 1BZ7B 4GAGH 1KLUA 2YUXA 3F8UB 4U1IB 1G7HB 4CGTA 1P5VA 2R9HC 3HLAB 4YFLF 5HGHB 4LHJB 5B39A 5HHOB 1BVZA 4OJFH 1LEKA 2VLKB 4YFLI 4QCIA 4JRWA 1HKFA 1ACYL 2Y25A 3ARGB 4ODBD 1UYWH 1RU9H 3Q0HA 4OZFB 5LWYH 4ONHB 3IJYA 1RZJL 4X4MA 5DJ2A 5LAXA 5HYJA 3HRZB 1K6QL 3PQYA 3RUGB 4JFDE 1MJ8L 3RTQB 1C08A 4NNYA 2R0ZL 4WO4D 4Z76A 4U3CA 3IGAA 4G8FA 1WFUA 5CSZA 2Z92A 4KQ4H 4PR5B 4X6FB 1UZ8A 5EIQA 5ITBL 1T20B 4HWBL 3B6SB 4ODUB 4ELKB 1H8NA 1BX2B 4ZFGL 2DQDL 5ISZA 2GT9B 3IU4L 5EC2A 2UUDH 4PGBA 3CX2A 4XCNB 2R2HB 1I1AC 3U0TA 4OZIE 1DQLH 5C6PB 3LD8B 4Y4KD 1TENA 1JNJA 4WW1B 1WZ1L 3NN8B 1H3PL 4F33A 3BD5A 1MJ8H 4FQPA 2VLJA 4Y4FC 1E4WL 4QWWD 3RPIB 1BPVA 5I74C 3LQZA 2D2OA 4JRXA 3L9RA 3FT4A 2X89A 3G6DL 5J11B 2HLFD 2PO6D 1EJOL 3TA3D 4MXVF 1A4JA 3O3DB 2Y5TA 5HDQL 5F7EL 4NZDA 3PWVB 1Y18B 1NGYB 4JGJA 1KXVC 4W81A 5FCUL 4WGVB 3CXHK 5J7CC 1WT5C 1U8MB 2P8LA 3D85B 3TO2B 3NFNA 1FNHA 3LY6A 4PJCB 5DD6B 1TITA 4BFEA 1CFVL 2H3NB 5F1SA 4JN2A 3G5ZA 1SEQH 3DUUB 2X70A 4YH6A 2X7LA 4IIQA 4ZXBD 4I18B 3RJQB 1EZVX 2WW8A 1BQHG 3ME0A 1EMTH 3U4EB 5F89B 2OZ4A 2LTQB 4MQXD 2OM5A 1UKSA 2D7MA 4RMTA 1JGVL 2HRPL 2EIZB 1FORH 2DICA 3SKOB 3QRFM 3CNKA 3C60D 5ESQA 3QA3B 4OLUL 3FQNA 1QYGL 3I6KB 4GUPB 4OCYL 4R2GC 2ID5A 1QLRB 5IVOA 1A7OL 5IHZA 4N90D 2XT1B 3TYGH 5MI0C 2CK2A 5IWLC 1MCHA 1BZ9A 4PJDB 3QXAB 5D5MA 2A6DB 3UTZB 4V1DB 3T4YB 5E9DA 3AM8A 2JELH 1GAFL 5J6HB 3DROA 4U2ZA 4KUCD 3RL1A 3FCTB 1BEYH 4UT7H 3W9EA 5FEBA 4LP5A 5EO9B 1JRHH 1OPGH 3TIDA 1A9BA 3H9SE 3QEQB 1A6PA 4R7NB 4EZMA 3G04A 4TSBH 4HF5H 4HV8A 5GZNC 2DJ4A 3HZMB 3L7FA 5JLZA 4F9PC 1I1CA 3DX9A 1X5JA 2WIIA 4DCQB 1RZGB 5BJTB 4WW2A 4ISVA 4RMQA 3NCBB 2VC2H 3H9SD 4RDQF 4G7VL 4N0FA 3BE1H 4IRSA 2B8OT 1K5NB 3NCCB 1KOAA 4Z18A 4KK8D 1GXEA 4OFKA 1XIWB 3TP4A 1KJ2L 3CSYB 1EV2E 1JRHI 3QDJE 3B2VH 2NY6C 1Z9OA 2H45A 3KPMA 4HKBA 4LCYA 4PBWD 5KS9B 3IVKB 5IMLB 2Y23A 1ERNA 1U2CA 3IKCB 1QHPA 3OHXB 2A0LD 3HC4H 8FABB 1DDHB 2JCCB 1ZGLA 4M5YL 2FEEI 3HZKB 4X7EC 1PJ9A 1P7QD 2XWTA 2OLDA 4G7YL 2HT4D 4I9WE 5DUBA 5F1OB 3FONB 5KANI 5DHVA 3FB6B 4OBRA 3G5YB 4X9IA 3VU2A 2DM7A 4HX1A 1WJ3A 2VR9A 4MVBC 3WDIA 5HY9A 4P99A 5BW7A 1P4BL 1D5ZA 5GGSB 4H20H 3QFJD 3VXNA 1X6NA 3WJLC 4B50A 1MWAB 5IVZA 3ROOA 3NFPB 1QVOA 1KEGL 1UJTA 4LF3B 1NMBL 1Q94A 3DUSA 3L1OL 1MJUH 3L5XH 4ZNCD 3ILQC 3TNNA 2Z93B 3H9ZA 1JGLH 4Y88A 1A4KA 3DNKA 5JUEH 2VL5A 3WDHA 2P48B 5KVEL 2WIMA 5MEPB 4J3OC 4I77L 1IL1B 2NY5L 4X80H 2OP4H 1A7QL 4TN9A 5JNYB 3FO9B 1NMCC 4K3DH 5E8DL 5CP7A 1MF2L 3KPNB 2BP3A 3KYKH 5CCKH 5DJ2B 4K7PY 1OGAE 4WEMB 4QT5A 3QI9A 5GSRB 3U82B 3LZFH 5FYKU 4G6AC 2VL4A 2IPKB 4UOJA 1P7HL 5BV7L 4NJ9L 5BXFB 1YNKL 3RQ3A 2QKIB 3GNMH 2V7HB 3B9KD 2VH5H 1ORQA 2GT9A 4M93B 1D5MB 3TBTA 1PBYA 1EFXD 5IUSA 1XF3B 4CAGA 1KJVB 1BM3L 1IEHA 1INDH 4KUCF 4PS4H 1SM3L 2B0SH 5E8DH 2VC2L 4I0PC 2VISA 4QHKJ 3QG7L 5EBMB 4Q6IA 2YN5A 5D1XB 5EZJB 3RL2B 1NUGA 3EOTL 3FO1B 3KNBB 4UILH 1Z9MA 3FMGL 3KXFA 4NQXA 1GOHA 3AS1A 1PEZA 3VI3F 1JV5A 3BWAA 3LV3B 1OL0A 2ICWJ 2YKLL 3V7AE 2ICWB 3L3DA 3ZDZE 3GZKA 4LVEA 4PJ8A 5FYLH 2DQUL 2ICCA 3MYJA 4Z7OF 2BNRB 1BMGA 3GSNA 5ICYB 4FQ1H 4KK5D 3VXQB 2IC2A 2ZOLA 5IB3A 2NW2B 2ZKHL 2GI7A 2N4IA 5EOTA 3LD8C 4ODHH 4S10A 2IQAA 1YECH 5EBWB 3P3YA 5ACZB 4I18C 4Z5RB 3D85D 2PYEA 4PRAB 2YRLA 3MGOA 2A1WL 4JKWA 2VR5A 3MRCA 4N8CH 5E8NA 4PBVC 5IB2B 1NANH 5D2LA 4LVOC 3V5KA 1GGBH 3K80A 3BX7C 3MNWB 1NBYB 4ONFH 4IRJC 5I8EB 4KH2A 4AEIH 4PJ8D 3VXPA 4HMEA 1XF2A 3SKNA 1H3UA 2BNRD 1FIGH 5EOQH 4JPWH 1JE6A 2DBLH 2PYFA 5JPMA 1YUHA 2B7DT 5FF6B 3V6FB 2DD8L 2NLJB 1LO3L 4X5WA 2ADGB 5ILTL 1RHHA 2ICEB 1BD2D 3KLSA 2I60L 5F96H 2HT4C 5CKGA 1A9BB 2GTWA 4KMTH 1YEFH 2IBZY 4QXWA 4JQVA 2VUOA 4YHYC 5SWSE 3U2SB 4IOFC 2VYRE 1AD9B 3N9GH 1LD9A 3DX9B 3MLYL 3HZVA 4E0RB 1E4JA 4OT1L 3UC0H 4LCWA 3OR7B 1NUDA 1OQXA 2NY4C 3QHTC 3GKWH 1HCVA 2JCCF 2DLTA 4HWEH 2MHAB 1LNUB 2YN3A 4KK6D 4HFUH 4IRSB 3C9NB 4FQXB 3STLB 4JFEA 4JANB 5EZIH 2G5BA 3MUY1 4POYA 4D8PB 4CW1B 5SV4A 2BMKB 3S4SA 1U92A 2VLLA 1YMMA 4FG6C 1QLEH 4QRTA 4O58H 1FG9C 5C09B 4Y4HA 2DMKA 5J13C 4OFIA 4L3EE 1G7IA 1CGWA 2BX5A 4PD4K 3P73A 4ZUTA 4FQ2L 4OZGE 5DDHB 1OT2A 5E2TL 3OF6D 4TNVF 2B1AH 3BJ91 4FQLL 3E3QE 4EXKA 1OGAA 2EH8L 3MACH 4RMUA 1IGJA 1LO4H 1KUMA 3E6HB 3REWB 4ONHA 4D0BA 4ERSH 5J1TC 4HX1B 5ACMA 3VGAB 1H3WM 3G08B 1E6OL 4EI5A 5F9JA 3R8QA 5KSBA 2O93L 2JK5B 3NIGE 4LIQE 2I9LA 4RIRA 2BC4B 1IMHC 3U1SH 2H2PC 3HNVL 3LPFA 4WRLA 2VLRB 3ELAT 2LU4A 1BBJB 5I76B 5KSAB 2H2PD 3C5JA 1M1SA 2Q7NA 4WUKH 1KGCD 2F54D 4I3GA 1KIQB 2AXGB 3KWWA 3BMWA 4EUPA 1FG2A 4U3XA 3TCLB 5EULV 4I0PA 5JXED 3JV6B 5I66B 5F7UA 4ZFOB 5C0BA 4F2MA 2AJXL 4L3EB 4ODXA 3V0VA 5KN5A 1PSKL 4OLXH 4UB0H 4YAQA 2VDKL 2YR3A 4X9HA 4XP9H 3BDYL 2WUCH 4UUJB 2F53B 5C0CE 1NC2A 1R3HA 4M7ZB 3QEQD 1LO3H 1IC7L 2XWBB 1IQWL 1LO5B 3O3EB 1WWCA 5F9AC 3B83A 3DSFL 1C7TA 4L4JA 5BVJA 3ZYZA 4U1JA 1IAOA 2ZSVB 4JZOA 2H32H 2FIRT 2XOTA 4R7DA 1KT2B 3WL9B 3V4UH 2UWEE 1QNZL 2EXWD 1OTUC 2DJUA 4XB8A 5T3ZD 1YJDH 5A3ID 2AQ1A 2F54A 3FT2A 3OB8A 3TBVB 5C70A 4MJIA 3LN4A 3UDWA 4L4VD 3QO0A 2FGWL 4KXZH 4TVPD 