5HYJD

1e6 tcr in complex with hla-a02 carrying aqwgpdpaaa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
193
structure length
193
Chain Sequence
KEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A "hotspot" for autoimmune T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 33
structure length 193
sequence length 193
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjD02
2ZUQC 3LDBC 4WFED 3CAFA 4NNYB 4YDVA 3WS6C 5GZOC 5IR1A 3PWJB 1BX2B 2Z4QA 4WI6A 3UC0H 4PY7B 2HYMA 4JM2A 4WHYG 2VDQL 5TGBB 2CDGB 4M7JL 5IQ7H 1NBYA 3RDTB 5AYQA 1P7KA 1MSPA 3QHFH 1HH9B 3HLAB 4KFZC 4QRPA 4MA8L 4XI5D 1FIGL 5LGKA 3BKML 4LPXA 4MSWB 3SDAB 1FVDA 1GHFL 1EEZB 1YN7B 4U6VL 4PRBA 4DN3H 4UU9B 4HGWB 2Q7YA 2W65B 1KJMA 4R8WL 5HPMB 1BAFH 3ZKQD 2HJKB 3LS4H 4L4TE 2WWMC 2PO6A 3ZT6A 3VI4E 5J12B 3CFBB 3BHBA 4TULH 2R23A 3G5VA 2BHZA 4FQXA 1ZHNA 4U4BA 1UWXK 2Y36L 1DLFL 4QHLB 4FQ2H 6FABH 5DD6B 2AEWA 1R24B 3HFML 2DYPD 4JG0L 1H8NA 3GSRA 1DBBL 5E6ZA 4F2MB 2DTMH 1X5KA 1CIDA 2PF6A 3GK8H 4NHUA 4XCFL 3RWFA 2ARWA 1LD9A 2FSEB 4MA3A 5J8OA 1A2YB 3EO9L 5I1GH 5F7WC 4PGCA 4GG6E 5GSRB 2B39A 4FXGA 1X5YA 3RL2B 1FQ9C 2IMNA 3BP7B 4GRMA 4LSQH 4RFOH 4OM0H 4YE4H 5T3ZL 4HFUH 4QHMB 4M7LH 4PRID 1TZIB 5D2LF 2KDGA 5AZEL 1BEYL 2C5DC 2CIKA 4XBEL 3Q3GB 3BEVA 1MLCA 3BDYL 3T0ED 3WN5C 5FYKE 3IDIA 3OZ9L 3OKLB 4FTVD 3X14B 1DN2A 2V6HA 2VXTH 4PPTA 1NCDL 2VLJA 5KZCD 1BMGA 3S36L 3ARSA 2B4CH 3E6FB 3NCFB 2RFXB 4S2SA 1MIEH 1S7QB 1CCZA 1FNAA 3D18B 2ZCHL 4GH7B 1HE7A 5ILTH 1GC1H 3VFWA 5C0RL 5K9JH 5B38G 3WNNA 3VWJB 3PP4H 3GI9L 1HHGB 3HMXA 1NBQA 1L6XA 3S36H 1CZ8H 3RUGF 3UBXG 4YLQT 1NGZB 3LOWA 5KVGH 5DWUH 3QRFM 1NPUA 4OQTH 2W0FA 4LCUB 4DQOH 5D7JC 4NO3B 5IFJB 1BIHA 5AEAA 2CK0L 4ZTOH 1YZZA 1MREH 2DS4A 5HHNB 3N1GC 3MMEA 5IJKA 3B8YA 4AZ8A 5CBEB 5JA8B 5IK3B 1HH6B 5IR1B 1KJ2A 3B8SA 3SDCC 3VFOA 1KBGL 5F88B 3GFUA 1JPFB 4FNLH 3V6FA 4HWEH 5HYJB 1KENL 5J12C 4OLEA 1I7UA 2JB6A 4LMQI 1H3WM 2YA2A 1JI1A 4NJAH 4DUVA 4NCC2 3MRRB 4DTGL 1XZ0A 3PJSB 2LQRA 4KUZH 2W59A 2ADJB 1S7RB 5TPWH 4EN3C 4XBGA 2DQFB 4PGEB 2CIKB 5DC9B 1LK2A 3S6CA 2C1OA 3M45A 2FX9L 4LLWA 4CNIA 4XNUH 3BWAA 5JXEA 2BFVL 4MNHB 1MUJA 2NZ9C 1EEQA 3MV9D 3DGGA 4I2XE 4NUJA 5I19H 2R0WH 1IKNA 4N0UE 1WT5C 1DVFC 1GL4B 4OCNC 3TT1H 1E4JA 2W9DL 2R29H 3DXAB 5DQDH 1JPGB 3BZDA 1AGFA 1FE8H 3S5LB 1EBAA 1NCWH 5ICYB 1G9NL 3ARWA 1OTSD 1T0MB 5FA3A 3NZHH 4YDLC 1UM6L 2MSPA 4KMTL 3OB8A 4WGWB 4BZYA 1NBYB 3ZT7A 5IWLA 4HS6A 3TESA 1KT2B 3W11C 4YR6B 2R1YA 3B5GA 4GLRI 1FPTL 3OAYK 4IIQA 5CEXB 1R3HB 1ZLSH 3VXRE 3WFCL 1MCDA 2DIBA 5BMFH 3BIKA 2VDRH 4PRNA 2VQTA 1EEYA 2DQUH 4R7DA 4N1EA 3GJEB 4UQ2B 5F7LB 3MBEB 4ZPVB 2B8OT 3RDTA 2GTZA 2J5LB 4JFDD 1DUYB 4GLRH 4Z77A 2XZAL 1YYLH 3QEHB 3MUZ1 5CJ8A 5J3HC 1QSZA 5IMMB 2OXGA 4M7KL 2B7DT 5EIQA 1ZA3B 4OGXL 1NC4D 3QWOA 2DQUL 3VXUD 4P5KB 5GZNC 3O3EA 4KQ3H 1ETZA 4NZTL 1OCWL 1UJ3B 4KDTA 2F5AH 2ZNXA 2ADJA 2OCFD 4FZEL 1R24A 2VJXA 1U3HC 3MCLL 4YGAB 4C4KT 3H42L 4OCSH 2NY4B 3EAKA 5ID1B 4WHTA 1BWMA 4AJ0A 4BSVA 3PWVA 1EHAA 2YPKA 4G6JH 3V4UH 1JTTA 4WWKC 5E2TH 1LE5B 1LEIA 2CRIA 5F96L 2ZOKB 3ILPB 5D8JH 3I9GH 3MRLA 1VEOA 4ELMA 5IFHH 3MMEB 1Z0NA 3LZFH 4GRLB 5C08A 2DLFH 4JFDB 1AQDB 1P7QA 4OAWB 5IFJA 3WS3B 1QYGH 4UU9A 2NY6D 4B50A 4JFED 3MFFA 3HNTH 1JYWA 1GC1C 2W65A 5B4MC 2VLRA 5L8KB 2PR4L 3VFMB 4JM4H 1N59B 3DX7A 3RVVC 1B0GB 4WJ5A 2WQ8A 1ED3A 1MFNA 1OARL 3O3AA 1MFBL 1CVRA 5GS2H 2IAMD 2GEEA 4U1SA 4HXBL 4M4RA 2JJTC 3IFPB 4LHUG 4QRSB 1R5WB 4YEEA 4MB4A 4XI5C 5FGSA 1AD9B 1WAAE 5K33A 4WFGD 5DMGC 5I0DA 2DWEB 3OKEB 1QBLL 5MP6L 1X6LA 3BDXA 5IP4A 3C5SB 2I07A 4PJBA 2FO4A 4MA7L 2OP4H 5BXFB 5AG9A 5DURB 1A3RL 3BESR 1K8IA 4FMKA 5JOPE 4JQVA 3IJHB 1F4YH 4LSUL 5BS0E 2F5AL 4V1DD 1YEJH 3UPCA 1QLRB 3O41B 1QLEH 2I9LA 3BKCL 3QUMB 1DE4B 4R90L 4B7LA 5HYEA 1KCSL 4NWUL 5E2UH 3O6KL 4YDIH 5F7EH 3VFGL 1XGQA 4HUUA 3MLRH 4IIQB 5DJCA 5EIIA 3GMNA 1MF2L 5FO7B 2NX5B 1W72L 4L8SB 2DM7A 2JJVA 3HMXL 5CEZL 2IALA 4YBLC 3DBXA 4GT7A 4I48A 3GJFK 4IRJD 4OUUB 1OOAA 4NBZB 3BO8A 3BHBB 2AQ1A 4L3ED 4J8RA 4N1HB 5BVPL 4R2GB 4N8PA 1W8OA 3GNML 1T20A 4P5TA 5FKAA 5KBNC 2OL3B 1I3RA 2P5WD 4O2EB 3IU3A 4CN4A 5CEZH 2WW8A 3PGFL 3DECA 5FHAL 3HPJA 3TA3A 2XKUA 3AB0C 2OXHA 1AGCA 5I18H 5HHOD 3CPLA 2VXVL 3EYVB 4XCEA 5MERA 3LQAH 2H6PB 1YJDL 4L4TA 2FRGP 2DJSA 1XCTB 4J3UA 3T0BA 1GOGA 1S7TB 5IVXF 3C5ZB 1ACZA 4NUGL 3TZVA 3FQUB 3NPSB 1BX2A 2Z4QB 4Y8AA 2O5ZL 3ZHDA 2A9ML 4Y4HB 1R3HA 4L9LC 2ZKHH 4FTVB 4LMQE 4NBXB 3U0PA 1FVCA 3SPVA 3WXVL 4YEFA 4R4FH 4QKXB 5F9WC 5FM8A 4ORZC 5B39G 3QEGL 4GAJH 3V5KA 4HUNB 1HCFX 1KT2A 1BIIB 4AH2A 3U9PL 3KYMA 4NQED 4DKEH 4B5EA 4LBEB 4R8WH 4NPYA 5FGRA 5IMLB 4CDGC 3GKZA 1MJ7L 2FNBA 3QFJE 4JFFE 4Y7MA 4PB9L 5TPWL 3ZDZE 2MWCA 2P5EE 3Q6FB 5J6HA 4X5WB 4QRTA 2GJ6D 4ZYKB 3M1BB 4P23B 3C5SA 4JZJC 5CILL 3QI9B 4DFIA 1FLRH 4LVOC 3ZDYF 3BT2L 4MNQE 3QUXC 5ANMA 5E08L 1RIUH 4NO0A 1EJOL 1T1XB 1M05A 4PGBB 2BSTB 3GSOA 3B6SB 4HUMB 5MI0C 1HN1A 1JPGA 4ETYA 1J0ZA 3QIWC 4KK8D 2DD8H 1CDCA 2LV4A 3V4VL 3WN5A 3QFDA 1TXKA 2APTA 1UFUA 4QTHA 4YDKL 3WBDA 5SX4I 5CIPA 3HUJF 3DGGB 4PJAF 3WFBH 4NGHL 2D7PA 5KSAC 3RFZC 2V2WA 1NCCH 4YBLB 3PGDA 