5HYTB

Structure of human c4b-binidng protein alpha chain ccp domains 1 and 2 in complex with the hypervariable region of group a streptococcus m22 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
124
structure length
124
Chain Sequence
NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precursor to Protein Sir22
publication title Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 22
structure length 124
sequence length 124
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 5hytB02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 5hytB01
1MD8A 1GKNA 1GPZA 2RLQA 3M7PA 5I0QB 4K12A 1GKGA 4LOTA 3SW0X 1OJYA 3MQLA 1HFHA 3OP8A 1H2QP 3TVJA 5HYPA 3IU3I 2MCZA 2YBYA 5JPMG 2JGWA 2G7IA 1FBRA 2JRAA 3KZJA 3GOVA 5HYUB 1C1ZA 1H03P 2RKZA 1G4FA 2QY0A 1U5MA 4PZ5A 2CG6A 2O39C 1ELVA 2EC3A 3OXUD 4CSYA 4FXGG 1VVCA 4B2SA 3OEDC 2XWBF 2XRBA 1OK1A 4ONTD 1OK9A 4A5WB 4AYDA 4AYIA 1MD7A 1SS2A 4LOSA 1QUBA 2BZMA 1UOTP 4C16A 3GXEA 3ZD1A 2RLPA 3T5OA 3ZD2A 2CKUA 3CALA 5HZPB 3L89M 1SRZA 3EJHA 1NWVA 2EHFA 2YRAA 4IGDA 4DJZA 2IZ4A 2UWNA 4KKDA 1QO6A 2XRDA 4JHSA 1VVDA 4YNXA 1H04P 1H2PP 4MUCA 3INBC 4F4OC 1OJWA 1PPQA 1ZJKA 5FO8C 3ZRZA 1CKLA 1G4GA 1TPGA 4B2RA 1HCCA 1E88A 1GHQB 4ZH1D 2LOJA 2RL0A 2A55A 1QGBA 1O9AA 3RJ3D 2KMSA 2W81A 4AYMA 1Q3XA 2B5ID 2ERJA 2MCYA 2XWJI 3O8EB 1TPNA 2IZ3A 1OK2A 1OK3A 2XQWC 4AYEA 3NFPI 1OJVA 2KRIA 3ERBA 5HYTB 2CG7A 1E8BA 1Z92B 4J38B 1TPMA 1HFIA 2W80A 4WJG2 1E5GA 2V8EA 1LY2A 3KXVA 3IX0A 3R62A 2JGXA 2RKYA 2WIIC
chains in the Genus database with same CATH superfamily
1MD8A 1GKNA 1GPZA 2RLQA 3M7PA 4YIZA 5I0QB 4K12A 4BWCA 1GKGA 4LOTA 3SW0X 2Y8TA 1OJYA 3MQLA 1HFHA 3OP8A 1H2QP 3TVJA 5HYPA 4APLA 3IU3I 2MCZA 2YBYA 5JPMG 2JGWA 2Y8RA 2G7IA 1FBRA 2JRAA 3KZJA 3GOVA 3WSYA 5HYUB 1C1ZA 1H03P 2RKZA 3ZLEA 1G4FA 2QY0A 1U5MA 4PZ5A 2CG6A 2O39C 1ELVA 2EC3A 3OXUD 4CSYA 4FXGG 1VVCA 4B2SA 3OEDC 2XWBF 2XRBA 1OK1A 4ONTD 4MSLA 1OK9A 4A5WB 4AYDA 3K3TA 4AYIA 1MD7A 1SS2A 4LOSA 1QUBA 2BZMA 1UOTP 4C16A 3GXEA 3ZD1A 2RLPA 3T5OA 3ZD2A 2CKUA 3CALA 3F6KA 5HZPB 1RLHA 3L89M 1SRZA 3EJHA 1NWVA 2EHFA 2YRAA 4IGDA 4DJZA 4PO7A 2IZ4A 2UWNA 4KKDA 4N7EA 1QO6A 2XRDA 3NJAA 4JHSA 1VVDA 4YNXA 1H04P 1H2PP 4MUCA 3INBC 4F4OC 1OJWA 1PPQA 1ZJKA 