3QCUH 4B41A 2Y6SD 1UCBH 1FVDB 1IEBA 3U30B 4QRPB 1BJ8A 4MCZA 4BZ2L 3E2HC 4M00A 5T3ZH 3F7VA 5E95B 4FMFA 4XVSL 2W0LA 1OSPL 3X3GL 4FZEH 5IJKA 1NUFA 3MPCA 3ZKXB 5EZJA 1R3LA 1BFSA 3QDME 5FOJA 3RIFK 3QQ4A 3SGDH 3WXVH 4ACPA 4XVTL 1R0AH 3NIFE 3FQTA 3NCJH 5F1IB 1PQZA 3MRGA 4F37F 5FOBB 5HI5D 3GUTA 1EAJA 3BAEL 2AQ2A 3MZGB 5CJQH 4C56E 2PTUA 3NBNA 1HHIA 2QSCH 3BXNB 5DMIH 4ZYKA 1YN7A 1CGXA 1JZ8A 5MI0B 5DMGC 5TFSL 4HPYL 4V1DA 2GK2A 4IBLT 3VFWA 1OSPH 3VGAC 1MQKL 1OAUH 4D3CH 1M05B 3VD4A 1JYNA 3DROB 1FBIL 5IQ9B 4R0LA 4JDTH 3IAGC 4RGNE 2WLYA 4XMKH 3TIDB 4RCAA 4WCYL 3OX8A 4YGVB 5EO0A 3HN3A 1UVQB 3RIFF 5A2KH 4LSTL 3MO1B 2MQCA 5GGSY 4N0CC 1A6UL 1ZGLM 2NY5C 1XZ0B 3MUHL 2P4AB 3MODH 5L0QB 2ADFL 1DBKH 1MRFL 3OJMB 4POZC 2IFFH 2J8OA 1JGDA 1OTTC 1XH3A 2L0DA 1UFUA 4M7KL 4P2QA 5I9QB 2VRAA 4RGND 1ZLWK 4OGAC 4KTEH 3M1BB 1E6JL 4Q9QH 1DQJA 5HGDB 3MRKA 2DB8A 4QXUL 5F1NA 1AKJB 4DKFH 3LSOB 4YDJB 1CIDA 2LVEA 2CJUL 4JO3L 1KB9J 35C8H 1GRWA 1C5DA 3EJJX 5DK3A 4BSVA 4RX4A 5K9OB 4F15C 5KS9E 3RZCB 3MLPA 2J88L 5C0FB 4Y4KB 4G6FB 3RWHB 5MERA 4LCCA 4PJ9A 3PWLA 3ULVE 2V5YA 3RKDC 3UAJC 3LHPH 1HSBB 3VMOA 4LAQL 5CEYA 5J3HD 3HAEG 3VMPA 1JMXA 4JPIA 1EIBA 4EKXA 4MQTB 3EYOA 4HUXA 2B20A 3X12B 4HAFA 3W9DB 2EDDA 1DBJH 4Y5XA 3VH8G 1N3NA 2EZ0C 4E9LA 1NSNH 2XA3A 3TPKA 3MRQB 3RWIB 5HYFA 4U6VH 4LAQH 5F7KC 3S98A 2EDQA 3VW3L 1ZT7B 3STLA 4A6YA 5EN2A 3P4OA 1GGCL 3U0PA 3MXWL 3MFGB 1J88A 1EEZB 4JCLA 3EJYC 4HDIB 1F97A 1F00I 5FYJL 4F57L 1A6TA 3W39A 3P4MB 3OXRB 5E8EA 4KRNA 3A67L 5DO2C 4HS8H 2GJZA 5JORB 4L9LC 1NQBA 5KZCB 2VAAB 4QHUA 2DF3A 5DQJA 2WK2A 1NJ9B 4R4ND 3QYCA 2DDQL 2BNQB 5D6CA 4BZ1H 4R4BB 1D5IH 3CK0L 3KYKL 3O8XD 4ZS6C 5IM7A 2OXHA 2UWEB 1DANT 5TQ2L 4OLZH 3QUYC 3DX7A 1P9MA 3CMGA 1JK8B 4H1LA 4AEIL 3TYFA 1KEMH 3QI9B 5GS0C 3PP3H 5J12B 4RMRA 5EOCJ 1RIUL 4X7TB 1B90A 3MRNB 3EDFA 1VCAA 5F1KC 4HCRH 3N1MC 5IW6A 1ZLWH 5DC4B 1S5IH 1WBYB 3C60C 3HE7C 1H0DA 1NBVH 3E1F1 4G5ZH 3G9VA 1UZ8B 1ZLUK 3V9FA 4OLWH 1CFNA 3D3VD 2JB6B 4H88L 1XR9B 4Y4FA 4W4OA 2AI0L 4OSUH 4LSSL 1DBBH 3VG0H 2HLFC 2YWZA 2IALA 3U0TB 4RNRB 4AH2A 2ADJA 2WUBL 3TBSA 3OJ2C 3SY0B 3RJDA 1U8JB 4WWKB 2X1PA 5D1XA 3WIFA 4G3YL 3HB3C 4UV7L 3NN8A 1N6QL 4OCYH 4LLDB 3VFMB 4LRNH 4EVNB 1FFNB 2ATKA 3OXSB 2Y07H 2MKLC 1U3JA 3LAFA 4WDIA 4AL8H 1RUPL 1U8PA 4DW2H 2CH8A 3FO2A 3V8CA 1TJGH 3VFSA 4G5ZL 1N59A 1A6ZA 5HGBB 3UBXG 3O6ML 1L9MA 4PRBA 3ESVF 4JZOB 1EPFA 4JRXD 3K0WA 1DE4B 2PCPB 3EO0A 1OAZL 3MNVB 2YA1A 4D0CA 5HPMA 1AKJD 4XMPH 1I1YA 3EBAA 3GB7A 1IM3A 1B2WH 1M71B 2O5YH 3C5ZD 5I8CB 5K59F 4PRDA 1NANI 3O2WH 4IJ3B 3PXHA 3W0WE 1XEDA 1MQ8A 3C87A 1AFVL 2I5YL 5JOPD 5IVXF 4PRID 4V2CB 1K3IA 1HXMB 4LSPH 3TZVB 4P49A 1CZ8H 4OQ1A 2EXYD 3NIDE 3SBWC 3JTSB 3S88L 2HJLB 4WI5A 3AY4C 3B9EA 3F7YB 1XGRB 3LZFL 5K33A 5MP6H 3W0WD 3O6FA 1DLFL 5DA0B 4ELMB 4J4PC 5I1CL 2UZIL 4U49A 1RJYA 2J1KA 1T7XA 1J0JA 4G42A 5CZVH 5IR1A 4XRCA 4FABL 3QXAA 4ZOBA 3QUZD 2FX9H 4RQQB 4GMSL 3G6AA 2FZ3B 5DZLA 1KPUB 2ZUWA 3QIBD 2NLJA 4PP2B 5FM5O 4O4YL 2B0SL 2EYTA 3CZJA 1GCFA 1RQ5A 3QUKB 5F96L 4EN3C 1A1NA 1BF2A 3L3GB 1S3KH 4LGPB 5D1ZA 4OKVB 4UTAL 3K4AA 4CNIB 4PB9H 2VXQL 4U6HB 4IRZH 3CXDL 4AEHH 3VXRA 1MSPA 4LHQB 1CICA 1D6VL 3CFKA 3UPCA 4HH8A 3MRLA 3MR9B 1QKZH 3TH4T 2F58H 1AGDB 3G6JF 3MV8B 3VXMD 4FXLA 2Y06L 2XA8L 1K6QH 3QUZB 3RY6A 1CDCA 4HFWA 1QFWM 2ITDB 4JO2H 3V6ZB 3LKSA 3BKCL 3CZFA 1S9YA 5AYQA 3TO4C 3IDGB 4O58L 2G60H 4PIRF 5ESVB 2GQHA 4FFWC 3WO3B 3QUZC 5JHDA 3TN0B 3BPCB 3MOAH 1G7MB 1NAMA 2DKUA 4OZGF 4HEPG 4EN3D 1AI1L 5K9QI 1F3RB 3QDGE 1GL4B 1BJ1H 1I85A 1RUKL 2WBKA 2WBJA 1ETZB 4OZHE 3P0VH 1NCWL 4AIZB 4RDQG 4HJGA 1CE6B 1IEAA 2XFXB 4F7TA 3F6LA 4I2XA 2OJEA 5KVDL 5MENB 3SDDB 5EU6A 3D87B 2R23A 4NOBA 3BESR 2ZNXA 5FHBL 1JJUA 2EEBA 3B2UD 3U83A 2E7LC 4YDLB 3MLVL 2V2XA 5IVZB 4HWZA 4X83A 5CWSB 5IF0A 3CVHB 4I3SH 3DHJA 2B1HL 3FZUC 3GK8H 5IOPB 4JB9L 3OXRA 3RBGA 3GMOA 5J3HC 2X4PB 3TJHD 4DTGH 5FFLA 4EDWH 5EFIB 3RA7H 3CCHA 1JMZA 2Z93A 1WQVT 4NCC1 2F9BT 3PL6C 2Y9RT 4MNHB 1J87A 2IH3B 4B0MM 5JDSB 3BAEH 4GG6A 4BSWA 4DVBA 4BH8B 3GGWA 5LBSH 1X5HA 5E9DB 5T3XH 2CD0A 2BOBA 1WIOA 3NTCL 5JNYA 1ACYH 2HLAB 4NQCB 3FQWA 1ZVSA 3BPLB 4GH7B 1SJHA 1FORL 4MXQD 3VXRD 1UM4H 3MMEA 5JOFB 3FB8B 2LFGA 3GJEB 4IDJH 4PYGA 3GMQA 3DURB 2D3VA 4XNMA 2BVOA 3PV6A 4K8RC 3ZKXC 2GY7B 4JFXB 1FE8L 2GUOB 2YC1B 1LP9F 2LVCA 4LNVA 4PLJC 3VA2C 4QOKE 3HR5A 4I3SL 1HH9A 3C6SB 1QTYT 3RKPA 1SVZA 1XF3A 4I8DA 4QF1A 2VLMD 2NY6B 4TPRH 5GS0D 5A40E 3QB7C 2BY1A 4ZDHB 3ZT5A 5J06A 2OTWA 3J7HA 3RY4A 3H3PL 4P3WA 5DHXB 4RAVB 5C08B 2YPLE 1UWXH 1T7WA 3ULVF 4OM1H 5KS9A 1KB5H 5F1IA 3FRPA 3HNVH 4ETQA 3ARTA 4Y7MA 4ZUWB 4U6VL 2QADB 1MNUH 1W0WA 3IXTB 4TOYL 3BWAB 3LV3A 4X6DE 3T0XA 1CU4L 1YN7B 4G8GB 4NN7C 3QEUB 2YPVL 4OBSA 4HUVA 5LGJA 3JWOH 3IU3B 1BBDH 2DN7A 1NCAH 3CSBA 4GW1A 1ZANL 4KTDL 1IAKB 2YMXH 3DGGA 2P43B 1M7DA 5BCAA 5D8JL 4JM2A 4LDEB 4PRPE 4ETYA 3NCYP 2NY4B 2AK4B 2F8VA 4OB5L 5ACZA 1SVCP 1QFUL 5GZOD 1KCVH 3ZDZF 1IJ9A 2P49B 1KG0A 2AJ3B 4P2OD 4KRLB 3C60A 1HE7A 2FRGP 1IZJA 4PLOB 1EDQA 4NO0B 5FM5M 4I48A 4PJEF 