4U1KB 3LD8B 4ZS6C 1T5WB 1C08A 1V3MA 3B2VL 3MR9A 2I07B 4MHHG 1ZV5A 5CZVH 3MRNA 5E00B 3BPLC 5IGXH 4CVZA 1RUQH 3C5ZD 4X9FA 1E6JH 1E4XL 4NN5B 2X4NB 5LAXB 2F74B 2PXYB 4MDJA 2R4RH 4EVNB 4PTUB 5IV2B 1P4BL 4UB0L 5CILH 1W0VB 4LSUH 4RSVA 2AK1H 3A67H 4OBSA 5I8KH 2YOCA 4G3YL 2HFGL 4R7DB 3QQ4B 1WT5A 4HJGB 4KAQL 5DD0H 2IBZY 5C70A 3PDOA 3A6OA 3SQBA 3VFTA 2Y36H 2GJ6B 3I6GA 1FRGL 3RBGA 5E8PA 3PP3H 1KCVH 2J8HA 2Q8BL 3VGAB 2YZ1A 4U6VH 1TVHA 3ZTJH 5SWZA 5DJ8A 4JRXD 2PR4H 2OTUA 1HKLL 3DURA 3KGRA 1I7RB 4IRSB 4KTEL 1RULH 3HR5B 1NFIB 4N8VB 1MCRA 5FYJH 5CP7A 3KG5A 3MRIB 4IMKA 3CXDL 2X1PA 2A73A 3A6CH 3B43A 3CFKB 4M6MH 1LK3H 3E3QC 2CUIA 5GRVL 1WK0A 4LCWE 4ZAKB 1TZHB 2HFTA 1QACA 3GHBL 1RZ7H 1HXMB 2RAMA 3EJZC 3ABZA 3ARUA 2XZQH 4DKAA 1A7RH 3J8F7 3TN0B 1T7ZA 5CP3H 4JKKA 2NY4C 1CQKA 4H20L 3V0WH 1BD2D 1ONQA 3FO1B 3NH7L 4LLMA 1MCLA 4NC2B 1A4JB 4RMWA 3ZYIA 4EDXB 1O5DT 2PXYA 4BSWA 1OM3L 3GI9H 4WIQA 3MCKB 4I9WD 4J8RB 5I9QB 5IV2A 4LK4A 2XXMB 5T3ZE 3V0WL 1JGVL 4K3JL 4M61B 5KW9L 3JV5A 4IOFC 5DK0B 3X13A 3GMLA 4RGOL 5ICXA 1A7PH 1OL0A 1XGUB 1ZT7A 5JPNB 5HTSA 1NEZG 1UH4A 2OTWB 4PJHB 4PV8A 3H9SA 3BD3A 4OCRH 4WFGE 3AGVA 1AR2A 4M02A 4GXUM 5AUMA 2VDLL 4L5FH 4XPFL 4KRPB 4Z7VB 2XWJB 3CVHB 4YUEL 5JORA 4G8EA 1B4RA 4G7VH 1G0DA 2PTTA 3KYMB 1XCTA 1FL5B 5ADPH 4I3RH 5FB8A 3D39E 5JHDD 1FZJB 4LLYA 2DLEA 5CSZB 3VCLB 3U2SB 5E8OA 2A73B 5GHWH 4LFHD 3ARFC 3THML 4OCWL 3MRFA 4PJ5B 2YBRB 4C56D 2WV3A 5HDQH 1VKXB 5T33L 1OSPL 1S9XB 3AMKA 4EBQH 4PJEE 2JKXA 3WEXA 1N64H 4NZJA 2UZXB 5DVOA 2DQCH 4R9HA 1JVKA 4JO4L 5E99L 5C0CA 3BUYB 1FNEB 5K59F 1S7WB 4RWYH 2OR7A 5JIIA 4KK6C 3B6SA 3BGMB 3OGCA 4HBCH 1ZVHA 3CDGB 1ZOXA 4PJ7F 3T3PE 2JF1A 1NUFA 5HDLA 2EIZA 4OLXL 1XAUA 2P44B 1VSCA 3T8XB 2WINB 3GJFA 5EORH 1P5UA 4ZOEA 1B4JH 4UUJB 1QR4A 3CGTA 3WN5B 2ZUXA 1YN7A 4WHCA 4FG6D 5ALBL 3CXHJ 1FGVH 4LU5L 4MJ6B 5FF6B 2PYFA 5JDSA 2DF3A 4KZDL 4TVSa 4Y0GA 1D6VH 5GGSB 4QTIL 3MRHB 1BQHG 2NTFA 4MXQC 3GSOB 2MQCA 2BXYA 5KS9E 3P77B 1U8LB 3I50H 2E6QA 4OD1H 1A6WH 5CJBA 5HHXH 1BLNA 1DFBL 1MCQA 3VRJA 2JCCA 4FFZH 2KBGA 2FHCA 3ROLB 4JREB 1N2RA 4OTXL 1VFAA 1J8HD 4ODXB 3EZ8A 1G7QB 1ORSA 3D0LB 5JMOC 2LU3A 4NN7C 1CXIA 5DD1H 3GMOA 1MCPH 1OGTA 3GHEL 4UIMA 1QLRA 3O41A 3W82A 5ADOL 2CGRL 4MNGB 3VXSA 4GW4A 4G6KH 3LS5H 5F21B 1MAKA 2V9RA 3G6AA 4YWGL 4ZMAT 2DD8L 2YC1B 5D6DC 1QNZL 2YR3A 1TZGL 2Y5EA 3VI3E 2G5RA 4PY7A 3VXRB 5J06A 3F5WA 4JB9H 1WBYA 3BZFB 1F6AB 4GOSA 1BGXH 3V6OA 4PG2C 1DZBA 3HC4H 3ULUL 5DO2D 4PGDB 5A1AA 5D96C 1IZKA 5IMOA 2OL3A 5D6DA 1WLHA 5L2JA 4JGMA 2RJMA 4EIGB 1LO2H 4P9MH 5F1IA 5DT1H 4ZD3L 5JOEA 3BZEA 1S5IH 3BE1L 4DAGH 1QRNB 2CUMA 3HI1B 5EZJA 5B39A 1JRHH 2GI7A 3CPLB 4MZ2A 4NJ9H 5KANI 4O2FA 5I1IH 5J6GA 2DLHA 3KYKH 3MRFB 1WIPA 4PJ5A 4DZ8B 1YEJL 4QTIH 1P7HL 4JDTL 4PJEB 4KK9C 1F11B 5GGQH 2X4PB 5JW5A 4JFXB 1SVCP 4HZLB 4G8GA 4JO2L 4XP1L 1O0VA 4F8TA 4PD4J 3ZKXC 1KB9K 1XT5A 4Y8DC 1N7MH 1VACA 4XWGH 1H3TA 3BW9A 5ACZA 4ZAKD 3S37L 3Q6GL 4MCYB 1ORSB 2IWGA 3D0LA 1D9KD 4U1NB 4P5TC 1U2CA 1HOCB 1O7VA 1KIPA 3AS1A 2EDFA 4WFFD 2Q8BH 2F8OA 1MNUH 1PAMA 2BZDA 4B7IA 1GGBL 5KSVA 1MRFL 1NAML 4HIXL 3QDJE 2A1WH 1F4WL 1HDMA 4JPWH 5LWYH 1U58A 3T04D 4NIKB 3SDAC 4OLWL 5DJ8B 1IGIL 4QYOA 3B83A 4NN7B 5F7KC 5HI4D 3ZTNL 2FX8L 3MBEA 4MD4A 4ZPVA 1Q9KB 2DM3A 2AK4A 1DANT 1FNLA 1OT1A 2PKDA 1S5HB 5DA0B 5IESL 2EEDA 3FB6A 3FO9A 3VXMB 2PTTB 1PYWB 4TRPL 4AEIL 4M7ZB 4RAUA 1HYSD 3VGGA 1NSNL 3CDYA 1YEDB 2APFA 4AM0B 5GZND 1G7MB 3E2HC 3GI8L 1HK6A 3KXFA 1P1ZB 2E6PA 5GS0D 2H1PH 3KPLB 1CU4L 4HDIB 5AZ2H 4FFWD 5IB3A 3MV9E 1NSNH 4QXTB 1CZ8L 4LVNB 4NQSA 1TJHL 4S1DC 3SJVD 4CKVX 2ZP0T 1VKXA 4C57C 3SDXB 4OCMC 2EH8H 3NCBB 5HYJA 5J4MA 3S34L 1U8NB 4HUVA 5CCKL 2LAGB 3DSNA 2EO1A 4YO0A 3FQRA 3QUXA 3RTQC 1MRCL 3GSNH 2XTJC 4OV5A 3ARQA 3H2WA 4JHAH 5KVMC 3FZUD 3LB6C 3LEYL 3KNBA 2UVEA 4MNHA 4GS7C 4X9BA 3MACL 4XVUD 2D03H 2DQFA 3H3BC 2BXZA 1B90A 1A6PA 2VKWA 2XWJA 3QDME 2OMBA 4X6BB 4M6OH 4OLYH 3MRRA 3IDYB 1S3KH 1YYML 2DWEA 3X11A 2I5YH 1MLBB 3WNPA 4S1SH 4MAYB 4HK0B 4BKLA 1X4YA 4I9WE 3SCMC 1TCMA 2IPUK 3Q5TA 3MA9L 2EDJA 1YMMB 4BH7B 2XPGA 3FQXB 3HZVB 4ENEC 2ICWI 5HHPA 3PDOB 1TQBB 4EBQL 5K9OA 4X6EA 1IT9L 4AT6B 1JZ2A 2QADC 4S1SL 3BZ4A 4EDXA 1V3JA 1QLFA 1T2QL 3QDJB 4C4KO 3CSGA 5B3NA 2G9HA 3S3PA 2Z35B 3HG1D 1UZ6E 4FP8H 1QFWM 4RWYL 1RK0A 2UWEE 3RI5F 4R4BA 4F7CA 2RIKA 1KTRL 2FL5A 1DQJB 4U31A 1CTOA 4EI5C 2KQMA 5TDNA 1LGVA 1G6RB 4BH8A 3DI3B 4RIRA 3L5WA 4UTBL 2M2DA 2C9AA 3WL9A 1JGLL 2F54D 4UDUA 4ZPTB 4YFLI 5KSUA 4N9GA 4NN6C 2JIXB 3CVIL 3ZTJG 5C0FA 5J56B 1UCTA 1VA9A 4X9GA 2P49B 5F70A 3SY0B 3VH8G 4M93B 5ERWB 3L5XL 2AJSH 4GBXD 4M5ZL 3MJ6A 3L7FB 4YK4B 5BS0A 1KOAA 4Q0XL 4UQ3A 2H9GB 3RL1A 4L4VA 1KV3A 2CGRH 3IDNA 3G9VA 4H25B 1BBDH 5IG7A 1NFDA 4TQEL 1B0WA 5IB4A 4FQQA 5D72H 1F45A 5C71A 4FN0A 1BEYH 4XBEH 3WUWB 4EN3A 5M94B 4BH7A 1ZT1B 5LBSH 4MZ3A 1A4KB 3MGAA 1IAIM 2VTFA 4N0CD 4QYOB 2E7CA 4FQ2L 3VJ6A 4EOWH 1NCTA 3FMGL 2AJ3B 4NNPH 2VISA 3C5ZC 1R3KB 3VGHA 1U58B 4JJ5B 3D3VB 1MEXH 4PG9A 5MEPB 3LCYA 1T89A 5I1GL 3W0WE 3EYSH 5F7YC 1MWAH 3GMPB 4PREB 3RWIA 4M03A 2ZUQB 3LDBB 2GK2A 2CH8A 3NN8B 1JBJA 3QJHA 2NY3D 4E41E 2J4WH 