4NQSB 2C3WA 4HUNB 4DKFL 4R9HA 5F3HB 5B3JE 4KY1H 5I73B 2PXYA 3CH1B 1HQRB 5CFHA 1BWMA 5BOPA 2VZOA 3LH2H 5DMKA 3MX0A 4Z9KB 2R0LH 3LKPA 3DJ9A 3ARZA 5B4MC 4LCCB 3FKUS 1ZAGA 4MXWL 4UDUA 3NIFF 3M8OH 2NY4D 3ARBD 3MV8E 4LSSH 4P57B 4YDIH 4ESKA 2H8PA 3C6LA 1RHHB 2ICEA 3LS5L 1DANU 4AT6B 4L29B 4XNUH 4XBEL 2RHEA 4DTGL 4K8RH 3UXFA 1EUUA 3D2UD 3IDXL 3NH7H 3QJFB 4TSBL 4QLRA 4G3YH 4P2RD 3RNQB 1RURL 3HUJF 1HEZA 2DI7A 3ZE0E 1CICB 1Q8MA 4TNWF 3KYAA 2X42A 3CXHJ 1GGIH 3BP5B 5C0AA 1MCKA 1GOGA 3M8OL 1D6EA 1N64L 4XP1L 1W8OA 4XBEH 5DS8A 1V05A 2YUWA 1OHQA 1C5BH 1PYWB 3TZVC 1MHPL 3HFMH 5IHLB 1JHTA 1A6TB 4KAQH 2X4NA 3G5VA 4P0DA 1YNKH 5D7JB 1U2HA 3GEWB 1MFCL 1QLFA 4ZD3L 1DQDL 5DF0A 2NNAB 4Y5YC 1RZ8B 2AJVL 2APXA 5I1DA 3UZEA 1HNGA 4M8QB 4Z0XA 1D5IL 4OF8A 3C5ZB 4JFFE 2N7BA 2AGJH 3MYJB 3FTGB 2I25N 4KUZL 3PL6A 4I3RH 1SJEA 4OLZL 3GMRB 2PNDA 5HHXH 3LN5A 1P7KA 1HNFA 4M7LT 1AE6H 2BHZA 2HMID 3NIDF 2XQYG 4GS7C 4BQ9A 4ZO6A 4JFOB 3WIIL 1T1XA 3MGTB 1T89A 4PREA 2VDQH 3SOBL 2R23B 4YBHA 1ADQH 2IPUG 4KWUA 3TYGL 1AQKH 1U42A 5C0ND 1S9WA 2R4RH 1S9VA 2B4CC 2YUVA 3QIWA 1GGTA 4HWZB 1QRND 4H5SA 4XXDB 3UBXI 3QIUD 2R56H 4WU7A 5BZDB 3TN0C 5IW3A 32C2A 1T7YA 2C3XA 4C83B 5AAWA 4J1UB 3RZCC 1I1AD 1RK0B 5GGTH 2X4PA 3O0RL 1C16B 2AXHA 3PWUB 1NCTA 5FYLL 4UT9L 4NHCH 3UROR 1CLOH 1Q9WB 1ZHBB 3E8UH 3FQXB 4AK1A 1DBJL 5C86A 1S7WA 4U6XB 4FQHB 3T8XA 1RIUH 3THML 3LKQA 3H9YA 1EVTC 1TVHA 2WNGA 2YRZA 3SHSA 4JFQA 5EU5B 2HLAA 1NLDH 1RD6A 3EFFB 3RDTC 1PVHA 5LAXB 2C3VA 3WFBH 5IHBA 1LO5A 2E9JA 3SE3C 1MHHA 1A2YA 1RZIA 2EDHA 3VE0A 5F3BA 3DVNA 5C07B 3EYQD 4OGYL 1KT2A 3LN9A 4YR6B 2YD5A 1ZA3B 1S9XB 1NCCH 2Q7YA 4I2XE 4FTVE 1R3KA 1BJ1J 4R96A 4Z7UE 4F8TA 1BAFH 3EO1A 2Z31C 5ELIA 3S5LG 4L8DB 3EDJA 2AV1B 4PJFF 1OGAD 4KXZI 2X4UA 1JPSL 1NGZA 4NC0B 4HXBL 4PGBB 3F7PC 5LXGH 4R6UA 4DGYL 4XVUD 2JCCE 1S7TB 4GSDH 5IMKA 3WNPA 5ALBH 1K2DB 5E6IC 3U4AA 2RAMA 4YHKL 2APWA 4NKMB 5ID0A 2CXKA 1VEOA 4PY7A 4U31A 5BV7B 2BJMH 1A7NL 4PV9B 4ODTL 3SQOH 4FXGB 3T2NL 4Q58C 4MA8H 2BVTA 3NABH 3L9RB 1MFDL 1IKFH 4QNPF 3SDCC 4FABH 4U0RB 3ARFD 3FO0L 1ND0A 3RI5K 1H8OA 1UH2A 3U30C 4GAYA 2YD6A 3MLTA 2YD2A 3MJ7B 3T65B 3V6OE 3I85A 3IDJA 4J4PA 1UGNA 3CLFH 3HMWH 4RGNC 2D9CA 3MOBL 1MCIA 3BJLA 2MPAL 3OKLB 3KYOA 3H7BB 2V5SA 1T7ZA 2PW2B 3D0LA 4TTDD 3TT1H 4U6YB 1DLFH 2HTKD 3RPKA 1EHXA 5FUCE 3MXVH 1IGFH 4XAWL 5ALCH 4NRZB 5FUZH 5AEAA 4QHNB 3ALWA 4XPGH 5AZEL 1MY7A 1BBJA 1D5BB 2NXYB 4ZPTA 2Y36L 3QZWA 2F19H 5A16B 1EO8H 2OR9L 3OF6A 3O41A 2AJZA 1K8IA 3I6GB 3MLRL 2ZCLH 2AEPH 5I30L 4S11A 4OV5A 3BZ4A 1F4YH 3JV6A 4HIJB 1RIVL 1YQVH 4MA1B 3OKMB 4NT6B 4YK4B 3D9AL 3EGSA 3QUXA 2F53A 2OI9C 5DZOA 3V79C 2Z4QA 2DLHA 4KGLA 1IAMA 3WNNA 4LMQE 4MA1C 4Z7QF 1G7LA 5HYSG 3WFEH 4U0QB 2ED7A 1PG7L 4L1HA 3WFHB 3ZE0F 3ZHDA 1GGYA 1QACA 4Y4HC 1JF1A 2FYYA 3RGVC 5IFAL 2LQRA 5L88H 4X9FA 4P5MA 3GFUA 3LRHA 4P2OC 4DUXA 3MV8D 5JMOC 2WBJC 1YEDA 5I6XB 4J3VA 5E2WL 1MWAL 4JDZA 4PJ7A 2VN4A 4LLUB 1DQML 2BCKA 1FVDA 1TTGA 4NUGH 4WW2B 2ZPKH 3RDTA 1INQB 1DSFL 3IJHB 4GLRI 1AGBA 3HPLB 1KTLA 1CLZL 2QSQA 5CEXA 3O3BB 4GMSH 1WC7B 4KJYB 2V9QA 1CL7L 5B4MD 1TCMA 4O4YH 1KCSH 5JZ7D 1UB6A 4R4FL 3VRJA 3RWEB 5E8EB 3V2AR 4LDOB 4AQOA 4FG6D 5KVDH 4P5KB 1L6XA 1FNGA 3IDIB 4NM4H 2FGWH 5JDSA 2H2SC 3Q1SL 4MJ5B 4Z0XB 1JTPA 1BQSA 1KIRA 1OM3H 2APTA 1NJ9A 3PJSB 5LKNA 1QKZL 4M61A 1WAAF 2NY3C 2B4CL 4PBXA 4C4KT 1QFPA 4JY6B 2ENYA 1L6ZA 5IQ7H 4YPJA 2QQKH 3IJYB 2LAAA 2BRRH 2NY1C 4L3ED 5CZKA 5TE4L 3O8XA 1SJHB 4YGVA 4BKLA 2O5YL 4PREB 4FTVA 3A6CL 5AD0A 4WI3A 1EFQA 1H5BB 1KELL 4RA0C 2ICES 2X44D 3PV6B 4PR5A 4X6FA 1H0DB 2FBJH 3CFCH 1T20A 2NR6D 5HPOA 5CS7A 5DJZB 4QGYA 4M3JA 4NZRH 4ZSOB 2E9WA 4OF3A 3QNXA 1DN0A 4Y1AA 4PJAB 1HDMB 3K1DA 2RJMA 3L7EB 4O2FB 5JXAL 1WBZB 4Y5XC 5HHPA 5TF1H 5IEKA 1O7SA 1C12A 2ZUSA 5L7XL 4L8CB 1BQHB 2XWJB 5K9OA 1MELA 1OWWA 2OSLB 2H32A 3ARQA 3EYUH 5ECJE 1CFTB 4OT1H 3GI8H 4WY7H 2CIIA 3RPIA 3IVKA 3HE7B 3L5JA 3D0VA 2X05A 3BPNB 8FABA 4HBCH 1MNUL 4Q9CA 3QQNA 2NZ9C 1UYWL 3IF1B 3FFCB 1IC4H 3HZKA 4JRYE 2XKSA 1F4HA 3DVNB 5GS2D 5E8OA 2NTFA 3QEUA 3LMJH 5IW1B 2VR4A 1EEYB 4OKDA 1S7SB 4HBQA 4P59L 3ESUF 3LKNB 4XZUA 1R3JB 1R3KB 1CDHA 1MAJA 3DGGB 3JXAA 3O4OC 4MCYA 4RMWA 1EGJA 1MIEL 1RPQA 4XH2B 2CJUH 4JO3H 4HWBH 4PRIB 4XPBL 1FQ9C 1II4E 2R0KH 3L3KB 1J8HB 1UA6L 4S1SH 1U8NA 4LPXA 4I5BA 1E6JH 4PRHE 5H37H 1QVOB 4M7LL 4KI5E 3U46B 1NCAL 2VDML 5E4EC 5E0QA 5EO1A 3EFDL 2HKHL 1KPRB 1PX4A 1EH9A 1H3VA 1GSMA 2FIKB 3KYMA 3R1GH 2E6PA 1WAAE 3GSQB 1SBBA 2WP3T 2X4TA 2BVEA 3K81A 2CXGA 4XP9L 3UTOA 4G42B 1YEJL 2JB5H 1CLZH 3CX5J 3I3DA 4WIQA 4GRLA 4YIQB 1FSKC 2EKJA 4WHYH 2FHFA 1D9KA 2ZUUA 2CRIA 1MRCL 1U95A 3KYOB 1U8KA 4AT6A 1NCDH 4KMQA 4K8RL 3QJFA 4OTXL 4QHNA 4LQ1A 5BXFA 2LU7A 2QJDA 5MHSD 3VXMB 2Z31A 3IDMA 5FGBC 4X6BB 3ZTNL 3WJLA 3KHQA 5JDJA 2UY7A 1D5MA 3TBTB 3WD5L 4U7SA 1KYOK 4ZS7L 1HQ4B 2OTUB 5T1LD 1NDGB 4C59B 4MNQA 1A1OB 3UDWC 2DM3A 4E41E 4YWGL 3TH3T 2HFFB 2IMMA 3JBG7 1NDMA 4IOIA 1JFQL 4LU5H 4MHHG 2IF7A 3LKSB 2YOCA 35C8L 3FOLA 5F9WC 4CJ0A 4KKNA 1D9KC 1JHTB 1FFPA 3VFRB 1FFNA 