1TJGL 3IU4L 5IM7B 4P9HL 4NQVB 2IADB 4LAQL 3SCMA 5MERB 3MYJA 1MQ8A 1SJHB 1UXSA 4LOUC 4X6DA 5BXFA 5D1ZB 3UTTE 3ARTA 1G7QA 1MLBA 3UTQA 5BOZG 3SY0A 32C2B 4JZJA 1N26A 4KWUA 5GGQL 3HRPA 3MOBL 4NC1C 1XF2B 3OKMB 4RGMB 1EA9C 3TO2B 3HB3C 3TBWB 5LG1A 4NUGH 3EGSB 3WIFA 1IILE 2Z9TA 4QGYA 5JZ7D 2IJ0C 4FTVA 3TBYA 2BNQD 2CLVB 3V52H 4NQCA 1WISA 2AGJL 3S3SA 3KYNB 4LLQB 2IGFL 1OAUH 1RFDL 4LRNL 5A3IC 4XT1C 3KNBB 5F97E 5HGHB 1KNOB 2J8UB 5HGDA 2FJGA 2AV7A 4ZTOL 4GAFB 4G7VL 2C4XA 1IAOB 1VERA 2P5EA 4H26B 1IQDB 2HTLC 4K3JH 4ISVB 1SBBA 2NXYD 2EC8A 2HT4D 4PP1D 5BRZD 1CE6B 2R0LH 4NKMA 2ICEB 1EMTH 5FEBA 3IS1X 4XX1E 5IEKB 5JQ6L 3M1BA 4NQXA 3H8NA 3E6HA 1S7XA 4I5BB 4Z7OF 2OMNA 5BVPH 4O2EA 3RGVD 4G42A 3P4OB 4GRLD 2P43B 2Z8WC 3FL7A 4IBLT 4ODSL 4NQSB 2FD6H 4Y1AD 4S1QH 3S4SA 2D7OA 3SQOL 1EIBA 1A22B 1LE5A 1RZKH 4NO0B 5BOPA 4W6YB 4AQOA 3I3EA 2V5YA 2VKXA 5DHVB 1QBML 4GKNB 4WW1A 1YEFH 3U0PB 1F5WA 1KFAL 2W9EL 4WY7H 4LP5A 3MLWH 3P0VL 4OZ4A 1OAZH 3OG4B 1KCUL 1LO4L 4MCYA 4DEPB 3U82B 1G9NH 2GY5A 3PABB 5JMRA 2ARJA 1JPST 3DX7B 4OKVB 4DK6A 2XY2A 3RUGB 1PG7W 1Q0XL 4PGCB 2YPLA 1LWRA 4NCDA 2VH5H 4YHYC 1FVCB 1R5WA 3MXVH 4MYWB 3MNZB 4YK4C 2Q86B 4D3CH 5C1MB 1B4JL 3AS2A 3HE7C 1U8JA 1J1XH 1U92B 2B1AH 4RAVA 2R56L 2YSSB 2JJTA 3BWUC 3QPQC 4DVRH 4LGSB 1OSPH 1OAQH 4HCRL 3ZYOA 3TO4A 4KROB 2XN9D 1IAKB 3QXDA 4F37F 4A2LA 1JRHI 3C2AL 3JTSB 4MAUH 4PJAA 1S3KL 4LCIL 1H8OA 3HKFA 4I5BA 4JO4H 5E99H 1A6TA 4K7PL 4POYA 4P3WA 5E8EA 3OGOE 2VLKA 2AJXH 2EE2A 5F7DA 8CGTA 4Q2ZA 2JELH 2OZ4L 4Y5YA 1KTLA 2X4QB 5C0BA 4PGZA 2OJZL 3DROB 4EKXA 3CXHK 1MFCL 3TH3T 3C9NA 4ZOCA 3ZSSA 3EOAA 1RJZA 3ARDC 4P4RA 5CP3A 3NTCH 3V5KB 3DUUB 3DRQA 4MJ5B 4OZ4B 4KMLB 4LSSH 4MD5A 3P0VH 1ACYH 1ZHBB 3LHPH 3A0OA 2WK2A 5E6IC 4GRWF 2OTWA 1N8ZA 1UKQA 3GKWH 5C9KA 4WUUA 3O4LE 1FZMA 3MRGA 3S36X 4ESKA 3DV4B 1CICA 1FORL 2NY0B 4IJ3B 4RIRB 3CFDB 4HIEA 3B2UC 1OWRM 4G42B 5KSAB 3HZYA 4HKXA 4A2MA 2DBLL 4MNQA 5HGAB 4GXVL 1OP5K 4XVSL 2P48B 5CJOH 3FB8B 2CPCA 4IMLA 5CBAB 1LO3H 3QBTB 3SGEH 4L29B 4JE4B 3RPKA 3VWKA 2VDRL 4QRUA 2NPLX 4H8WC 2DI7A 1EUUA 3BSZL 3QRGL 1QFUL 1WBZB 4LLVA 4NC1E 3HI5H 4NSKA 4U3XA 5IIEA 3W39A 2FEDD 5D7JD 4LSPH 4UI2A 3GIZH 1DSFH 3ZLQC 4NP4L 4ONFL 3QIWB 1KEGH 1QHPA 3SO3B 4H20H 1B2WL 3O2DL 1R0AL 1MJUH 4KJWC 1Q72H 1NCAH 3RAJH 5JOPD 4OFVA 1KNOA 1AHWA 4G5ZH 4I2XB 3CLEH 3B9KA 3TBYB 2DQTH 1P84K 2BSSB 5BZWA 5ISZA 3NA9L 1FO0B 4ZNCD 2CDEA 1KJ3L 3EDKA 1CLCA 3CMGA 3IXAB 5D1XD 1QLEL 3P9MA 5KZCB 3PV6A 4TULL 5L2KA 1T2JA 3FO1A 3VFOB 4XNMB 4UV7L 4H26A 1FFRA 4EI5B 5FFLA 4M6OL 2GT9B 3STLA 4IS6A 1IVLA 1CDUA 3QDGB 1RZFH 3AAZA 3QPQD 3ULUF 1QFWH 2J8UA 5HGDB 4AEHH 1MRFH 4P4KB 3GSQB 2QHLA 4ODHL 1BQHB 1MI5D 4PJEF 1T7VA 2CR3A 2HN7A 5DMKA 1SJVA 3L3OB 4S1RL 2CK2A 1K8DB 4YDLB 2P5WE 1QPPA 3IYLW 5DVNA 1KIRB 3QWQB 1ZXQA 5I17A 1ZAGA 1A02N 3FQXA 3O6FC 1LO2L 4IM8A 1MVFA 2X9YA 2VQ1A 2X4NA 4MJ4A 4JJ5A 1G6RL 1KN4L 3MCKA 4WY7L 4JFYA 1JGEB 5HJ3A 4KI5D 4WNQA 5I1IL 1ZA6A 3TFKC 5KVFL 3ZKND 3AY4C 4MCZB 5DWUL 3QIWA 4X7CC 3NMEA 4LCWB 4MQ7A 5DRZA 1FGNH 3QH3B 5LJYH 4GFTB 2FR4B 5AZ2L 1NMAH 4UINL 5EUOB 4XHJC 4JFPA 1QHOA 3TA3D 1Q72L 4EZMA 4JY6A 3B3IA 3FQNB 2ATKA 1UWGH 1JGVH 3QUZB 1MVUA 1IAMA 2EIDA 4PJBF 3D18A 3V6OC 2CRMA 2ED9A 3SDAD 4AQ1B 5DC4B 3RWHA 4N8CH 4R97B 1A9EA 1C12B 5DXWA 4YDIL 3GBNL 4K3DH 2FATL 5A43C 3LH2L 1G9EA 1UWGL 3SOBH 4Z7VE 3F8UB 5FOBA 3L3GA 1JIBA 2CRZA 5GS2D 5ICYA 2MCPH 3M8OL 1EXUB 4KQ4L 3HNSH 3T1FA 1PDKA 1MIML 2GJ6E 4JFQA 4P2OD 3LN5A 3FAWA 3PWPA 4KK8C 3NFSH 4LARH 1W0WA 1TQCB 5GGTL 2IQAA 1BVKA 5F89B 5IESH 3FN3A 4ZO8A 3TPUB 4KJWD 3QO0A 4X4YA 1CI5A 1RUKL 2Z92A 1F00I 4XMLH 4JR9H 2GK0A 5C86A 3ZKXB 1JYNA 4I0CC 4OCYL 2HJLA 3L3IA 5KOMC 4JFHE 2EDBA 3IDJB 1TNNA 4CAGA 4Y4KD 4JKPL 4DN4L 3V0AC 5E0QA 1RJCA 4K94L 1U3YA 2KQNA 4F9LC 5EBMA 3DVGB 4LPUA 3JUYA 4XCCH 3I6KA 5J13C 2W38A 5F1SA 4PJHA 1JGDA 2CDEB 2DAVA 4KROD 4POUB 1F3DH 1NCWL 5E03A 1QQDB 4OQ1A 1WJ3A 5FCUH 3LKOA 2XZZA 4O58H 4N0YH 4HIIB 1PEWA 4K3EH 7CGTA 3GIVA 4MVBD 4R0LC 4Q6IA 3T3PF 4LAQH 2HT3D 3QUZA 3IRPX 1YECL 1MRDH 3VXMA 4X5XA 3WJLA 4L29A 3I2CH 1JRHL 1NAKL 3KYAA 5D5MA 4EUPB 4HSQA 3VFRB 2MPAL 3I6LD 1MCHA 3FOMB 3SDYL 3VWJA 4OCLC 1LEKB 4CADA 1GSMA 1FNHA 5CBAA 4OGAD 1LE9B 4JFOB 4U1MB 3EOTH 4QF1A 2NW2B 4MXQD 5E8DH 3JXAA 5TE4H 3NOIA 4HKZA 4WI2A 4M7KH 3IXAA 3VFPB 4PV9B 1YY8B 4KRMB 4BQ6A 3REWA 4WUUB 3CCHB 3QP3A 2FZ3B 3JTTB 5T1LA 3OSKA 5I66A 3E8UL 3EYOA 2YK1H 3C9NB 1GZPA 5HD8C 3OXSB 1ACYL 3C08H 3VD5A 5DGQA 3U1SL 2AKRA 3H0TA 5FDWB 3B9VA 1A9EB 4L1HA 3PHOB 1W0YT 3RVWC 3RWDB 1U91B 4OM1H 5IEKA 1FFOB 4XP6L 2VLKB 4KKLD 1QA9B 2VLRB 2EZ0D 15C8L 4U0RC 3KPQA 2ID5A 2ORBL 2OK0L 2DWDA 2ADIB 3ZSTA 2ZUVA 3G9AB 3QA3A 4JJHA 1JPSL 3B5HA 5CGYC 2X7LB 2FECI 3LKRA 4NQDD 1YEDA 2JTDA 4XXDB 4LHJB 5E9DD 4MNQB 3EOYG 4UT9L 2ICWJ 1FL6A 3F7VA 5F93C 3G6AB 3B9KB 1ZGLM 1QO3A 2I60L 2PO6D 1JF6A 3EYFB 4GBXC 2QQKL 3TC9A 3BQUB 5DJZB 4M6ML 1F4HA 3MBXL 3KPRA 2DQGL 3NCEB 5CWSA 1IL1A 4Q9BA 4BFIB 1QEWA 1LVEA 1INDL 2DYPA 1A3RH 4L8SA 4ZS7L 4LSQL 5E4IA 3UJIH 3P4NA 4XC3L 4H88H 3KPSD 1INEH 4PJGE 4P4KD 4UBDC 2CIIB 5I16A 4U1NA 4QWWC 4ONGL 5D1ZD 3RUGA 1MFDL 4U1IA 4WTZA 1FFNA 4NJAL 3ULUC 3O6MH 3AY4A 3LY6A 1GAFH 4P57B 3UXFA 4I77H 2B1AL 1T89C 3MLYH 5DD0L 1ZHKB 1EDQA 3ARGA 4PJFF 3MRBA 1QFWI 3ILQD 4F7EB 1VB9A 3DXAE 4JY4B 2R9HC 2V5TA 4Y5XA 5F3HB 4Y4FB 3QIUC 4YDJB 1NCBL 2XI9A 2QL1A 4L8DA 3UPRB 2FEEL 3JTSA 1IEBA 4WO4D 4JRWA 4JPKH 3I75A 1T5XA 1LDSA 1T20B 1Y0LA 1J0YA 4YHPB 4XGZA 4PGBA 5D93C 3BP4B 1WZKA 1TNMA 4JRXB 3FB5B 2ITDB 2Z91A 3HZKB 2X7LA 2LU4A 4RGNB 2Q3AA 1FJ1B 3G04A 4N90E 1NLDL 3GBML 4F8QA 3W5MA 3QG7L 4G43A 1WFUA 2XYCA 3MROB 1VFMA 4AM0A 4UT9H 1TJHH 4IRSC 4C56E 2V9QA 4OZGE 5IHZA 1R5IB 3VG9B 4KY1H 1BP3B 2F58L 1A7PL 5CGMA 2VSDA 2Y7QA 1M1SA 2Z92B 4P5TB 5FKAB 1IGCH 4HJ0C 2NY5L 1KFAH 1B0RA 1BZ7A 3RHWF 4GKSB 3S35X 4JANB 4X4MA 4X7TB 2G60L 2A6DB 2QHRH 4JRYA 5ISZE 4LPYA 1P4IL 3MLUH 3SE4C 1ZVYA 3QEQA 5DUBA 2QBWA 3QR2A 2R8SH 3L5IA 4OKDA 1CICB 3T1FB 4DWHA 4CW1A 1A7NL 1HXYA 7FABH 1CN4A 3BP5B 4NKIL 4LVOB 4XC1L 1LEKA 3OPZL 1IBGH 2IPKA 1FL6B 5T1KA 4I4WB 4PTTB 5JXED 1CFVH 2VDPL 1FLTX 4NQVA 3EFDL 4I0PA 1LMKA 4P2QD 5EN2B 2WUCH 1FNSL 4HJGA 3C8KA 4N8VG 2FLBT 2HVKB 4HLZH 5BQ7A 1RIUL 1LILA 1VFOA 4YQXH 2AV1A 3PQYA 3WHXA 1RJYB 5K9KB 4WNQB 1URLA 5IQ9A 5FYLH 3DETD 4KKAD 3D85A 4I1NB 3PXJA 3TBSB 5FUCE 4LPTA 4GRWH 2DIAA 3F7YA 4MAYD 1B0GA 4WJ5B 3FMGH 4KK5D 4ENED 1YY8A 1MFBH 3NIDF 3DJ9A 3RP1A 4HAFA 4LLAA 2X4TB 3QA3B 1HWGB 3BEVB 2DLFL 3O2VL 4U1JA 3QZWG 3UDWA 1M4KA 1C1EL 1QBBA 1WAAF 2NY2D 4ZPTA 1UZ6F 4WO4C 4OB5H 1ORQB 1UXWB 3LD8C 1TZHA 2DQEL 5ESVA 2HFFB 2Q8AH 3QIUD 4XNQA 4WUKL 4NP4H 4MS8C 1F58L 5GRJL 2P7TB 4QLRA 2E7MA 2Y5TA 1FO0H 4Z7VA 2VDMH 3MRMB 4BYHA 4F33A 3QUYB 1IGMH 1RSFA 4IOSD 4MNGE 2VITB 3RIAF 1AXSB 3SE9H 5T1LB 5I66B 2YEZB 4F3FB 4XVSH 4ZUSB 2MOVA 4RGND 2JB5L 3RWIB 4JN2B 4L8CA 5CKGA 5HHPB 3KYOA 2EYTB 1FFQA 2E5EA 2YUWA 4OZHB 1LDPL 5K59E 1CWVA 1I8LA 4WTXA 4HIIA 2JB5H 1RIVL 5EH1A 3AXLA 1TETL 3BN9C 2ZCLL 1ZLVK 4ZFGL 3V9FA 3E8UH 3HMXH 4HUWA 4APQA 5LXGH 3B3IB 4MXWL 5D7LB 1U36A 3QI9A 1DQJA 1T7XA 1YMHA 4XZUB 1I9IL 4L3CA 4H25A 4UT7H 4Z5RB 4OM0L 4YE4L 5E5MB 5C09A 2J5LC 3H3KA 2AEIT 5IBUB 3G6JB 1IQWH 3BH8B 1FYTB 4JO3H 1FVDB 4QHUA 3H9SB 1DDHB 4WCYH 1XR9B 3UPAA 2F74A 3LQMA 2LAAA 3BDYH 3DYOA 4X4XB 3HE7B 1A5FH 3KVQA 1P7KB 3RX8A 2EDRA 1I1CA 3N9GH 3HAEG 1IKNC 2V2TA 4EI6A 5JXEC 4IRJB 2JJSC 1UH3A 4J2XA 5C07A 5KJRL 4FG6C 3UO1L 5I71C 3MXWL 5I19L 3VU2A 2R1XB 3D69B 4YFEA 3BN3B 25C8H 4OI8A 5D5ME 2QSTA 5D96B 1KPUB 2XZCH 1U8QA 3M17B 4R97C 4M6NH 1FIEA 4PJ9B 5ECJE 3QUYA 3AC0A 4DOHE 4HUXA 5E1AB 2BMKA 1I7TA 1GGBH 2NLJB 3SCMB 3DUSA 5DFVC 3VXNA 8FABA 4JDTH 3O8XD 3W81A 3R06A 4R6UA 1UA6L 3W5NA 4XPBL 5B3JE 1WCBA 3I85A 1PSKH 5E4EB 4XMPH 4P59L 4LLDA 1HI6B 3UJTL 4X99B 5CMAB 1KGCE 2D03L 5HDBF 1I7RA 5MEQB 5T1KB 3X13B 5L0QC 2XG4A 2Y06L 4BFBD 3ROOB 3BGAA 3CFBA 4U1LA 1U92A 2B5IB 3KPNA 2RGSA 3HS0A 4N0UA 2VLJB 4GQ9L 2HJKA 2VXVH 4FQLH 4JY4A 5IFAH 4K07A 3X3FH 1AC6A 2VITA 4J3OC 3C60D 3HE6B 3RNQA 5D2NA 2YWYA 2O5YH 4D94A 3HRZA 4MMZC 5DJDB 1U95B 1X7QA 2ZCHH 2Y5TB 1BBDL 4PP1C 3IGAA 1HHGA 3LKPB 5EN2A 4NDMA 1RZJH 3AVEA 3RL2A 1F2XK 4I4WA 4OFYD 3SGJA 1DCLA 2BNUA 5D71L 5J11B 2H45A 1GGCH 1MUJB 2WANA 5EBLB 3AXLB 4LSVL 5HSFA 3Q0HA 1PLGH 5KN5A 2D4FA 4PRIA 4OZHA 1FYHB 1Q0YL 3MRCA 5D2NE 5SWQB 4XTRC 2FH8A 1CFTA 3JWOH 1NGQH 5C0NC 3SE4A 4MJ5A 4NFBA 4YXKH 2EDEA 2VZVA 2F53A 1MQKL 1V05A 1U41A 4RDQG 5GGUA 3AM8C 3GSUA 1B0RB 3A6BH 3P77A 3GZKA 5F7NC 2F5BH 3O0RH 4PB0L 4JRYB 3TF7C 4NOBA 4QT5B 5IBTH 5LGHH 2AXFA 5A2FA 3Q1SH 3NCMA 4P4KC 4UBDD 3I02B 2R2BB 2QQQA 3LKRB 4WFHD 2PNDA 2NY3C 4N90D 4Y4KB 3SKNA 4PYHA 2B2XL 2VZ3A 4U1JB 3OWEA 1TTFA 1OW0A 5HDOA 2ITCB 3CDCA 3K4AA 1IE5A 1OQXA 1KIUA 2AXGB 2Z91B 3HZKA 4LHUB 4XC3H 2UYLA 3U7WL 4J1UA 2X40A 1ZANH 3BPCA 5DFVD 1DVFA 4MQXD 3T0VA 3NACL 1WTLA 1WBYB 4Q97A 5EA0L 3ARGC 5DHVA 1I3GH 4Z7WB 1IZJA 3BKYH 1I4FA 4K9EL 2XICA 5DMIH 4A6YL 3WYRA 5HI5D 5F6IB 1D3CA 5DJCB 4D2NA 2QSCH 1GCFA 1D5XA 1KIPB 4JY5L 4WU5B 5EO0B 3T2OA 3DUUA 1MWAL 3NCYS 5CUSL 4FQJH 3QEHA 4GBXA 2DL9A 4FQCH 4UAOC 3BJ91 1Q0YH 1I1FB 4HKXB 5EOQH 2W1NA 4KKLC 1V7NH 2X89D 4UQ2A 3HC4L 3W11D 1MCWW 1G9ML 1VFAB 4ODXA 5EU5B 2JJWA 4CJ1A 1EK3A 3CD4A 3WIIL 3K0WA 1QSED 5IQ7L 1OGTB 1RZIB 3SKUD 3OR6B 3ARVA 3PV6B 4HLZG 4WI7A 2PUQT 3ARYA 1AQKL 1UKTA 2WBJD 3HN3A 4G6MH 5DRNA 4NO2B 1AE6L 2O5XH 5ACZB 5KVGL 1BGXL 1QVOB 4NZRH 4H1LG 4ZSOA 5C0DB 3WFZA 3LRSA 1DANU 3WEXB 2UZYB 4NQUA 2I9TB 1MY5A 3T1WA 4PJEA 3P0GB 5SWSD 3L5XH 1N5YH 2ESVD 3DRTA 3T2PA 2Z8SA 2ADFH 4HIHA 2DDQH 2XTJB 3UYRH 4F9PA 1HYSC 4ERSH 1A7RL 1OPGH 4JPVL 5D2LB 3ZE1E 2J8UF 1MI5B 2BX5A 4HFUL 4YHNA 2C1PB 4M7LL 1KEMH 3MQIA 4RRPA 1OAKL 4GSDL 5I6XC 1Q9LA 4QOKA 3AREC 1RPQA 3FO2A 2BNQE 2BMKB 1EH9A 4OCXL 2AK4B 1IM9A 1UWEH 3OZ9H 1MNUL 4Z7UF 3VG9C 2AJYL 1I3GL 4TSAL 1X6NA 2H3NA 4CU8A 1F02I 4KJYA 1N7ML 3CIQA 3NGBB 5DO2C 1QFWL 4FQHB 1AO7B 4AEHL 3OAYH 3GMNB 2FO4B 1T04A 1R5VB 5DSCB 4YHYB 2NMSA 1LP9A 1VADB 3VRJB 3O3AB 3ROOA 5I0ZA 3UO1H 3WD5L 1KN2H 2OZ4H 4HH9B 3NABL 4Y19D 2HT2C 5C2BH 4ELME 3RVXC 2DQCL 3TYFB 1RUAL 2V7HB 4C83B 4Y4HC 4X9IA 3SGEI 1HNFA 4M6NL 4DCQB 5FUZH 1U8IA 5FUOH 1S78D 4JFEA 1QLFB 4HGKC 5FYKL 4Q6IC 1MFDH 5DRZB 3IDJA 2O61B 1EHXA 4PJIF 1HILA 1AQDA 