1S5IL 3RX5A 3PGDB 2NYYD 2P8PB 5K9JL 1J86A 4XP4L 2PN5A 4TTDC 5CUSL 3VFSB 2GITB 3U4BH 1BQLH 1T03L 3DMMD 3VWKD 1ZS8B 4HK0B 4M7KH 3Q2CA 3VDAA 4Z77B 4XAKD 1E4XI 1J8KA 1NFDA 5C0JA 1A8JH 1G6RA 4ZOCA 4D0CB 4Z7VA 1BD2E 1I9JL 4YFEA 3H9SB 3BIKA 3K8LA 1FVEA 4TSAH 2AERT 3CFEA 2ESVD 2DQEH 4NQDD 5HY9B 2DQHL 5SX4H 2UYLB 2A6KB 1YEHH 3IS0X 3U7YL 2SEBB 3GIVB 1XCQA 3MGOB 4JQIH 3HAEH 4PJHF 5DURD 1Q0YH 3I50L 1A9EA 3LMJL 5GGTL 4NCC2 5D2LB 3V5KB 4L3CA 3GSOA 3NA9L 1MCOH 2R1WB 2MPAH 4DZ8B 4NQDE 1M6OB 2KBGA 5C09A 3RWEA 3HI1A 2WSKA 4ODTH 3X13A 5KW9L 2A77L 1FL3B 1ITCA 4JZNA 2C3HA 3MROB 4YHNA 5C0BE 3VFVA 3H42H 1OTSC 4O51A 1I3GL 4MJ5A 5GXBB 4NO2A 4CN6A 3I75B 3KPSD 2BDNL 3L3HB 4IMLB 4MAYB 5EIIB 2BFVL 4YBQC 5IBLC 3BH8A 4WU5A 3WKML 3EFFA 4KQ3H 3WXWL 1T3FB 3KPRA 5FKAA 1A47A 5GHWL 2AGJL 4A2LA 4LSPL 3I9GL 1BLNB 1JGUL 5D7LB 2VXSH 2HWZH 2B2XH 4U1KB 1CVSC 4G43A 1ZLSH 3VFUA 4LCUA 4EUPH 2AJVH 5T1KB 1G6VK 5EH1A 3TJEH 3LKRB 3S3SA 4XC3H 4JPKL 2W92A 3RNKA 4DN3L 1FFQA 2JTDA 1ZGLP 4LCWB 3QFDB 4ELKA 4TULH 4LIQL 1LE5B 3ZKMC 5ERWB 1WLHA 4O2FA 3CDFA 5ENWB 4F9LC 4G80A 4Z95H 3KPSA 1MLCB 3QUZA 1KJMB 4JVWA 2UVFA 1DBMH 5IJVB 3B9VA 1QA9B 4CN4A 1ONQB 4PY7B 5MEND 3QRGL 4ODXB 3V0VB 1KGCE 3BZDA 5E5UB 1PY4A 3LEXA 4LMQI 5CZVL 3O6LH 1YQ2A 2XWBA 4PLKD 3ULSA 5D7JD 1GHFH 2A9NH 2L7JA 3NFSH 2V5RA 2VE6A 3T77A 1TZHA 5ILTH 1S8DB 2DAVA 2WBJB 2VSCA 3QEQE 1I7UA 1FYHB 1MLBA 5I1KH 3ZDYF 1OAQL 5D7LE 4UT9H 4AJ0A 1EHLL 1QSVA 4RISH 3KXFE 2VDPL 3BSZH 1DSFH 1QP1A 4X6CA 2VLKE 4PRAA 1J1OH 2XZCL 3G5ZB 4NQCD 4ZQKA 1LK3L 1RZKC 1UENA 2BERA 3BGFC 4HLZG 2F19L 1MJJB 3BKYH 5I76A 4XNQB 3GSVB 1L7IL 3U9PL 5IQ7L 4PJ5B 3QDJD 1I8IA 2X4SB 3BEWB 2CR6A 4U3HA 5BV7C 7CGTA 5KOVC 4NM8H 2OMBA 4BJLA 3BUYA 1MAKA 2Z8WC 1BFOB 4XWOC 2VLKD 4MNHA 3DRTA 1A1MB 1G9NL 1OAQH 3QNZB 4XX1G 3TT1L 5FGCB 3JTTA 3C2AL 3SE8L 1ZV5A 1P69B 1HQRA 2YKLH 2Y07L 2PYFB 3KR3H 4XPFL 4ZSOE 5CEZL 4R4NC 1BFVL 3ARUA 1X6LA 3IETB 5D1ZD 4OZIB 4BK5A 4BSJA 2RB8A 4WI8A 3QAZC 4JKPL 1LK3H 3WXWH 4YXLL 3ZMRA 4EDWL 4GQ9H 2ADIB 3VI4E 1Z3GL 4P5MB 5HI4D 3IDYB 3WL9A 1KLGB 2NW3B 1H3PH 5H94A 4QRQB 5ISZD 2VXVH 1A22B 2GUOA 3T09A 1AD9A 4PJDE 4LEOB 4XPHH 1OAXL 4NUGL 4E0RA 1RIHL 4QY8B 5AZ2L 1IEBB 2W9EL 5IVXE 5FUOH 1KF9B 3X3FL 3SDXB 2EE6A 3KLAA 4Q9BA 3S96B 3C08L 1LNUA 3CLFL 4IOIB 3W82A 1SYSA 1YY9C 3OKOB 1K4DB 4OUUB 5FGSA 2XZZA 7FABH 2MNUA 4NDMA 4GAJH 5GGQL 4PJHB 3O4LB 4XC3L 3VFGH 1NC4B 2YEZB 3VXME 3QXWA 1P7QB 2DQTL 4FFWD 3SDCA 4K94H 2NMSA 5EUOA 3MREB 4B7IA 2ZOKB 1F58L 1G9MC 2FO1A 2AEPL 5I30H 4A2MA 1VESA 4UU9B 4DAGL 5HYSB 3VFOB 3H9SA 3X12A 2QQNH 1NGQH 3HPJA 4FFVC 4FQJL 4MDJA 1FNEB 5GZOC 1FVEB 2W07A 2LU3A 4XHJC 4YQXL 1NL0L 3I02A 3UO1L 2HN7A 3GJFA 2E7LA 4YXKH 1KB5L 4ALAL 5L2JA 5JHLH 4KDVA 1UEMA 3IFLH 5FA3A 3UJTH 1UZ6E 1DUZB 4LVHB 3V5DB 2IFFL 3ROOB 2FJGA 5I1GH 4QRSA 3SDCD 3UJJL 1RZFH 3H3PH 1A7PL 1JF6A 4JB9H 4NUJA 3T1WA 1DQLL 4YZFE 3ZKNC 5CLTA 3QHFH 3KLHD 2GJZB 1MRDH 3H3KA 4PB0L 4UZGA 1C12B 3PP3K 3SQOL 5JORA 4YDJA 3HG1D 3PNWA 4MYWB 4MXVE 4PJGF 2W9DH 4NO2B 4F2MB 2X40A 2OXGA 1JF5A 4NQUA 5DT1L 5FA4B 2FBJL 3V4PH 3BZEB 3SDDC 1FO0H 3PWLB 3S9DB 5CMAB 1BHGA 1CDGA 1NCBL 3CPLB 3W9EB 1HCFX 1S7UB 4Y19B 5M94B 3X3GH 2AKRB 1BVLB 2X9WA 3ECBB 3RY6C 3OKNB 1AO7B 2EIEA 4IDJL 3NMEA 5JLZB 4H8WH 1C5CH 3H7LA 1DL7H 4IRSC 3W9DA 2PO6B 2VITA 3L3OA 2OQJB 4R96B 1TPXC 4Y16D 3SDAD 2NXYC 5DK2B 1CFVH 3VRLF 5KVMC 4U1SA 3GDBA 1AXSA 4QRPA 4ZS7H 1UM6L 2J8UF 1KJMA 1R3IL 3V4PL 1SMOA 1V7NL 4G6KH 4LCWD 3ARED 1X44A 4RNRA 4G8EB 2WLZA 1EERB 1W8NA 4C4KO 1SJVA 1U3HA 4UI2A 5FB8B 4Q6IC 2E5EA 2GEEA 4JZJC 4LPWA 4WTZA 3KPMB 2D0FA 1JPGA 1GIGL 4IS6B 1FL6A 3TT3L 4RFEA 1SJXA 3RAJH 4H8WL 3OHXA 3WNMA 1NAKL 3HS0B 4BFIA 3PDGA 2E7CA 5MENE 4NQXB 5C0IB 5K9KA 1IC7H 1KACB 5E1AA 1KEGH 3LS5H 1YEJH 2JB5L 4N8VG 5TDOA 5IWLA 2BNQA 1RUAH 2JELL 1VEMA 1C5BL 5JO5B 1MJUL 3L5XL 4J7RA 2ZG1A 4Z7VE 1WZMA 3KJ6L 4P46C 3ISWA 4JFOA 3X14B 4ODWA 1I9IH 5L7XH 1U3HD 3VD5A 1KFAL 3N1QC 3I6LE 4OTXH 5DD3L 4U6YA 4J8RA 1SYVA 5IIEA 3EYUL 5KJRL 4Z5RA 1BF8A 3KXFD 5ITFB 5T3ZL 5CBAB 1MF2H 3UTSE 2R2BA 4HKXA 4ZMAT 1D5BA 5E9DE 1T4KB 3GSVA 1CVRA 1KPVB 3RWCA 4DK3A 1FRGL 5FYKD 4LLWA 3QQ9D 5TE6H 1E28B 1FYTB 4JN1H 5KZCD 5D71H 4KV5F 1WT5A 1CCZA 4MNQB 5I8EA 3RGVD 2F5BH 1KJ2H 2HT2C 1LEIA 3TBYA 3UO1H 2AABH 1WBXB 4XPBH 5IESH 4LLDA 4EVNA 3EGSB 3C6LD 3G6DH 3GSRB 1AGFB 4IHOB 4LLVB 1EX0A 3H0TB 4FZ8L 3CH8A 3QI9D 3MV9A 1OM3L 1NLBH 3JV5A 5DRWB 4PJ7F 5HHNA 4K9EC 1A3QA 1TDQA 1DEDA 2VABA 3ULUE 1A2YB 2JJSC 4Z77A 1XGUB 2ADIA 3QSKB 3BH9A 5EWIL 3B9KB 3W11D 4YHIA 4O5LL 2NW3A 2NXZB 4XCEA 1F90L 1QBLH 1RURH 1IGIL 1YEDB 1AHWA 1KN2H 4ZUUB 2ZNWA 3KPPB 2OBGA 5IK3B 1FDLH 1ORSA 3U7YH 4FQQB 5ISZE 1FV1A 3A6BH 4J4PD 3RVVD 4NZRL 5CBEA 1GC1L 1LP9B 1U8OA 5I2IA 1NMBH 3C9NA 2YD7A 1CZ8L 1IAIH 1BBDL 3DX6A 4P23A 3DMMB 3B9DA 3EHBC 3IDGA 4QEGA 5IG7B 4MB5A 4C57C 3RWGB 1MY5A 4PV9A 1ADQA 1WFOA 1MFNA 1MAML 2G2RA 4GW5B 4ZAKD 2XZQL 3TN0A 4OGXH 2EXWC 2VDQL 4HMDA 1LEGA 1N0LA 4OZFG 4HXBH 2CSPA 3P73B 4X6CE 4XP4H 3OKDB 4U1MA 5DR5H 5IFHL 4TUOA 4F37K 