3CU7A 1T7WA 4MX7A 3P2TA 4PJHE 1FVEB 2P24B 4XP9H 4G7YH 3T8XA 1KBGH 1H5BC 4KVCH 3LRSB 4UIKL 4GKZA 5F89A 1JGDB 4Y1AA 4XAKE 5J1AA 2WLZA 3B9AA 4JFHD 3ISWA 3RNKA 4WEUD 2IALB 1E0OB 3F62A 4DKFH 4K8RC 2BY3A 5F1OB 1ZEAL 1AKJD 5EPMB 3RTQB 1HI6A 4GSDH 3GSXB 4GMSH 2YWZA 4K7PY 3U30C 3MA7B 3GSNB 1IM3A 3MLUL 5F72S 3C6LC 5M7QA 2SEBA 3QRGH 1I75A 1IC7H 3MODH 3HI5L 2IMMA 1ZGLA 1XGYH 1ND0B 2EH8L 3MV8A 4RAHA 3BX7C 3W9EA 2O5YL 3FFCD 2AI0H 4M3JA 4XRCB 1RUMH 4XPFH 4NKQB 1XGYL 5AG8A 4IRJC 4X9HA 4PLKD 4DKDC 5MEOB 1J0KA 4F15C 4PLOB 4HX1A 5I75C 5D2NB 3WFDH 1ZMYA 2G9HB 2D7TL 5E5UB 1U6AL 1HQRA 4JM2F 2FR4A 3M07A 3C2SA 4NC0B 4GS7B 3FHAA 5ISZB 4ODSH 2PYED 1H3GA 3CVHL 5JLZB 4NYLB 43CAA 3VRLE 5C0CD 1YMMA 1G6RA 4BH8B 2QKIA 1QUNA 3VE0A 3D9AL 5ENWB 3ZL4H 2R29L 1QQDA 4CADB 4EUPH 3DVGA 1ZVSA 3G6JA 5F44A 4KTYA 2BSED 3QQ3B 4L9LA 3BYTA 1DDHA 5GGTA 4Y88A 1AD0A 2Q3ZA 2VC2H 2IG2L 4YHLL 2J6EA 5JPMA 4M1CC 3WFHA 2CQVA 1E27B 2WMPA 5C0BD 3CH8A 4D9LL 4HLJA 3O3DB 1N4XH 2BJML 1B88A 2AW2A 3TIDB 1Z9SA 3TPUA 4L4VB 1XH3A 4RFEA 5AD0B 1NH6A 2J4WL 4E41B 5L88L 4KDVA 5CSGA 4JFZH 4OI7A 4Y16A 2VQ1B 3H9YA 2KPNA 2VL5B 5H2BB 3JWOC 4L3AA 1YDPB 2VWEC 43C9B 4Z9KB 4G5ZL 4XWOD 5AAMA 3REWB 3MOAH 5C0EB 1X5AA 3IF1B 1DBAL 4KI5C 4YHOH 2A74B 1FH5L 4DGIL 3RZWA 3VXNB 2AJUL 5KN5B 2ERJC 3TCLB 3LAFA 2DTSA 3OL2A 4CMHC 3H3PL 1MVUB 4EDWL 5SWZB 4LCUA 1OGAE 5DJ0A 5LBSL 3UAJD 1IGFH 3VGBA 4HD9A 3VWKD 3UC0L 1HEZB 2CKBL 2XFXA 4S1DD 3I9GL 2WIIB 3QDMD 2E9BA 5ESQB 3V6ZB 1JV5B 1IGJB 3QFDB 5EBGA 4RX4A 1SBSH 3MA7A 2FJHB 5AAWA 1NGPH 1I9EA 1S5HA 3TNNA 1SY6H 1NCCL 5DGRA 4LPWA 2OLDA 5JZ7C 4Z7WF 1BJ1J 5JXAL 4QNPF 1OLZA 5E6ID 3MLXL 4FABH 1SBSL 1TCRA 3MO1B 4HWZB 3AM8A 1DN0A 1YNKL 5D70H 4HEPG 5IW1B 3OHXB 5ANMB 1WC7A 3TT3H 4RMQA 4R4BB 5IVZB 2ZJSL 1FORH 1SMOA 2FX7L 2N7AA 2CDFB 4MLSA 3TEUA 3FQUA 4P2RA 1D5ZA 5IF0A 3EHBC 1EGJL 5CINL 2YXMA 2LVEA 2OJEA 2XWTA 2KL6A 4PR5B 5B3JF 1TZIA 4JQXA 4OZFA 1EO8H 5AYUH 2BY0A 4X4ME 1NBZA 3LEXA 1UQSB 3OX8A 4JN1L 1HNGA 4UIKH 4JPWL 2UWEB 1V7ML 3RWFB 3BXNA 4LPCA 3FQRB 1BVLB 2D9CA 5EPMA 2IANA 2ZSWA 5T1MA 3MJ8B 2EIEA 4M4PA 4ONGH 1HQ4A 3BIBX 3ARBB 5I1JH 1CBVL 3S37H 1RJZB 4Q7DA 1T5WA 2FIRT 1J1PH 3VW3H 1B6UA 4KK9D 4JM2D 3BGFC 2EXWD 3S4SB 3MLYL 4U1GB 2YSSA 1EEUA 3PDDA 4NHCH 3MXVL 2EXYD 3F58H 4X4ZA 3G5ZA 1NGXB 5GGSA 1XH3B 4WW2B 5DJYB 1I8KB 4F7MB 1IFHL 2HG5A 1CR9H 1VHPA 2I5YL 5H8DA 1A7QH 1CE6A 1CGSH 4R26L 5KAQG 1A2YA 1RJLA 1ZANL 1EFXA 2W0FB 3QDHA 2VDPH 3QDMB 4YHNB 4F7EA 1A8JH 4JVUA 3NAAL 5IVNA 1IAKA 3C8KB 3P4LA 3PP3K 3ZKSD 4ZFOB 4ORGA 1P69B 2V2XB 4X6EB 5D7IE 3PL6C 2KKQA 4OCWH 2ARJB 4GW1A 4KZEL 1JWMA 1YEGH 2JJSA 3VE0B 1SYSA 4QY8B 4JRXA 3WXVH 3SJVA 4KDTC 4NNYA 1RZ8A 3V5HB 3WNKA 2XOTA 4LCYB 3K74B 3RZCD 3KS0H 5ABDE 2A6IA 1ZHBA 4M43L 4X6FB 3GMQA 3WKNA 1RZKL 3IDMA 1N8ZB 1RUKH 2NY4D 3VFUB 5FO9B 2BSRB 1V3LA 1IGCL 4P4RB 4K3DL 2FATH 2Y6SD 1EEZA 2ZUSA 3ARGB 5DUBB 3V4VH 3DUHA 3FB8A 3JWOL 1C8PA 3R8BB 3M8OH 4JEGB 1FG2B 3FOMA 1ZEAH 4GKSA 4KQ4H 4NQEE 4QEGA 3W0WA 1JZ6A 2HFFA 1N59A 3SE8H 1DP0A 2QSVA 2YD4A 3MREB 4FQ1H 4Y89A 3X17A 1LNUB 5DD3L 2VDNL 3S88L 5AUMB 5GGRA 4GG6F 3QI9C 5EZJB 1BD2A 5B39B 1TENA 4Z0BH 1PBYA 1CFSA 1NBVH 1WBXB 4QRSA 4ETQB 4GW5A 5FYLD 5F9OH 5E8DL 2Y23A 3S96B 1OD9A 2W0LA 1VENA 4PJXB 4OTXH 3W9DB 3TN0C 3DX8A 4KH2A 4HWBL 2MFNA 1YEIH 1UG9A 3FRUB 2VN7A 1EHLL 3AROA 3ME0A 2QQNH 4DK3A 3S5LA 3U7WH 3C09B 3HAEH 3E6HB 4TSCH 3WLWD 1UT9A 4PJIE 5EU7C 3F5WB 2IANB 2ZSWB 3BKCH 5T1MB 5JW4Q 2DQDL 1OD7A 2OJZH 2XV6B 5EOQL 3NCJL 1F6AA 3CFEA 5FO8B 1CG9A 3MOQA 1KIQB 3KPQB 4FXLA 2FJGB 1BFOA 4RISL 2DTML 1IEAB 2GCYB 1F8TL 3EDJA 3FFCB 4Y19B 5EU4A 5BJTB 3K81A 5EORL 1NUNB 4L8BA 2YMXH 1EBPA 1DLHA 5ELIA 2D31A 4RQQA 3NN8A 5J57B 5I8CB 3QHTC 2E3VA 4P2YA 3V8OA 2D3VA 1KJ2H 1XIWC 1BPVA 4IJ3C 1AKJB 2YD7A 5GRWA 5C07B 5T1DH 4FXKA 3TVMC 1AXIB 5I1EL 3MV8E 2W0KA 3PF2A 3T2QA 3UTQB 4JQIL 3TNMA 4S10A 1T2XA 4FZEH 1XF4B 4DGYH 3B4NA 3K8KA 3MRDA 3LEXB 3LKPA 4R0LB 1PQZB 1FFNB 3WIHA 3LQAL 3QB7C 2LU7A 4MQXC 3VXSB 4NZUL 1E6JL 1IGJA 4P99A 4P9ML 4KHTH 4MJ6A 1OP3H 3RQ3A 4M5ZH 3IFOB 4MCZA 2DQIL 2HJLB 4YXHH 1RHFA 4XTRD 4E42A 1GRWA 4ZXBB 3KPSE 3QXDB 5EFIA 4L3EB 4LIQE 2VDLH 4O51A 2UY7A 1U0QA 3OAUL 1CDYA 5I15H 1I8KA 4F7MA 3MLPA 2P8PB 1IKFL 4OIBA 4R7NA 3KJ4C 5JUEH 1YNLL 2NX5D 4WHTB 5IMOB 5B22A 5HVFB 4YXHL 1P53A 3MJ8A 2UY6A 1JNHA 3ECBB 4PRPE 2BC4B 1GGIL 1GYAA 3KPSA 1RY7B 4AEIH 3MREA 2YD1A 4P4KA 3STZA 4Q9RL 4JFDA 1X9QA 3QG7H 5FXCH 1DQQA 3OKDB 4OZFG 5DURD 1I7TB 2NLJA 5MENE 3NZHL 5B4MD 4LQFL 5BW7C 3QFJA 1KTDB 3H6JA 1S7SA 1BVKB 1J0IA 2BFVH 2CDFA 2YPKB 1U8QB 3M17A 3L1OL 5EIVA 3S35L 4LVHB 4HW6A 1D5ZB 1PX3A 4WI8A 1YY9C 4QHKJ 5EC1B 5FO9A 1QRND 3D69A 1KJ2B 4X5LA 2EDNA 2Z31C 4NQCD 1FZOB 5JOFA 3DMMA 2Z8RA 1NC2B 1NFDF 3IFPA 3MOBH 5IEHB 2QV2A 2FL5B 3RVUD 2CKNA 4OIAA 3LKOB 4D9LH 1OGAA 3ARXA 4HUKB 5CD3B 5F7MC 4W81A 3TJEL 2NTFB 1JWSB 1P6FA 2P42B 4K94C 1NFKA 1J1PL 1P7QD 5JPMB 3VW3L 2LFGA 1YY9D 1I1AB 5DD5H 4TPRH 5DQJB 3CSYB 4N9OB 1VGEL 3TNNB 5MHSD 5CJXA 4JO1H 4QO1A 3TJHC 4NQTA 5C07E 5BRZA 4X5XB 2VLRD 1A6ZA 5D5MF 2D2OA 3RNQB 4JM2C 3F58L 5HYSB 3EFDH 3WS6A 1JGEA 1FFOA 4OAWA 5CZKA 