2DM4A 4Y19E 3ARSA 3L5IA 3OKEB 5F70A 1AJ7H 4PJGB 5D2NA 5I8KL 3VD3A 3VGDA 2V2TB 3O45B 2AJYH 5MEQB 1VGKA 4NM8L 2VMFA 4HF5L 1JK8A 2PYED 2VDOH 1VB9A 3PP4L 3LRSA 4N0YH 3C2AH 1OT1A 3SE8H 2XY2A 5ESAB 2X10A 1C1EL 1WISA 1DUYA 4U6HA 3QNYB 4Q9RH 3C2SA 4JFFD 2GCYA 1V8HA 3MNZB 4J12A 3L3JA 1Z5LB 5D5ME 2D7NA 1AJ7L 3F7RA 1NEZG 3MV8A 1RZJC 4Y1AB 2XN9D 5HHQB 4YGAB 4AM0A 3JWOC 2V7NA 1IARB 3WUWA 4LVNC 1YJDC 3MFFA 3TA3C 1CE1L 4RGNB 5I66A 1A6VH 1QRNE 2GAZB 3SE4C 4NO5A 1X5FA 1TLKA 5E24E 4M4PA 5AG8A 4ENED 5HVHC 1UJ3C 3TFKD 5B3NA 5FF6A 2OR7A 3RVUC 2ADGA 4PJXE 4QOKA 4LIQH 4JFFA 1OVZA 3MOQA 4F7CB 3CDGA 3LB6C 5DJAA 5E5MA 4HQQL 2A74B 2NY0C 1R6VA 5GGUB 5EOCL 3CFBB 3U2SA 3GMQB 4ORZC 1A7NH 3QCVL 2ZUTA 4X8JB 5FHAL 1I1YB 3DGCR 5SX5H 4D9QE 3WS6C 4IMKA 5INDB 5I8CA 4I2XB 5J1AA 1AGBB 2DLEA 1IGML 2Y5EA 4XHJD 5FECB 4L1DA 2D0GA 2FX7L 2OP4L 3GRWA 4UOW0 2H1PH 4LSVL 2BVPA 2V9TA 3LHPL 3OAZK 3QT2A 2BDNH 4XTRC 3MRHB 4QOKD 3CVHA 3WFEL 2F8XC 1EGJH 4CMMA 3NGBC 3R06B 1R3LB 5CJBA 1UB6B 1FFOA 3P9MB 3GMLB 3SKMB 3JTSA 4NJ9H 2CKBH 4PGZA 4IRJA 4P5KA 3FQTB 4PB9L 3HI5H 1BZ7A 3HMXA 5T5FL 2YPLD 3MLWL 3WN5A 2EZ0D 4P9HC 2E9BA 4MSWB 3MGAA 3VXTA 4P2QE 5LGHH 4OLVH 3ARFC 2OR9H 3N85L 5SWZB 5DD0L 3QG7H 5T1MB 1IKNC 5DMJB 4NJAH 1TZIA 3QDMA 2UV3A 1U8KB 5E2UL 4JREB 1HHJA 1MRDL 3DWTA 1N7MH 3GI9H 1KLGA 3QR2A 3IFOB 2I9LB 2DQHH 1JWMA 4H20L 5CSZB 1MFEL 3AS2A 1PKQB 3ES6A 3SQBA 5E7FA 1LQSR 2YXMA 3RVXD 4QRPE 4X6BA 5CJ8A 43CAB 3M07A 5EC2B 3TF7C 4OUOA 1MCFA 1CD1A 4QF1B 3KWWB 3ZE2F 4K9EL 5F3HA 5LCVH 1BQHA 1NGWB 4XB7A 4P9HL 3KVQA 4X4ZA 2J8UB 4HS3A 4CVXB 5IKCB 2YRPA 2P5ED 5ESVA 4OF7A 3DETC 2VZTA 2ED8A 5F6HJ 4DQOH 4OV6F 2H8PB 4KJQC 3F6IA 4RZCA 4WHDA 5FDYA 3QIUB 4PJIB 4WHCA 5C0DA 3QDAA 2HVJB 5CZXC 1T1WB 1IM9D 3AY4A 1KENL 3T0ED 1CS6A 1OLZA 2FB4H 4KHTL 4WI2A 1CDJA 1HEZB 2FECL 2VXQH 4L4TA 2YD3A 1PZ5A 3BIKB 5ACLA 2HTLD 4XH2A 2FO4A 4ZUSA 3QJHA 5HI5C 3BP5A 4PV8A 5B8CC 3D39D 3O2WL 1PKQE 2CRZA 1JIBA 4I5BB 2CGRL 4HBCL 3GJFK 5LBSL 2P24B 5J57B 2JJVA 1HWGB 1U8IA 5TFSH 1KCUH 4LLMB 3TVMB 3BP4B 1CXHA 2X4RA 1WK0A 1CI5A 3QQ4B 4YHPB 4JKPH 4U1HA 4Z0BH 4GJTB 2N1KA 3DVIA 4HW6A 3SJVB 1QPXA 1ZXQA 3P4NB 3K8KA 1M6OA 1H15A 4PJEB 5DQDL 4MZ3A 1PW3A 2F74A 1FAIH 4KKLD 43C9B 5ICZB 2IH3A 1SEQL 4GG6B 4GRLB 4YIQA 2VXUH 4KZDH 3SKJL 4I0KA 3HE6C 5BW7C 3ARGA 2RIKA 4MA3A 3BP6B 5J6HA 1MI5B 5FKPB 1YYLH 1XGTA 1X5KA 4PUBH 3JZ7A 3PQYB 4F7MA 5IVNA 1I85C 1F2XK 5INCB 1YJDL 1T21A 5IB5B 1VGEH 2IH1A 4CVZB 3QNYA 5F93C 2HFGH 4BQ8A 3VRIA 4XP6L 2OL3L 1KTDB 4NP4L 4YC2C 4PLNC 2OQJA 3DXAA 2FLRT 4K71B 3AU1A 1QFUH 5E08H 2MQ0A 5E99H 5C9JB 1UXWA 3GMMB 5ERWA 5HHOD 2ZG2A 3DVGA 4N0FB 2BSTB 2XPGB 4WFEE 4FQHA 3BPLC 4HT1H 3E6FB 2ADJB 3TBSB 4LNRB 2FJHA 2YMXL 1ONQA 5FYLE 1XF5A 4KTYA 3MJ8B 1URLA 1OCWH 2YD9A 4M48H 1S7XB 3CAFA 4WO4B 1YDPB 5C0GA 4I0CC 2ZP0T 2NXZD 1EJOH 1AIFB 2P5WD 4X9GA 4QHMA 4HS6A 5D7IB 2R0WH 4ERSL 4JGUA 4X98A 4Z7VB 1TETL 3PL6B 3BPOB 4EN3A 1J0HA 4MVBD 3P0VL 1QFWI 4PGDA 1FAKT 2NPLX 5HPMB 4OLUH 1RJLA 3UTTB 3CFJB 2EEAA 4BH7A 1MREL 1NBZB 2ZG3A 2A6KA 3RAJL 4OCWH 2JIXB 5DI8A 4QXTA 1CFSA 4UMGA 5HXMA 1JPFA 3KGRA 3F5WB 4M5YH 2V17H 4Y5YA 5F7YC 4BUGA 4X4YA 1FNAA 3BKJL 4MJ6A 2APVA 3U7AA 2DS4A 3VXUA 1N4XH 1XFPA 4WHYG 4YDIL 5DUPH 2Z9TA 5HDLA 1RZJH 3TZVA 1HHHB 4NC1E 5ADPL 4KHXL 3PWUA 3VG9B 5TH2A 3SKOA 2DIJA 3BIAX 1T1ZA 3RUGE 1A4KB 1R5VB 5GRVK 2VLJE 3MRJB 3JWDH 1D9KD 4XBPA 2VNCA 4PJFA 4PJ9C 5E2TH 3TM6A 4BUHA 3UTZA 4M43H 5FO8A 3FT3B 3WFDL 4RFNB 2XNAA 2COQA 4NRXB 3KPRB 4OZIA 2H26B 3WHE1 4TVPL 2E7BA 4JG0H 1KJ2B 5AYUH 4Z7UF 1SEBB 5C2BL 4KKBC 1I7RA 3RUGF 4NGHH 4APQD 3P4LA 1WITA 2H6PA 3GMNB 1JGEA 5I1AA 2Z92B 1FYTD 5C09D 1NSNL 3VXRB 3TT3H 3KPPA 5ISZB 2KPNA 2HFEB 4KPHL 4LPYA 3WD5H 4K7PL 1UWEL 1DBBL 4PLJD 1CK0L 3L5WB 1IAIM 4JY4B 1AR1C 4D3CL 4NHUB 5C09E 1DZBA 4E41B 3AS0A 5B38B 5EBMA 2DYPD 2H9GA 4NKMA 3CU7A 5F9OH 3RWGA 2ATKB 3OXSA 4NN7B 3V6OC 3G5VB 3UPAA 3KNBA 1U8PB 2P5WA 4DGIL 1YYML 5K9JH 3N50A 4A6YH 3BPCA 2AEWA 3DECA 1CFQA 5HGBA 1CICD 3K4DA 1ZSDB 1U91A 5JIPA 5TQ0H 4TPRL 1VENA 1EA9C 5GISH 2PTTA 4KTEL 3GSUB 4Q9QL 2FDBP 2EDTA 3V6BR 1KEML 3GB7B 3FAXA 3TO2A 4HJJL 4HZLB 3BEVA 3WE6B 5ABDE 1ZTXH 3QJHB 1F8TH 3AXLA 3L3IB 5I15H 1KBGH 3T0EE 5TPWL 2NY5H 5EBLA 3IXAB 4OZIF 5HHVL 3O3BA 3MRFB 5E94B 5GS0H 3ARVA 4PJ5A 4X9BA 5BVPL 1XGRA 1RK0A 4FQ1L 4UT7L 4RSVA 2Z91B 2C7UB 3O6FB 1QLRA 4M6NH 1XF2B 1GZQB 3S4SG 3O11B 5C0CB 1FL5B 1BVKB 3ZSSA 3LH2L 2CMRH 4R2GD 2VDNH 5F72S 1U9KA 1N8ZA 2XTJE 5EUOF 2E8YA 4XNYL 4M6OH 4Q7DA 2UY6A 3BZEA 3N85H 4ODVL 5CILH 4NQCA 1W72B 5GS0L 3TO4B 3DYOA 2JJWA 1JGUH 1UG9A 2A74A 4JZJA 3CVHL 5F3BB 1HSAA 1RI8A 2GTWB 2OR8A 2Q8AH 4NNPL 1J10A 3VFPA 3VRIB 1I1RA 5D6DA 2V2WA 4K07A 2R2CA 2YD4A 4WUUB 1SY6H 4YHOL 5F7HA 3IB4A 4BZ1L 5FYJD 3M45A 1BJMA 2AEQH 1JNNH 4JO1L 1F4WL 3QNXB 2X4UB 3JVGC 4U1SB 3C8KB 3LEYH 4MD0A 2BVPB 5ANMB 2D9QB 2P5EB 4HQQH 1OQOA 5TGBA 3QULB 3A67H 1YEKH 1KIPA 2LAGB 5KG9A 1K4DA 5J6GA 3THMH 3ABZA 3IAPA 4XMPL 3MXVL 5E7BA 4EUPG 5E2VH 5H35B 4CADB 4PJEE 4YHOH 3P77A 2EC9T 1ZGLB 1RJCA 3PWJB 1YNLH 4L8SC 1QOKA 5HHMB 1DR9A 3V95A 5FUOL 4KFZC 5IB1B 4APQC 1PG7X 5D7IA 4URTB 2FX9L 2ZWLT 3K3QA 4MD5B 3VXSD 4UU9A 4L3AA 3VXTB 3QXUA 3RWJB 1ETZA 3R4DA 3X3FH 4P2RE 5GJSL 5IV2A 1J1PH 4JCMA 1YMME 3GSWB 2EDXA 4UV7H 1ED3B 1R24A 1WZLA 1KXQE 1HKLL 4LKXA 3RTQC 4HC1L 3O9WA 2IJ0C 4LPTA 4MA8L 4AL8L 3VGEA 1WWBX 1ADQL 5I1CH 3QXDA 1XF4B 4FHBD 4EIGB 3TJHC 1OB1B 3T4AA 5F21B 5CIPB 2EKSA 4MDIB 3GHEH 2A83B 4ZUVA 2A73A 3T3ME 3U46A 1MI5E 4K7FB 4YBLB 1FHGA 1G9EA 4NUJB 3H3BC 3S37H 4I3RL 2W60B 1AR2A 3BN3B 1KULA 3C5JB 3DX8A 3EJYD 3MV01 4JQVC 4M1DH 5DJ8B 1HOCA 1JYXA 1MIMH 4HHAA 1U93A 4NQSA 4PP1C 5E2WH 1JP5A 3MLXL 3GBML 3KDMB 1FG2B 1DVFB 1QFWH 5SWQA 1IL1A 3NCMA 4NKIL 5LVEA 3MRJA 3SDAB 3SKNB 4CVXA 5IKCA 4Q6YA 4NWTH 1QG3A 3T2OA 3QUXB 3Q3GA 1OGTA 5HHME 3GSRA 4LCIL 1S7RB 3O6MH 2IANE 4WO4C 5CD3B 5HD8D 3BKYL 1IGCL 4XNZC 2V5TA 3IYLW 1KJ2A 5I0DA 5TQ2H 5EZIL 1OAYH 4DVRH 4HJ0C 5D1ZC 3MV9D 2VIRB 2X6MA 3OMZA 1OWRM 4U1JB 2X1XR 3DIFA 5E8OB 2VKXA 4HC1H 1NC4D 4M1DL 2CLRB 1JPST 3T3PE 2DWEA 4K94C 4LHUA 2HFGL 1JYWA 4JFXA 1EAPA 3K2UL 5FUZL 1QFWL 1IT9H 2VXTH 3UC0L 4BELD 1X5YA 3HZVB 5KSBE 3S35L 2GKIA 4OI8A 1T83A 1JBJA 1CT8B 1FGNL 3VXUE 5F44A 4JY4A 2R0WL 2K7PA 3U79A 4RGOH 1UQSA 3ZHKA 2GSGA 4NZUL 1NDMB 3CVIL 2DQUH 1E4XH 5E03A 4RAVA 4CDGC 1Z3GH 1E27A 1QO3B 3OJDB 3WDJA 3OV6A 5CEZD 4KDWA 4E41D 4NNXA 3LKOB 1G0XA 1TZGL 1U0QA 2AK4E 4U05A 3QIWD 2WP3O 3D25B 5FOBA 3BD4A 4JPWL 4YFDB 5C0IA 2Q86A 2W0PA 5CJXC 4PJFE 1ZSDA 1IILE 3KPLB 2DQDH 5A2JH 1NFDB 2QL1A 5DJXB 3GSXA 3GJFH 4JY5L 1NAML 5TDPB 2EH8H 3MACL 4KDTA 4TUOB 4GW1B 2X41A 4KKLC 3BKCH 5EG6C 2AK4D 4R97B 3HAEA 3O45A 2ILLA 2BVQA 4HKZB 5EORL 2BJML 1KN4H 4P9MH 3FOMB 2E27H 1IKNA 3D18B 3HC3L 4D94A 4HEME 5EBLB 4G6FD 4GBXC 1T83C 4GAGL 4GG6F 1IGFL 4XAWH 5KSBB 3VH8A 3T0BA 5TF0A 3DXAE 3L3JB 3NTCH 5JQ6H 3NCEB 5CGTA 4YUEL 1FC2D 5I16A 2EH7H 4WVRA 4Z78B 4J1UA 3NGBB 2ENSA 3SGEI 5IT2L 4FNLL 1OW0A 4JFDD 4NQDB 3BFOA 1TJHL 5I8OH 1BVKA 1TNMA 3MJ8A 4C58B 3SDYH 3DARA 4HK3J 4UQ3A 4LLQB 3QH3A 4UBDC 4F7EA 5KJRH 1FGVL 2HMIC 2XIDA 3HE7A 4DGVH 4EQ2A 4R26H 4Y4KC 3RL1B 2G75B 3NPZB 2OS7A 2YPVH 4WI6A 3VXOB 5D93C 4ZAKA 2FH8A 2GSIA 3QEQA 2EH7L 2ZJSH 5TE4H 1EXUB 3VFNB 4AMKL 4KROB 1EHAA 1F6AA 1JN6B 3P11L 3D48R 4P4KC 4IOSD 4OM1L 4X8JA 1OSZB 2CLZB 1QSFA 5HVHB 2ARJB 3EO1B 4CUCA 3V4VL 5C0RH 5CBEB 3DI2B 1U8NB 4MCZB 3GIVA 1PG7H 3EZ8A 1UWGH 1IGYB 4N1CA 4QXUH 3P4OB 4D8PA 1QZ1A 3BRFA 2VLLB 4LOUC 4KZEH 1EEZA 2NQCA 3MRBB 2Q87A 2BHYA 2OL3A 4ZTPH 5HJ3B 2J88H 1G7JB 3P77B 4JR9L 3ARFB 2GFBA 5D8JH 5ETUA 4FOMA 3WJJC 1X4XA 4N0CD 4XP6H 5IBUB 4U1IA 2DQGL 1FCGA 4Z7WA 2HJFA 2WMPA 4Y8DC 4B7LA 2OZ4H 5J13B 3CJJA 1F3DJ 3ZTNH 1LDSA 1ZK9A 1TPXB 2BY2A 2G9HB 4Q2ZB 4GKZA 3HUJE 3FONA 3V7MA 3MJ7A 5SWSD 3DSFH 3IDUA 3S37X 3BE1L 4LU5L 1ED3A 1R24B 3ARBC 5GGVL 3VXSE 2VWEE 3T2PA 4AEEA 4U1NA 1FVCA 2Z8SA 5F7FA 3BDYH 5D2NC 4YDVA 3S6CA 4X6CB 2FWOA 2NY0D 1QSEA 1HHGA 5IEHB 3LKRA 3MCG1 4UIMA 1PKQA 5DXWA 5K9QG 1YEHL 3MBXL 4F7PB 4DOHB 1R5IA 2PW1A 1JGDB 1G7PA 4HGKC 2O5XH 1C16A 2J5LB 2UVEA 4JFPA 5BRZB 2GTZA 1FJ1B 5D72L 3RWFB 2AJZB 1EK3A 4LASL 3N1GC 1P4LA 4HGMA 2HFFA 3T0AA 3SY0A 1CBVH 4KHXH 2VAJA 1VERA 2H2SD 4FNLH 2V9RA 3QUML 2DTML 4MB4A 1AGEB 4HC1A 1DQDH 3PDDA 4HH9A 2C26A 1VKXB 1N4XL 5C08D 2AK1H 4KRPC 3W11C 5HYQB 2NY1D 3RVWD 4MQSB 5E5MB 1A14H 1WCBA 1KTRL 5TJWK 2KZ1B 4M43L 5EUKB 2Y5TB 2XZAH 4J3XA 3WSQH 3CGTA 3T1FA 2HRLA 4JPIB 2F54B 1T1YA 1UWXK 5DJ0A 5E8PB 1MAMH 3OZ9L 5I71C 1R5WA 2HJKA 4I77H 1IM9B 4PJHE 4JDZB 3NAAH 4PJIF 5BMFL 2CQVA 1NGZB 3RI5F 4K3DL 3CFDA 3UAJD 2F53D 4P23D 4P4RB 2SEBA 5EC1A 4DOHE 2P24A 1ZHNA 1BOGA 2DLIA 1S78C 5JOEA 2VISB 5DTFA 3EW3B 5GJSH 3U0PB 4LGSB 4LSQL 1JGLL 4PY8I 1QO3A 2JJTA 3HI6H 5HGGS 1I8IB 3GMPA 2DKMA 3P4MA 1EEUA 4I9WD 2N7AA 4WV1C 3INUL 4P2OB 1L0YA 3IDXH 3QFJE 4U4BA 1GGUA 4QRUB 5GRYA 4PTUB 3GRWH 4QRRB 4WI9A 1P6AB 1YPZA 4ZYKB 4L4VA 1SMAA 4Y1AD 43C9A 3O4LE 3PUCA 1Q9OB 4H88H 2IANA 2DIAA 2PO6C 3T65A 3CMOL 1JWUB 2XXCB 3TNMA 3MRPB 4RWHA 3DRQB 1Q0XH 1FLRL 1FNEA 2UWEA 4O9HL 3QWRD 4GQ9L 2HKHH 4U1GC 4H1LB 3OG6B 1B2WL 1I9EA 1T5WA 4LSQH 2VDLH 3D18A 4KJPD 5GGTA 4OKVA 2H41A 3O4LD 1C1EH 3EYQC 2CKBB 5T5FH 1J8HE 3L7FB 1VACB 3H9HA 5IESL 4Y16C 4Q97A 1FZOA 1AFVH 2I5YH 3QZWB 4K2UL 1CFNB 1HWHB 4V1DE 5I18H 3VGBA 2X4QB 2FR4A 4NKDA 1YC7A 4S0TD 1U6AH 3MLRH 4PJAA 1MLCA 3QEGH 3EYFA 4HIJA 1FO0A 3QUXD 3MRIB 4YZFF 4NC1C 1OAZH 2R1YA 3B5GA 4NNPH 2QQLH 4PJBE 3BSZL 3K2MC 1JI1A 3CSYA 1GOFA 2RGSA 4N8VB 1CFBA 1CFTA 1J1OL 4HKBB 3I2CL 5L2KB 2DQIL 3LPGA 1CIUA 3HG1E 4XCYA 5D70L 5CMAA 4HAGA 2HP4A 2BXYA 5KANG 5I74B 2O5XL 4RMSA 4PD4J 3V5HB 2GSIB 3D6GA 4X6EA 4N0UA 4MD5A 3D3VB 5GIRB 2IPTL 2BVYA 2YPKA 1WVZA 1VADA 3PHQA 3GSWA 1RAMA 3UYOD 2QR0B 4F80A 3G6JE 1LD9B 2FO4B 3SGJA 1IEAB 2XFXA 1WAAA 4TUJA 5MHSE 4M1CD 3SPVB 1RJLB 1U8QA 3MUJA 1G9NH 4OFYA 3FMGH 4B53A 4PJDF 2ZSWA 3SDDA 4J3SA 2KDGA 5DI8B 3PIQB 1BP3B 1YMHB 1INDL 4PS4L 3ARGD 5DJ6B 1FGNH 5CIPA 4XWGL 2OJZH 4OQTL 3NACL 1QPPA 2NY1B 1UM5H 3QQ9C 2EDYA 2IG2H 4JE4B 4P46B 2XQBL 3NVQA 2ORBH 5IMOB 4GS7B 4Y4HB 