1F6FB 4JZOB 3RGVA 1I9JL 1QRKA 4Z0BL 4OF8A 4OCSL 1JZ8A 3DIFB 2IAMA 4DTGH 4U1LB 1ZT4B 4KKAC 4HMDA 5C6WH 3MRNB 3P30H 5JHDE 2P8MA 1NUDA 4GG8B 2ILLA 3IKCB 1FG9C 1ZTXL 4WVRA 3GBNH 3T4YA 3WLBA 4HC1L 3HC0A 1CD9B 2X5PA 1AXTL 4I3RL 12E8H 4N0FB 1I9IH 3MYZA 4FA8A 3O9WD 4BFEA 1NJ9B 1S7SB 5IB3B 4OV5B 4Z6AT 3LKSA 1BREA 1FDLH 5D4QA 3RWEB 3DUSB 2VABB 2EDQA 5I74C 2Q7NA 3MBED 2VZSA 5JXAH 1AXTH 3R0MA 4BZ1H 2FO1A 1G7LA 5DQ9B 4JFPB 2YPLD 4K7FB 3Q2CA 5DLML 4XAWL 2PTUA 4C54A 3QULA 4PJ7A 1XF5A 3MRQB 2NXZC 4PD4K 1JGLH 2ADGB 3QHZL 4Z7UA 2M26A 2X70B 3KXFD 4R7NB 5CD3A 3HR5A 4U1GC 1H15B 1D6EA 3GSWB 1AFVL 2BDNL 5CIPH 4AY0A 1XF4A 4JHWL 5TF0A 4XB7A 2H32A 3FO0H 3MLSH 3B9EA 2XN9A 5D6CB 5FHBL 5IB5B 4YHOL 4MAYA 3VMNA 5M95B 1NL0L 3G5YB 3VFTB 2OR8A 1IMHC 1A6AB 1FO0L 1U8MA 4HXBH 4ZXBC 1J1XL 3WO4B 4DCQA 2GUOA 1J5OL 4TNWK 3BKJH 3R06B 3C2AH 3O6LL 1HYRC 4WTZG 3V95A 1QBLH 5C0AA 1OTTD 3BAEL 2CDGA 4UV4L 4OLXH 1D5MB 3OR7A 1HSBB 4R0LA 5BVJA 3NCJH 1J12A 2JK5A 1X5FA 3CH1B 1P2CB 4Z78A 2PCPB 4DW2H 1FRGH 2D4DA 4KRPD 4NHCL 3TZVD 2COQA 3DMMB 4EI5A 2DB8A 1JMZA 4WHYH 5D7KD 5I30L 4P5MB 5C92A 2BVPA 2J6EL 4HXAH 5KG9A 1MH5A 3WIHL 1JNLL 1F13A 3A67L 2AK1L 4I3SH 2L0DA 1MEXL 1S7TA 4LRIA 4M62L 3BKMH 1B9ZA 5I1AB 3FO2B 4RCAA 3L5WB 5ITBH 1KCRL 3KPLA 2J7LA 3UZVB 3G08A 5D1ZC 3CC5B 3K2UH 3TPKA 1W8NA 4AMKL 1KF9B 4YDJA 3TWCL 3KHOA 3MCLH 1A5FL 1FYTD 5T5NG 5BZDB 1W2KT 4G43B 1G7IA 2GJ6A 2R69H 3I6GB 3SKNB 5CD5C 3ULUH 3QIBA 4P0DA 3VWKC 3OKOB 4GXVH 5BV7C 2Q7YB 2EDLA 1NGZA 3HG1A 3D3VE 3UYOD 4ZSOB 5C0DA 1BM3L 4XCNA 3ZHKA 1NGQL 4X80H 1YQVL 1KG0A 3EDEA 3L3HB 1TQBC 2R69L 2Y6SC 1LP9F 1CICC 4QRPB 1OGAB 2BHYA 3SE3C 2F58H 4X80L 5GRYA 2F54A 3ULVH 1YQVH 2YD8A 4NRYB 4AIXA 1OM3H 5CEZD 5E5RB 4I48B 4OUUA 3MV01 5E00A 4G6FB 2IFGA 3IFOA 5EWIH 2BRRL 3G6DH 4Y5XB 5F3HA 3UP1A 1CK0H 2RB8A 1AGBB 2GITA 5A2JH 3RVWD 5EU5A 4F7TA 2YKLL 4PJCA 4XBPA 1HZHL 3QIUB 1IGFL 3SGDH 3P3YA 5TFSL 1G1YA 2R2EB 2X1QA 4XMPL 5J9PA 2IGFH 1A0QH 1NCBH 1SJEA 1HSAA 1IJ9A 2Y06H 3PXHA 4M1CD 2IH3A 4JZNB 5F1NA 2X44D 4PREA 3E2HB 4GRWE 4YDVB 3IU4H 5IMKA 5FGCB 1KLUB 3ARFD 2LVCA 4QWWD 2XQYG 3RPIA 1YN6B 4S0SD 4QHLA 5D6CA 4LSTL 3U36B 3BP4A 3UZEA 3ESUF 3KLSA 3RIFF 1F3RB 1ZWIB 5DUMH 3P73B 4OLUH 5DJAA 4D9QD 1GZQA 4PYGA 1Q1JH 4OZIB 1BFTA 3FONB 3O11A 1WZ1H 3QIWD 1AY1H 2ZG2A 1FN4B 2YMXL 5DHYA 5J11C 1RIHH 2JCCE 3FN0H 4XCNB 3OKMA 3TO2A 2IBGA 5IHZB 3DV6B 4G8FA 5K9QG 1L0YA 2D0FA 3O6FD 1YEEL 2RBLA 4DKEL 1H3PL 4KC3B 4LKXB 4NQDE 2AV7B 1N6QL 3DMMC 5DFWH 1QG3A 4MXVE 1TITA 3MNVB 3FCTA 3RWEA 1VEPA 2ITDA 2B2XH 4CNIB 4Z77B 1BOYA 4ELKB 2XG5A 4MHHI 1K3IA 3OG6B 1OTUD 1RUQL 3VGFA 3UZQA 4NGHH 3HC0B 2JB6B 5HYJE 4ZUTA 4X98A 4TUKL 4PB0H 3LEYH 2E9JA 1BWWA 2FD6L 2NW3A 4CUCA 4O00A 4P2OA 5GIRB 4QF1B 5FM4A 5DJZA 4FQIH 1U3JA 4JZJB 5T5FH 5DK0A 2HH0H 3K1DA 3MLZH 3H42H 3FB7B 3Q5YA 3AFLA 1A4KA 2MNUA 3K8LA 3AREA 1JF1A 4JFXA 4HS3A 3SKMA 5J3HD 4PBVC 1R5IA 2FGZA 4WW1B 1CYGA 2XFXB 1DFBH 5B38B 3GB7A 1T83A 3T0EC 3WUZA 4ZFFB 5TE4L 5ESAB 4ISVA 4POZD 5BV7H 1JNLH 4G8GE 2VWEE 3KR3H 4D0CA 5H35A 5I76A 2APBA 4NO2A 5ALBH 4Y4FD 5HGBB 1DVFD 3PHQB 3OBAA 3TIEA 1JYXA 3MV7E 3ARFB 1JF5A 1MFCH 4BSWB 3LMJL 3DXAA 4P3CL 2P1YA 1AO7D 4OB5L 5I75B 4OZHF 4WEBL 3ULVC 1OTSC 4M93C 2P47B 4DVRL 5MEOA 5FYJL 4P3DA 4N0YL 4LSDA 3V4PH 1KJVA 4HUXB 1DLFH 3W9EB 1G7LB 4LIQL 3CSBA 2GJZA 2HWZL 3LSOA 4JCMA 2XZCL 4Y5YC 4PRHB 5E8PB 4ONHB 1U95A 1X7QB 2VB5A 4PJGF 3FQWB 4P9HH 1RUPH 1QD0A 2RQ8A 5E5MA 5C09B 3O6LH 4TN9A 2Y25A 1X5LA 1QSEA 4LPVA 5ID1A 1EEYB 4LIQH 3R0NA 4NN5C 1OP9A 4JKLA 3SDDD 4RZCB 4YX2L 1WWAX 3QDAA 1XR8A 4UB0H 2PCPA 5ETUB 4RFEB 2WBJB 1DN0B 5JIPA 3EO1A 3K1KC 3L3JB 2DLTA 1TPXB 1OAKH 2YUZA 1WIUA 2WIIA 3MBEC 3W39B 1HHJA 1AE6H 2O5XL 2ESVA 3JV6A 2VLKD 5LCVL 4MXWH 1SHMA 1QR1A 3L95A 2DQHH 1GC1L 5E9DA 1LO3L 3ES6B 1G84A 1EJ6A 5E1AA 2X2YA 5KSAA 2FX7H 4OF7A 4APQB 3AAZB 1IAII 1Y6NR 4HT1H 4KHXH 1AP2A 4A6YA 4NYLA 3G5ZB 1RZJL 4HIJB 3ZO0A 2AEPH 1FAKT 2VZTA 4ZO9A 2D7MA 2C3WA 3K8MA 4CBPA 5EOCL 4Y4HA 5DS8A 1HWHB 1J8HA 3N1QC 2VDKL 2BSSA 3KS0J 3RVVD 2NY7L 3L3DB 5IKCB 3CSPA 3V5DB 5EO9A 1XF1A 1ZA3A 2APWA 4EI6B 1OB1B 5MP6H 4KDWA 3SGKA 5FECB 4MNQD 3GSQA 3IETB 4MWFA 2HRPL 4Z0XB 1DQLH 3TIDA 4P59H 2GT9A 4FZ8H 5FYKD 4KVCL 1J8HE 2VR4A 4YC2C 3QH3A 3CLFL 5IW6B 1DBMH 1GAFL 3TV3L 2DM4A 1HINL 3V79C 1M6OA 2ZSVA 1Q9KA 1CR9L 4P46C 1T1YA 5GRUH 3MLVL 5FUOL 3TV3H 3BPOB 5DJXA 3BRGC 3HZVA 3CLFH 1C12A 2QLVB 4Y1AE 3KLHD 4UNTA 2EKJA 2GW5A 3DSFH 3SKOA 2A77L 3WMSA 2KZ1B 2EH7L 4NN6B 5EIIB 3O3BB 5D1XA 4RBPH 1L7TH 1HKFA 2GJJA 3FJTA 4ZFFA 2IANE 5JNYB 1JGUH 3C8HA 3WSQL 1NC4B 1MJ8L 1L0XA 4G80A 5L9DL 2W9LA 5D7LA 1C5DB 4RGNC 2ZUTA 4GBXB 4HPYL 5LVEA 2EDTA 2HLFC 2K3TA 1BQHA 3FFCA 2GY7B 3O9WB 3CZFA 3MLWL 1MI5A 5DHXB 3C60C 3GUTA 1ORQA 1UXWA 2XTLA 3V5DA 1KPUA 3QHFL 1J05B 3GMQB 1WZLA 1MFEH 1LO4H 2EIBA 5E94A 1I3RB 3MTRA 5ADPL 3JWDH 3TIEB 5HGBA 2BCKB 1YDPA 43C9A 3BZEB 3UTZA 1JNHB 5D7IF 1XGTA 1T0PB 5DMJB 1C5CL 3B2VH 5A16A 3NVQA 5T1KD 1K9TA 1FFPA 3VRIA 4PJXA 4K55A 4AG4H 3NIFE 3X12A 1A9BB 3JBG7 1UJ3C 2Q6WB 4JGJA 4ORGB 4FQIL 4X83A 1JHTB 1XF3B 3O81A 4NBYB 3C6LA 3QDJD 4LFHG 2O93L 3L5JA 5GGRB 