2VERN 4M1GH 1LILA 4MXQC 3B43A 4HUMB 1AD0A 5GSVB 1YQVL 3IDIA 1K3ZA 3H42L 3OAYK 3BGMB 3PNWB 4QTIH 2AW2A 5I1LA 4BH8A 4OFYD 1AI1H 4XBPB 1EHNA 3I84A 3FRPG 5FA4A 2FX8L 2NY6D 4K94L 1IGJB 4P4KA 5CP7B 4N0UE 1JUFB 2VQ1A 1QBAA 3FT3A 3QG6B 1TQBC 1U41A 2FL5B 1Q0XL 5AAMA 1XGQB 1CXLA 5I19L 5L6YH 1ZHKA 2A6JB 3QIBA 4HWUA 4X7TA 4Z0BL 3L3GA 1BVLA 2M1KA 3ECBA 1C08B 2VDLL 3GBMH 4EI5B 4YDVB 4CNIA 3GMNA 2BZDA 1MFDH 4LHUB 4P2QD 5DJCA 4AENB 3CSGA 2AXFB 2YC1A 4XPAH 2WAHA 3V0AC 3CMOH 3DI3B 1ZWIB 3FO0H 5F7DA 3WKNA 3MCKB 15C8L 4QGTA 2OTUA 1FH5L 3T0EC 4XGZB 3SDXA 4NZJA 1Y6NR 1RUKH 3B9KC 5HYJE 2GSGB 1HYSC 1KENH 1OP3K 1LEIB 3HMWL 3FQRA 1E27B 3VWJA 1TJHH 5DJYB 4UT6H 4HSQA 5FGCE 4YXKL 2F5AL 2X4OA 4Y8AA 3MOAL 3H0TA 4GW4B 1VKXA 4KK6C 4XPAL 1NBQA 1P1ZB 5DRWA 2BSRA 3MLWH 4BFIB 5LQBL 3KPOB 2H1PL 2PUQT 2D31B 3S7GA 3HZYA 3ZHLA 1ZS8A 2EDKA 2AJUL 2ZOKA 3S88H 5LGHL 5I1GL 2XKUA 4R7DB 4HUVB 5E8PA 1IFHH 3CVHH 1NGYA 5MEOB 1AHWB 3ARDC 3WUZA 1KCRL 1MFBH 1IQDB 2RQ8A 1XR8A 4PGCA 3P30L 4G9FE 2WBJD 4QXTB 3VFGL 4AG4H 5D2LF 3I02B 5JW5A 3L3KA 3X11B 3HHRB 1NEZB 5CJXA 3MODL 3AMLA 2KUTA 1JNHB 2XZCH 3EDDA 1DVFC 4NBZB 4LPVA 4ZFZB 5IVXA 4JDVB 1IAII 3DMMA 4QRSB 3B3IB 1AXTH 2D03L 5EO1B 1GJIA 1F4AA 4GRWB 1I8LC 4PJBB 1CXEA 5TH2B 2R1WA 2CK0H 4Z7VF 1I4FB 2EIZA 2XICA 4QRUA 5KSUB 5CHNB 5KSBF 4X7CC 4KI1A 3K2UH 4O51B 1LHZA 2ESVA 5C8JB 4JRXE 3U0WL 3OKEA 5B8CB 2IBGA 1LEKB 4NZUH 2DOCA 5C07E 3IJSA 4PJCF 5D7LD 3BO8B 5KVFH 25C8L 3FQWB 4MAUH 1XGUA 1W72A 1UKQA 5I1IH 3AUVA 3T0VA 4ZAKB 1UM4L 2KQNA 2O61A 3DVFA 5T1LB 3SE9L 4KVNL 4Y4FD 3LQAC 4G43B 3G9AB 3W0WA 2PO6A 1NGPL 3IT8D 4BZ2H 2Z0BA 4MNQD 1ORSB 5L2KE 1HQ4A 4WUUD 5DK2A 1NDGA 3QDGA 4XI5D 5GJTH 1OTUD 1D6EB 3MUGA 2QQKL 2BNUA 2R1YB 5EORH 1HXYA 4ZDHA 2VDMH 5CJOL 2Z8VC 2JJTC 1SY6A 5C6WH 4OCXH 3LVEA 3G6JB 4TQEL 4NKIH 2G2RB 4GW5A 2QBWA 3L95B 2C9AA 2VDKH 4UB0L 3WS3A 2I24N 4NBXB 3MLVH 3EUUA 3FN0L 4KU1A 4L9DA 5FHBH 3C5SA 2QSTA 3U6RB 3V6OA 4Y16B 4G8GA 1JPTL 4Z7OE 3BYTA 3C5ZA 5I73C 4TVSa 4AIZA 1J5OH 3HFML 3ZSTA 5JW3L 2J5LC 4GG8B 3SN6N 4AMKH 4V2BA 5J1AB 3RVUD 5DSCA 3FB7B 3OAUH 3TWCL 5I8OL 5IB4A 2V2XB 3FN3A 4HUWB 3QIWC 2GCYB 4D9QD 4A6YB 2B1AL 1I3VA 4FQLH 1UACH 4IMKC 5JXAH 4H5SB 5B21A 5JW4Q 4CU7A 4MNGE 1KG0B 2EDJA 2X89D 4LF3A 4NQEE 2IADB 1G7PB 3KJ4B 1F90H 4MMXC 5HYEA 4LSRL 3HC0B 5L9DL 1NCNA 4YJZL 1HOCB 2VLRD 2VUYA 1P4LB 3TCLA 4KRMB 5FCUH 3MFFB 4RBPK 3TJEL 3HLAA 3G5XB 4NO5B 4GXUM 1IRAY 2LABA 1LVEA 3D39B 5D96B 2W9LA 2PXYD 1Z6JT 3LKPB 5IBUG 1A0QH 4R8WL 1PX3A 5D6DC 5E08L 4OI7A 3AGVA 1D3CA 3QEGL 4P59H 4NNYB 1RZIB 1G9MH 4GBXD 2X1QA 5IW6B 2DJSA 2AABL 4KKBD 5IMMA 1S5HA 3B9AA 4WUUA 4RRPG 5DJCB 4HV8B 4DEPC 3LS4H 1F3JB 3O2DL 4M03A 2M8XA 3W5NA 2R2EA 1RZGA 3C6SA 2E6JA 4JPVH 2Q20A 4OZGB 4MD0B 3W5MA 1ZVYA 1MCQA 2Y7QA 3BKJH 1MCDA 2DRUA 4NWUL 4X6DB 2D7OA 4FQIH 5GS1C 3QZWG 2HTKC 3QAZB 4F33B 4KTDH 5D72H 2VOTA 5DJYA 3GMPB 1MCPL 5GGRY 4CADA 5H35A 5E00A 1F02I 4M6ML 1L7TL 3T0WA 2DQEL 3SDXF 5TE7H 3LQAH 3LS4L 2NNAA 3DO7B 4FZ8H 4MD4A 1PLGL 4TUKL 3P0YH 5DQ9A 3VG0L 5GJTL 1YNTB 5DJXA 2PCPA 4F15B 5HYSA 3PABA 1SJEB 3MCLH 4YHYB 4XHQA 1PAMA 1VGKB 1NFIA 4X4XA 1R0AL 4TQEH 1D5ZB 3T3MF 3DHMA 2AK4A 3E3QC 4XXCA 1F6FB 1XIWD 4RWYL 2G5RA 5EU4B 4PJ5D 1F4WH 2QHRL 1DUYB 3NAAL 3IDNA 3OKYA 1XZ0A 4LLMA 1ROWA 4DW2L 3TO4D 5DRZB 1HXMA 5FA3B 4UQ2B 3U4EA 2FJGB 5TQ0L 3SDXE 5I16B 4P2RA 2HYMA 4Q74A 1IVLA 2Y72A 5J8OA 4NQVA 2NY7L 3ZDYE 4Z8FH 3QCVH 1N2RB 1NMAL 2EE3A 4MA7L 1TCRB 3DRTB 5SWQB 3NZ8A 4M62H 4XMKL 1GH7A 1I7TA 1CDIA 3MRRB 5MEPA 3SDAA 3VGGA 1BWWA 4OFDA 4HS3B 3GSNL 5EZLA 1J0ZA 4BQ6A 4C56A 4HJ0D 3UBXA 4WFFD 4YC2B 5T33H 1S7RA 4RQQA 4OLWL 5T1DH 2CMRL 1N5AB 2NX5E 1A5FH 3RGHA 3FO9A 1K8DB 3V6FA 15C8H 4GBXA 3BO8A 4HMCA 1FH5H 3FCTA 2I60H 1G7LB 2R69L 1EO7A 3O0RH 1P2CB 1Y0LB 2VTFA 3QQ3A 4ZPVB 1H3TA 1AXIB 4NJAL 4CVZA 3CFBA 3HNTH 2XTJD 3D9AH 3SO3C 1AO7D 2MCG1 1MCSA 1CR9H 2J6EH 2NY2B 5CCKL 1W0VB 4YDKH 4YHMH 3KLAB 1KCUL 1KJVA 4LEXL 5DJ6A 3DYPA 5DYOA 4NN5B 5HHXL 4M9OA 3MRHA 2L4OA 4KUZH 4WNQA 4UTBL 2QQNL 4QYOA 5JUEL 3R06A 1U92B 1KCRH 1MFBL 3L95A 2DL9A 3BZFA 2NR6C 1A7QH 1D6VH 4JEGB 1P7QA 1FIEA 1FL6B 5JOPE 1SY6L 1MHEB 4P5TB 3VJ6A 2MJWA 5DRXB 4CVUA 4S2SB 3L3DB 3CD4A 2J6EL 2XA8H 4DQOL 5E1AB 4OM0H 2IGFL 5DUBB 1OGAB 3I9GH 1P7KB 3FB6A 2MCPH 3WFCH 4OD3L 3CU1A 5E4EB 4KROC 2DIBA 3QFJA 2KL6A 3CFJA 4BH7B 1T1XB 3MGTA 4U2YA 3VXQA 5DRNB 3SKUD 1TZGH 4P9HH 1J11A 3BQUD 2JIXA 2PW2A 5GGSA 3OGCB 5I0ZA 1T21B 3TIEA 5IB5A 2PKDA 3F5WA 2UZIH 3IFOA 4FFYH 5GQBA 3IFLL 4RIRB 1S7QB 4YPGB 5JA8B 4W6XB 3F7QA 5CEZH 1VFAB 4XNYH 5B38G 4FQCH 1IE5A 1NBYA 4KMTL 1DP0A 1HHHA 4G7YH 5F7DB 1UB5B 3NA9H 3EOAA 1FNFA 1X5GA 4Y2DA 2D7QA 1A3LL 1T1ZB 4AH2B 4QTHB 5MP6L 3VXPB 4M62L 2AAVA 4LVOB 4GFTB 2VXVL 3SCMA 3IAQA 4M1GL 3VWJB 3OAYH 3S36L 1XF5B 1MI5D 4FA8A 4Y19D 3L5HA 4YAQB 5HGAA 1FZMA 3VWKC 5FV1L 4NRYA 5I71B 5JW4N 1IGCH 3HRZA 3VXOA 4LQFL 2OJZL 4OQTH 3O9WC 5DURB 4ONFL 2IAMC 3O3EA 4EDXB 1LP9E 4KVCH 3BRDA 4N8PA 3ARBB 1D5XB 1GGBL 4X98B 1AO7A 1NGXB 3MNVA 5GGVY 4L5FL 4F3FA 3IKKA 1OSZA 3EIFA 1F3JA 