4WHDA 3ETBF 1T6VN 2R0ZH 5EZLB 2VYRE 4X7SL 4PRAA 4OFPA 2DIJA 1IGYB 1EUTA 4KKNA 4YHKH 2BY2A 1DBJL 1GZQB 1A6WL 1I9RL 1TJIH 1U8IB 4OF0A 5A2IH 3MRJA 1IRAY 2HLAA 3CX5J 5H94B 1MCWM 3SDAA 1F4XL 4D0CB 1NAKH 4LCIH 5EC2B 2WUBL 3F7PC 4O51B 3HZYB 3EO9H 4NQCB 4Z8FH 4KJQD 3UTOA 2X4RB 1MCSA 2P24A 3B9KC 4QHKI 4WW2F 4JKWA 3TVMD 1KJMB 3VFPA 5HYJD 2ED7A 3H7BB 5T3ZH 3BVNB 2C3VB 1YPZE 4LQ1A 1S9WB 2GYSA 5L88H 2L7UA 3S9DB 5HI4C 1KC5H 4KMQA 4XPTL 1EAJA 2IH1A 4BFGA 4PRHA 5EUKB 1REIA 2L7JA 5IVOA 3U0WL 4MAYC 2BNRA 1XEDA 5DJDA 3VD4A 4D0DB 3DRTB 1JCKA 3PWUB 3PWJA 4LDEB 3STBA 3ARRA 5I1LB 4LQFH 4X6CB 4PUBL 4PY8J 5TJWK 3P9MB 2FB4H 4PJGA 3UMTA 5KJRH 4IRZH 3IKKA 5DVKA 1QVOA 3EDDA 1VPOH 2W07A 1S5IL 3BE1H 4LASH 4ZUUA 4DAGL 5JW4N 2VO5A 1WFNA 4UT7L 2OI9B 1OWWA 1KCKA 1PY4A 4WFHE 4X99A 2DDQL 5E4EC 4PRAB 5JO5A 4PJDB 3O4LB 1LEGA 4ODTL 3P40A 5TF1H 1UZ8B 2QQKH 2VMFA 5D2LA 1JFQL 5KVEH 5C9JA 3MLXH 5C09D 1PFCA 4EXPX 4EOWL 1CT8A 2QR0A 2R4SH 1S78C 3VXMD 2R8SL 2AABH 3RRQA 1U91A 3U9UA 4M7JH 4QRTB 3OAUH 5I15L 1X5GA 2AXFB 1PYWA 5INDA 3L7EA 5ANME 2VN4A 4M1GL 5GJSL 4K23L 1CDJA 3QDGD 4GMTH 3RVTD 1I85A 1QSFA 3MRDB 4XGZB 3QUKA 1Z5LA 2NY2B 3S4SG 3KAAA 2BCKA 2C3VA 1CLOL 5MHSE 4NKDA 1BM3H 5C07D 1NGPL 4JLRB 2VLRE 1D5XB 1JE6A 2DYPB 1KYOJ 2H32H 1R5VA 5D1XB 1A3LL 2NW2A 5A40E 1T83C 3ZTNH 3TA3C 4UDUB 3QUMH 1R3KA 3UBXA 5H94A 1OAYH 5BS0D 1U93A 2EKSB 3QWRA 3G6JF 5E2UL 1MJ8H 5L9DH 2G75B 2IQ9H 5EC2A 4O5LL 4F7CB 5DZOA 1IGTB 3A6CL 2CIIA 5I16B 4PUBH 3V52L 4LVHC 1QSEE 3QJHB 1ONQB 4KTDL 2X10A 2ZG3A 4PJ7E 4O02L 1MHPH 3UTSB 4EN3D 3FN0L 1JWSA 1PEZA 4I77L 3VFWB 3VFNB 2A0LD 4B53A 4YHLH 5IHLB 1E6OL 2DJ4A 4HV8A 4L3EE 3BQUA 4FFYH 5CGTA 5FDYA 1M7XA 3C6SB 1OSZA 1JMXA 1KYOK 2UV3A 3UPRA 4RA3A 3E0GA 3PE9A 2YBRA 2HMID 2ESVE 3SDDB 1DL7L 4ZTPL 4Z7WE 2AERT 1A4JA 1WEJL 3PV7A 1MCJA 1HZHH 3QUZC 4ZFZA 1AGEA 3CFIC 5E2JA 1G7IB 4PV9A 3IFLH 4ONHA 4A6YB 3I3DA 4OFYA 5D1QD 2VSCA 3FOLA 4U6XB 5EDXA 2NY1B 4P57A 2XWBA 1FZJA 4LLYB 1MWAB 4AYFA 3GSVA 1U8PB 2VABA 3W0WD 1I9RH 1RHHB 1TJIL 1A1OB 3H7LA 3G5XB 3OPZH 2GTWA 3CX5K 2ICWA 1NJ9A 1S7RA 4XPGH 3U7YH 2F53D 3RZCB 3GSNL 4NRZA 1VEMA 4N9GB 2ZCKH 1ZHNB 1KPRB 4XP6H 5CBEA 1GGCL 3U48A 2OL3H 2EE9A 1GOFA 3MO1A 5TQ2H 3QWOB 1VFUA 1K4CB 4WO4A 5I74B 3CZFB 3RZCC 5DMYA 3MUY1 1JPSH 1MCPL 3GHEH 3WFEL 1DBKH 5IW1A 1UYWH 1CF8H 2AS5M 3MGOA 3U83A 4YDKH 1UEMA 2VRAA 4M1DH 2P5ED 4JZOA 4LLMB 1S7XB 1H15A 4KHXL 5DYOB 2DMBA 2EYSB 4ODVL 5KAQF 4OFKA 1UM5H 1EZVX 3UYPA 4OFIA 4NZRL 1NKOA 4AG4L 3BT2H 2QQLL 5I1KH 1ZLWH 1XF5B 3MRQA 1ZLWK 4Q0XH 3INUH 3QIBB 4ODUA 2AJVH 5HVHC 3I6LE 1S7VB 4GRLA 3GMLB 2Q6WA 35C8H 3CDGA 3KPOB 3IDXH 3IXTB 3T3MF 3HUJE 2J8UE 1FGVL 3QXAA 4LU5H 2NY0C 1VPOL 3ZDXE 1P4LA 3SGKC 4GAYA 4ZQKA 5EZOH 1CD0A 2N7BA 2AJZA 4CW1B 2CR6A 4G6FD 3JWDC 4KMTH 4PJ7B 3O4OC 4FQCL 4UV4H 2BVPB 4S0TD 1HH6A 3V7MA 3NACH 3BP6B 3QXWA 1F42A 2IFFL 1PSKL 1BZ9A 4O58L 4KTEH 4CVUA 2CXGA 5ESVB 3DETC 4MA7H 1NAMH 3HE7A 4HV8B 1X5HA 3LV3B 5D7IA 4ALAH 5CEZE 5BVJB 2NY3B 2V2TB 5GRUL 3DHMA 3ORJA 3QXTA 5KS9A 4KK5C 4YHIB 1UCBL 3QEUB 1V5JA 4XPTH 1RI8A 5FKPB 1ND0A 4I0PD 3WFHB 2V9TA 2R39A 4HS8H 2X4OA 5B21A 2RCSH 2MKWA 1EO7A 4LGPB 4HKBA 3TYFA 4KXZH 3TO4B 4QGTA 3EYSL 4IMLB 1AHWB 4J3WA 2OX5A 2JE8A 1K4DB 2NTSP 1U93B 3OHXA 3KYKL 1BECA 4P3CH 1NANI 4W68A 2QEJA 3F6IA 3K4DA 1OAYL 3GM0A 1I8LC 4ODWA 1KEML 1G7HA 3BI9X 4PLKC 2VDOH 5KSVB 4OCYH 3CU1A 1MREL 1HHKA 4JZNA 4ZUSA 4HS3B 5F7HA 5CD5D 5D8JL 2WM0A 4JQVC 5KW9H 2ZNWA 3EOAB 4X8JB 5DVMA 5HYQB 2ICWB 1MFEL 4F9LA 3R1GH 5EU3B 3QIUA 2P7TA 2R4SL 4QCIB 5CCKH 1NCNA 1OVZA 2EICA 4JDVA 3ZHLA 5I1HL 3CK0L 1C5CH 3FQTB 3E6FA 4EIZC 3EUUA 4TVPD 5L2KB 4YBHA 4I18A 3MV8B 4H8WH 4M1GH 2QR0B 3ELAT 1NMCC 4LVEA 4DZ8A 1T03H 1F4YL 5GS0C 1FV1A 4Y4FC 3ARBD 2R1XA 5B8CB 2WBKA 1QRNA 5C8JB 5HVGB 4GQ9H 4WW2C 3HG1E 4TTDD 1KCSH 4HX1B 1G7JB 1N6UA 4Y16B 1SYSB 1MFAL 1F90H 1ZWIA 1WUNT 5CZXD 3V0VB 3KPOA 3ARDA 3T77B 1F11A 1OGAD 1UM4H 2BNRE 2OQJB 4Y5YB 1D9KC 3NAAH 1CT8B 2F54E 1JK8A 3CUPB 1MOEA 1NGYA 2KH2B 2I24N 3MUJA 4MAUL 3V6OE 2BOBB 1KN2L 4Z7VF 3ZDYE 4YGVA 4WWKA 2I9LB 4LBEA 1QSVA 4WW2A 4GO6B 2OYPA 1C7SA 3O45B 2HT2D 1OSZB 5T3XH 1J1OH 2DLGA 1RIHL 1U3ZA 2X4UA 1FZMB 3MRGB 3PWVB 5GSVB 5L2JB 5ISZD 4RAVB 3VFUA 5IFHL 4GAJL 4JR9L 1AKJA 1X3DA 2F8XC 2R56H 4JHAL 3MLSL 4QRRD 2R2HA 4I0PC 3IFNL 3O3EB 1RZIA 2K9UA 4RAUB 1T80A 5JDJA 5DRXA 1UQSA 3OX8B 4QRUB 2HN7B 3KXFE 1NL0H 3TZVB 2A0LC 3VXPB 1MAML 3ZE2E 3S34H 2WBJC 4U7MA 5E8NA 1T3FA 4YHZH 2AJVL 3THMH 1KTLB 1BJ8A 7FABL 2EDOA 3IGAB 3O2DH 3DROA 1AJ7L 5E2TL 3EYVA 4XCEB 3O8XA 4LOUD 4PJAE 5HYSG 4G6KL 2YA0A 2J12B 4ZD3H 4HUVB 4V2BA 4JDZA 5KSBA 1KCUH 2J8OA 2ERJB 4EUPG 5LXGL 1P7QB 3BSZH 4Z7UE 5DD3H 2AI0L 2NR6C 3HB3D 3T4AB 2OQJA 4U05A 1YMMD 2DQJH 3BH9B 2AKRB 3H0TB 4PJDA 5HPOA 4NO5B 2AXGA 3D39B 3L6FA 4E41D 1KEGL 3WFDL 4ELKA 4KVNH 4M9PA 1A7BA 4LEXL 1OAXL 3TLRA 5GS1B 4ZXBA 3MNVA 2APXA 3DBXB 5MENA 1TVBB 4AENB 1J87A 3R4DA 4RFNC 2ZCLH 3KXFB 1CG9B 4MD0B 1R3IH 1DR9A 4OZFH 1AI1L 2DBLH 4U6HA 5T3XD 3QUMA 3FQTA 3NTCL 4G6AC 2VDML 3OMZA 1FG2A 2YN3A 3MRBB 3IU3B 5F1NB 4E0RA 4U1MA 3LV3A 4ZOAA 3FRUA 4PBXA 3WHE0 3R8QA 5IM7A 3UTPD 4FP8L 