5SX4I 5EIVA 3RGVA 2IFGA 1VGEL 3TGXA 2ARJQ 4ZUUA 4FQXC 2DQFA 2BCKB 4ZUSB 3QWOB 3BKMH 1WFTA 4OZGA 3OR7A 3GIZL 4QNPE 4R3SA 5BZWB 4R2GB 2XN9E 4YNYB 1S7TA 3HPLA 3NA4A 5D2LE 4FFZL 4X6DA 1MVFA 2W0FA 3QUXC 2EDOA 3VXUB 3SKJH 1IC5H 4KJYA 1A3LH 1S9KC 3B3IA 1A3RL 5IG7A 3F7YA 4FXKB 4OFVA 1OLLA 4O02H 4ETQB 4MQ7B 1ZT4A 4ZUTB 1T0MA 3GIZH 1FNGB 2F74B 2R4SL 2JKXA 3EO9L 3PL6D 5I1JL 3A6OA 4H0GA 2IAMD 2Q6WA 4MNGB 3UTSA 3ZYIA 3BXNA 3F65A 3LRGA 1UJ3A 5CGMA 2BSSA 4XCFH 5SX5K 4W70A 4JKMA 1Y18A 1JTTA 3O3AA 1ZVHA 5D2NB 1E4XL 1IAKA 1WFNA 4JG0L 1AP2B 5DJDB 3BP6A 3OKLA 3Q6GL 1IC5L 4OGAD 1U8MA 1OP3H 3ZL4L 2XYCA 4R0LB 4QXGL 2R0ZH 3WNOA 3HCVA 3LRSB 4FFVD 5DD6A 4J8RB 2UZXB 2P7TB 5ESAA 2IBBA 2BC4A 4FFZH 3C60B 5DEFA 4F58H 5KSVB 5F89A 1EMTL 4MJ2A 3RIAF 1AGDA 3AU1B 3I6GA 4P2QB 1X5IA 2IG2L 4NQVB 5I6XC 1OAYL 4DVRL 4HIXH 1N26A 3VDBA 3NZ8B 4I13B 5I1IL 1I1AB 5F1NB 3I6KA 4WFGD 4GKSB 5SWSA 1WZ1H 1J12A 3CH1A 1WBXA 3SGKC 3ZL4H 4UBDD 5E6IA 2IPUK 2Z4QB 5J4MA 5EA0H 1E4WH 4P3DA 2Q8BH 1KCVL 1DLHA 1ZOXA 4RX4D 4GBXB 1FGVH 4WFHE 3RU8L 3JWOL 4JVUA 2FYYB 5B39G 1BECA 4HK0A 5GRVL 3MBXH 2NX5D 1OAUL 5DJAB 1RZFL 4NBYB 1IAOB 2ZSVA 3TC9A 1YEFL 5GIRA 3ZKSD 4HK3N 3VFPB 4P23C 4M7JL 5JW3H 4EEEA 3PGCB 3IJHA 3DV6B 1FE8H 3AXLB 3L3IA 3WHXA 3ZT6A 1RUML 4W4OC 1N0XL 2GYSA 5L0QC 1JPFB 5F97E 2DYPB 3RWIA 3FL7A 1HK6A 3SDAC 4HUWA 5EBGA 3U0WH 1G0YR 5TGBB 5CWSA 4CW1A 2R29L 3VGFA 4PGEA 5LWYL 1YMMB 4KY1L 1I9JH 4Y5VA 4PRPD 4OFPA 1KPRA 2Z91A 3X13B 2PF6A 3OB0K 1UXSA 4JR9H 1UCBL 3FQUA 3BRGC 1OP9A 2X4TB 5C0CA 4LLYA 4UINL 1RVFL 4OLYL 5IROA 5B39B 5BQ7B 1JZ4A 1DBKL 1MRFH 3L3HA 3FTGA 3JUZA 3TNMB 5IV2B 2P1YA 2RFXA 5CSBA 4WI4A 4FQXD 3O2VL 3QG6A 4EI5D 1J1XL 2K1MA 1CG9A 5KW9H 1L0QA 5FKAB 3QHZH 2HT3C 2I9TB 3DO3A 5KAQG 2FJFA 3RUGA 2PR4L 1MHPH 2F5BL 1XGYH 3ULUC 3HNSL 4KK9D 1UVQA 3VFUB 2V2WB 3QIWB 2XN9B 3EYSL 4YPGA 4G9DB 5T3XL 4A6YL 4WU7B 2A73B 4HPYH 1YY8A 1Q94B 3DUSB 1Q0YL 2R1XB 3SE4A 4Y4FB 1VDGA 5DJ8A 3EOAB 4GO6B 3TNNB 1U93B 2ZCHL 4Z8FL 3NCJL 3KS0H 1JCKA 4DN4H 1KFAH 4OAWA 1ODAA 2GAZA 3CDYA 5IFJB 1AE6L 1KBGL 2H9GB 2J8UA 4TSAL 2QV2A 4EI6A 3T2NH 3RVWC 4JFQB 5EU5A 4NRYB 1BQLL 1RK1B 4X7SH 4ZUWA 3FFCA 1NH6A 2OZ4L 1MHHB 3VE0B 3RZWA 4PP1D 4Y0GA 2R15A 5FCSH 5BO1L 4JLRB 2XZAL 3WSQL 3OWEA 3PWVA 1JFQH 5CGYC 1QYGH 3U36B 1SBSL 3DV4A 2IQ9L 5MEOA 5FYJU 5C08E 1DL7L 3R1GL 4QHLB 3CFEB 1N3NB 1PKOA 3MRQA 4RWYH 4PRDB 4RFNC 4JFYB 4OZFH 5BZWA 3MLZL 2FX7H 1FSKB 3MJ9A 5IGXL 1ZT1A 1UM6H 2Q1EA 1U6AL 3WFBL 5E56A 2EKSB 4YHLH 2AJ3A 2ZUQB 5HYIA 3GMLA 1QNZH 1QEWA 5EU7E 1NCDL 3L6FA 2C4XA 1U8LB 4ZODA 4IDLA 1G0DA 3C8DA 2C7UA 1E0OB 3CXDH 1FDLL 3STBA 1GZQA 1CXFA 2DQJL 2WQ8A 2YZ8A 5HSFA 5JR1L 3KHOA 5ICZA 5DMIL 2FD6L 1GHFL 3WJJA 4XRCB 3CLEL 1MCNA 2W91A 4P4KB 5D7IE 5C8JA 2MOVA 4M6AA 4X7FC 3G6AB 1XT5A 3ZKQD 4HIIA 3WFDH 4UDUB 3ARRA 3C8HA 3W81A 4WU5B 5FAAA 1AGCA 3C6LB 1V3MA 3ILPA 1X9QA 1DQQB 4XMLH 3QQ3B 1P2CA 3OX8B 2VIRA 2FHBA 1N7ML 3SO5A 1HSAB 3LDBB 3S5LA 3SOBH 2O61B 3EOBB 3G04B 4U1KA 3RX8A 2ERJB 12E8H 1T22A 1WBYA 4PRHD 2XI9A 4ZPTB 1M4KA 2V6HA 4QY8A 5E8NB 5A16A 2FX8H 4WI7A 4TULL 1JHLL 1AY1H 2R39A 5I8KH 4LQFH 1DQJB 2IALB 1AKJA 5DYOB 3KPRE 1NGWA 2O5ZL 4GKSA 5SWSB 4MS8D 1QA9A 5KG9B 4DFHA 4NT6A 2CO6B 4MWFB 3UTTE 4Z6AT 1BAFL 3FO2B 4Z7UA 5C0AE 8CGTA 3ZE1F 1HH6A 5AZ2H 5J9PB 1RZ8A 3MA9L 3ARDD 3VJ6B 1AY1L 5FK9A 3SDCB 4PRHA 2I27N 3WFHA 1BGXH 2Z31D 3C08H 1QBMH 2B4CH 4CJ1A 3SJVE 1MUJA 4ELMF 5I1KL 3N06B 3HI6L 2LE9A 3UJIH 3OR6A 1N5YL 3GO1H 4RGMB 5J12C 4PJ7B 3MLUH 5I1EL 4HIEA 1M7IA 3FAWA 4KGJA 3B2UC 5D1XD 4LL9A 4I1NB 2I07A 3JV0A 3QUMA 2GIYA 1S7QA 3V0WL 5J56B 1RMFL 1VFAA 4P5TD 5IF0B 4YHPA 4YXHH 2RBLA 5FYKL 3W39B 4OD3H 3X17A 3DX8B 3HTLX 1A6VL 4N9GB 1I1FA 4Y2DB 5E2VL 1I8MB 4F8QA 2NXYD 2CDEB 1BFOA 2Q3AA 1FIGL 2MTPA 4JO4H 4X6CF 3REVB 1IT9L 3ZTJG 4R4BA 4LARH 4DN3H 4OGZA 1T2JA 1HIMH 4PP2A 3QISA 5IFAH 1BFVH 4I4WB 4LSDA 5CKAA 2H26A 2J4WL 4OZHB 4EOWH 4N5EC 2XKNA 4NPYA 1SEBA 4UTBH 3DIFB 5JHDD 3MMEB 1V5JA 3AMKA 5EPMB 1T0PB 4Z76B 2HH0L 2DWEB 1HI6B 4APQB 1DEEA 5C9KA 2JB6A 4YDLC 3MUZ1 2VDRH 1Y6MR 5EZOH 3LEVL 1ZHLA 3OAZH 3CUPA 1CL7H 4JHAL 3RWFA 1CT8A 2AXGA 4MAUL 4EUPB 1LO2L 5AUMB 1UQSB 2FCBA 4KKAC 3CZFB 4DZBA 1IC1A 3MRMB 3UTQA 4O2CB 1BREA 3UPRB 4NKOA 1UZ6F 4M8VA 4ELME 4WO4A 1LO0H 4XBGB 2J6EA 3QEHB 4ZXBA 4GG6E 2AEIT 3D0VB 1NMCB 5T1DL 1ZT4B 3HS0A 4Z7WE 1F11A 4PRBB 4GXVL 5EUOB 4CU6A 1B0WA 1WEJH 5EUKA 1F6LL 4S1DC 4R26L 5D2NE 3BD3A 3T1FB 4DAGH 5DMYA 1AXTL 2D03H 3CC5A 3O3AB 3VFOA 1IFHL 1CE6A 4KV5E 4MGXA 2ZUYA 3PABB 5DWUH 4DK6A 2MSPA 2P47B 4KQ4L 2MWCA 3VFTB 4LBEB 1W2KT 3BP7B 3X14A 2XG4A 3GNML 1G7QB 4PRIA 1CFSB 4F9LA 1YEEH 5MENA 3EOYG 4JM2B 1J8HA 4MAYC 2P7TA 4UINH 1TQCB 1SYVB 4ALAH 4AEFA 4NO3A 1EUTA 1ZHNB 3P0GB 4H1LH 4GRMA 2W0KA 4I18A 2IADA 5KVGH 1JWSA 4GXVH 1R5IB 2PW1B 3TA3A 3HC0A 2C1OB 1QR1B 1QEWB 4Z78A 4G9FD 1B0GB 4GRWE 4P2OA 1H8SA 5D7IF 3SBWA 3JTTB 3VGHA 3HC3H 4JHWH 3ZDXF 1D7FA 2D4FA 3GI8L 1RJYB 4WY7L 3GGWB 1HHIB 1YPZE 2VQTA 5E6IB 2RCSL 5KTEH 1S78D 4X99A 4ZFGH 4P3DB 4N1HB 5EU6D 5D5MB 2P46B 1JWUA 4UQ3