1YECH 4P46D 3PL6B 1ZGLP 5IF0B 1H0DA 1IGIH 2BSRA 3IJHA 2AJXL 1AGDA 1G7JA 2H2SD 2JELL 1CFTB 4KUCF 5I1EH 3SDYH 4Z7WA 4ZO6A 3P4NB 1S8DA 1RUAH 3VA6A 1L7IH 4KGJA 3OR6A 3BZFA 2NNAB 1D9KB 3BIAX 2Q76A 5ID0B 4RGNE 4S1RH 1ZHLA 1J0JA 3SJVB 4KKBC 4NOFA 1RUPL 3SGJC 3GMMB 4JVWA 3OB0H 3P9LB 3TH4T 4CU7A 1N6QH 2ED8A 1Y18A 1I1FA 4KJPC 1DBBH 5DRWA 1IM9B 5IROA 4M48H 3QXVA 1XIWA 5D2NC 3FTGA 4DZBB 2WWMD 3NGBC 5D1QC 2G2RA 3AUVA 1EO8L 1TTGA 5AYUL 4Y4KA 5EZIL 1KIQA 3GMPA 4JM4L 4XXDA 4LEOA 1C16B 5HDBE 5IVXB 1IFHH 2DQGH 4HIHB 4RX4D 5DJ2A 5E7BA 1KB5A 2YUXA 3KPPA 1M71B 1A0QL 2ZG1A 3TBTA 1GOHA 2P4AB 3IT8D 4HHAB 4HG4K 3O2WL 4DFHA 1T7YA 4Q6IB 4CJ0A 2R0KH 3QZWA 4YZFF 1T1YB 4JB9L 1M7IA 4DN3L 2OI9C 3PWPB 3QUML 1BQLH 4WCYL 3JTTA 5IJVA 5DRNB 3DI2B 1CDBA 1HHIA 1QSEB 3RI5K 3UTSD 3QCTH 1MHHB 3LIZH 4P2RD 1CLOH 1W72B 1YEKL 3FQWA 3ZYZA 4XHJD 3TT3L 3ULVL 3QXAB 5D7LE 1IC4L 1RVFH 2IADA 3LKSB 5KS9B 3D5OF 2FWOB 3GI8H 3PGCB 5E2WL 4JAMB 1PZ5A 2X89A 1YEKH 4ELMF 3MRIA 1JTOA 2D0HA 4HKJB 2GSGB 2F19H 3DX6B 2CSPA 1Q94A 2IAND 3RWCB 2D0GA 3T08A 5C8JA 1KXVC 5MEPA 4NRXA 4IHOA 4P23C 2VZUA 3ARFA 2WAHA 3HE6A 4F15B 3L3JA 1LO5B 4EQ2A 2X9WA 2X09A 3U4BH 4U6TA 4PJCF 4IRSA 2CUHA 3MJ9A 1DL7H 4CMHB 3O6KH 4W4OA 4GMSL 1JTPA 5F7EL 1UXSB 3VFGH 3O3DA 1RULL 3ZE0F 5I73C 1JN6A 1FCGA 4L4VE 1PY9A 4TUOB 2BNUB 4HIXH 4MJIE 2DQEH 1FLRL 2AGJH 3W2DL 5DEFB 4XPHH 3P0YH 4FFYL 1EFXD 1G9NC 3ULVD 3WUWA 2ICEA 4N5EC 3VXRD 3IDNB 3L95B 4M7ZC 4FFVC 4NQDA 2OZ4A 1CIUA 3MRMA 4PB9H 4YFDB 4C83A 4F33B 1A3QA 1HXMA 1E4KA 1PQZA 1JNNL 4KK6D 4EEEA 4KRLB 1WZ1L 4Y5XC 4QOKD 2E9IA 4BELD 1IM9D 5HDQL 5GSRA 3IETA 3VRIB 4QTHB 2VXQL 5JR1H 1W72A 5FYLL 3VXUE 3MZGB 4X7EC 1I7UB 4K3HA 1YA5A 2ADGA 3RY4A 4MD5B 5C0FB 2VXQH 1XZ0B 3ULVF 1MH5B 2E27L 4M8QA 5EUOF 1A7OL 4NCC1 1FNSH 2Y72A 1NMBL 5TQ0L 1C08B 2EDWA 4UOW0 2A83B 4GRLC 4O5LH 1Q0XH 4LKCA 4GKZB 2DMKA 5DZNA 3VRLF 4P46B 5I1KL 4R2GC 3OF6A 1WIOA 3P4MB 4P3DB 2WBWB 1IC5H 3HHRB 2CMRL 4YXKL 4JPIA 2BC4A 5CZVL 4NHUB 5KOVC 4X4XA 1MY7A 2HVKA 3EZJB 1UKSA 3MV7D 3BZ4B 4JFEE 4TNWF 4NT6A 3ZZ1A 4NSKB 1QNZH 2E7HA 2CLRA 4DUXA 3FO0L 4PBWD 1MHHA 4PTUA 4HCRA 2AXHA 3BDBA 4ODVH 3QCUH 1U3HA 3BD5A 3EKCA 3IKCA 3NBNA 2GQHA 5IK3A 5F8RC 4FQ1L 4I18C 2R0ZL 4RZCA 4G6ML 3VDCA 2DQIH 4NWTH 5HHNA 4ACPA 5KTEH 5ETUA 4MQSB 4Y4FA 5BQ7B 3CMOH 4LCCA 4K8RH 5JOFB 1YYLL 1RZ7L 1S8DB 3DXAD 2X70A 5F6HI 4PRBB 5GRJH 5DZLA 3Q3GA 3HCVA 5GS3A 1KB5B 3I50L 2V5SA 1Z3GH 4QRRE 3FTGB 4DZBA 5TF1L 3HI6L 4O9HL 2VNCA 3EOTL 5CEYA 2DICA 4L9LB 3TN0A 2E7BA 5JHDB 4UTBH 1CDGA 1MJJA 3PWNA 5DQ9A 1FP5A 2YHGA 2J6EH 4IS6B 3UX9B 3VH8B 5DUPH 5ENWA 6CGTA 1LP9B 4W4OC 3JUZA 3O2WH 4JRYD 3HZMB 2WWKO 3QEQD 1PX4A 4M62H 2OR9H 4MB5A 5IT2L 3ULSB 4KZDH 5ID0A 1UZ8A 1L4IA 3FT2B 3EFFA 1U8OB 3VWJC 1IL1B 2VL5A 5H2BA 2A1WL 1JGUL 4MQTB 2GSIB 2IBBA 2AEQL 5E7FA 2AK4E 3PWLA 5EA0H 4XCYB 2VZOA 4PJGB 3QT2A 2YUVA 4P2QA 5D7SH 4AK1A 3NA4A 4PJ8D 5K9KA 3DV6A 1P6AB 2H2SC 2VAJA 3KPPB 4JO2H 4XP1H 4LKXA 5MI0B 4M48L 1GGYA 4XP4H 5DMGD 5EUOA 2HRPH 1NAMA 3CLEL 1JF1B 4JG1L 4QXUH 1NDMB 4PJ8B 5HHOE 1I1AA 4PJDE 1Y18B 3MXWH 2E8ZA 1P4BH 3EDFA 3O4LA 3GJFH 4H1LB 5GS1A 4G9FA 1ZS8A 4OD2B 4PP2A 1PVHA 4I2XA 5DDHB 5SWZE 1XGTB 5EWIL 2NZ9D 3U6RB 1CTNA 2NY7H 4Y2DC 4Y16D 4XC1H 1RJYA 4PGDA 5TH2A 4X98B 4OZHE 5IBTL 5LGHL 1M71A 1ZHLB 1LNUA 3E3QE 3BYYA 4X6CA 3SQOH 1BFSA 5JUEL 1BLNB 2NY5C 3SOBL 2VR9A 4ZUWA 1Z9MA 1VACB 3SN6N 2AEPL 4YBQC 1IKFH 3SE3A 4BUHA 4OZFB 1RU9L 1UB6A 3X3GH 1A6UL 1XGRA 5FHAH 2DQJL 3FOLB 4U6XA 1N5YL 3QFJD 5LCVH 4OIIL 1IC4H 3HG1B 2DQHL 4TSBL 1AGBA 3QDMA 2A6IB 1OAXH 1Z2KA 1MCNA 4V2CB 3WS3A 4WUUE 3BJLA 1EGJA 2H2PC 2DLIA 3BEWA 1RQ5A 3RTQA 3T0AA 1Q9OB 3KPMB 1OTTC 5L2KE 4K9EH 5INCB 3HI1A 4WU7A 4XVTL 5CFHA 1T0NA 5HVWA 2HTKD 4D8PA 1J10A 3P4OA 4CN6A 3FONA 5HHMB 3OAZH 1ZLSL 2VXSH 3WFCH 1C1EH 1JI2A 2XIDA 3U4EB 3BRDA 1FYTE 5IOPB 4APQD 2PYEB 5E08H 3QI9D 4N0RA 2FECL 1F4WH 1BQUA 3VFNA 3NZ8B 1NEUA 2Q8AL 3LVEA 3TBTB 3U0WH 4FTVE 3VMOA 4UTAL 1WQVT 2UWEF 4XNXL 3T3ME 3GRWH 4HCRH 4L4JA 2WIMA 3MV7B 2EEBA 1U8KA 4WI4A 4I0PB 4HMEA 1CL7I 2FBOJ 2XKSA 5D7LD 3NFPA 4OZIA 2Y07L 1DUYA 2HG5B 4FZ8L 2VUOA 2W9DH 3MRLB 1OHQA 4NKOA 3MUGA 4GW4B 4PJIA 1I4FB 3KLDA 4X6FA 5GJTH 2PW1B 5ICZB 2JCCF 4FQXC 1F2QA 3DX9B 4ODWB 1J11A 4HUUB 2QQNL 1CFVL 4U1SB 3EJJX 2VXUL 4N0UB 2HFGH 3QUYD 1N0LA 1NGWB 2CLZB 4WWID 3CFJA 1S7VA 3QQNA 1K85A 1WTGT 5DDHA 1QTYT 4Z7QF 1YEFL 2IH1B 4G6JL 4X7DC 5EU3A 5GPRA 4QOKB 5JW5B 2IPUG 1C5BL 1U42A 1AGCB 5DK2A 2ITCA 3PG2A 4U7KA 3S98A 1ZKAA 2EYSA 4Y16C 4PJFA 5FKPA 1J88A 3V6BR 1PD6A 3EOBB 5KS9F 2Y4SA 3FT3B 4PJCE 1TZGH 3N0PB 4OGAC 3OKNB 1EFXB 3SE8L 4QT5A 4TQEH 2XRAH 1CF8L 5E2VL 4ZG1A 15C8H 4UQ3B 3QYCA 5DLMH 3P4MA 5HJ3B 3O11B 1CGWA 1DVFB 2VLME 5EOTB 4WO4B 3DX8B 2R1YB 4ELMB 4JRXE 1II4E 1SQ2N 4ZUUB 2P45B 4LLDB 4GW1B 5BCAA 3KJ6H 3VXOB 3EJYC 3ULSA 5GGUB 5FOJA 4EN3B 3C60A 4D0BB 3LQZA 4Y5VA 1HEZA 1CFSB 1WBXA 3EFFB 3NFNB 1QFOA 2EYRA 4YWGH 5LGJA 1EJOH 3MNWA 3QAZC 1PZ5B 4P2QB 1F58H 5C0AD 4V1DB 4NZUH 3VDBA 3OJMB 2AQ2A 5FCSH 1JFQH 4JHZA 1OB1A 2HKFH 3IB4A 2VOTA 3OKKB 3PWLB 3STLB 3QG6A 1CDIA 2HTKC 2R1WA 3UTTA 3S97C 3O2VH 2BOCB 3BPLB 2ESV