5DN5A 5FO8C 3ZRZA 1CKLA 1G4GA 1TPGA 3CI0J 4B2RA 1HCCA 1E88A 3FGRA 1GHQB 4ZH1D 2LOJA 2RL0A 2A55A 2X2ZA 1QGBA 1O9AA 3RJ3D 2KMSA 2W81A 3WSXA 1Q3XA 4AYMA 2B5ID 2ERJA 3FGTA 2MCYA 2XWJI 3O8EB 1TPNA 2IZ3A 1OK2A 1OK3A 2XQWC 4AYEA 3NFPI 1OJVA 2KRIA 3ERBA 5HYTB 2CG7A 3VWOA 1E8BA 1Z92B 4J38B 5DN4A 1TPMA 1HFIA 2W80A 2Y8SA 3ZLDA 2I2LA 4WJG2 1E5GA 2V8EA 1LY2A 3KXVA 3IX0A 3R62A 2JGXA 2ZYCA 2RKYA 2WIIC
chains in the Genus database with same CATH topology
1MD8A 1GKNA 1GPZA 2RLQA 3M7PA 5I0QB 4K12A 1GKGA 4LOTA 3SW0X 1OJYA 3MQLA 1HFHA 3OP8A 1H2QP 3TVJA 5HYPA 3IU3I 2MCZA 2YBYA 5JPMG 2JGWA 2G7IA 1FBRA 2JRAA 3KZJA 3GOVA 5HYUB 1C1ZA 1H03P 2RKZA 1G4FA 2QY0A 1U5MA 4PZ5A 2CG6A 2O39C 1ELVA 2EC3A 3OXUD 4CSYA 4FXGG 1VVCA 4B2SA 3OEDC 2XWBF 2XRBA 1OK1A 4ONTD 1OK9A 4A5WB 4AYDA 4AYIA 1MD7A 1SS2A 4LOSA 1QUBA 2BZMA 1UOTP 4C16A 3GXEA 3ZD1A 2RLPA 3T5OA 3ZD2A 2CKUA 3CALA 5HZPB 3L89M 1SRZA 3EJHA 1NWVA 2EHFA 2YRAA 4IGDA 4DJZA 2IZ4A 2UWNA 4KKDA 1QO6A 2XRDA 4JHSA 1VVDA 4YNXA 1H04P 1H2PP 4MUCA 3INBC 4F4OC 1OJWA 1PPQA 1ZJKA 5FO8C 3ZRZA 1CKLA 1G4GA 1TPGA 4B2RA 1HCCA 1E88A 1GHQB 4ZH1D 2LOJA 2RL0A 2A55A 1QGBA 1O9AA 3RJ3D 2KMSA 2W81A 4AYMA 1Q3XA 2B5ID 2ERJA 2MCYA 2XWJI 3O8EB 1TPNA 2IZ3A 1OK2A 1OK3A 2XQWC 4AYEA 3NFPI 1OJVA 2KRIA 3ERBA 5HYTB 2CG7A 1E8BA 1Z92B 4J38B 1TPMA 1HFIA 2W80A 4WJG2 1E5GA 2V8EA 1LY2A 3KXVA 3IX0A 3R62A 2JGXA 2RKYA 2WIIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD8 A;  1GKN A;  1GPZ A;  2RLQ A;  3M7P A;  5I0Q B;  4K12 A;  1GKG A;  4LOT A;  3SW0 X;  1OJY A;  3MQL A;  1HFH A;  3OP8 A;  1H2Q P;  3TVJ A;  5HYP A;  3IU3 I;  2MCZ A;  2YBY A;  5JPM G;  2JGW A;  2G7I A;  1FBR A;  2JRA A;  3KZJ A;  3GOV A;  5HYU B;  1C1Z A;  1H03 P;  2RKZ A;  1G4F A;  2QY0 A;  1U5M A;  4PZ5 A;  2CG6 A;  2O39 C;  1ELV A;  2EC3 A;  3OXU D;  4CSY A;  4FXG G;  1VVC A;  4B2S A;  3OED C;  2XWB F;  2XRB A;  1OK1 A;  4ONT D;  1OK9 A;  4A5W B;  4AYD A;  4AYI A;  1MD7 A;  1SS2 A;  4LOS A;  1QUB A;  2BZM A;  1UOT P;  4C16 A;  3GXE A;  3ZD1 A;  2RLP A;  3T5O A;  3ZD2 A;  2CKU A;  3CAL A;  5HZP B;  3L89 M;  1SRZ A;  3EJH A;  1NWV A;  2EHF A;  2YRA A;  4IGD A;  4DJZ A;  2IZ4 A;  2UWN A;  4KKD A;  1QO6 A;  2XRD A;  4JHS A;  1VVD A;  4YNX A;  1H04 P;  1H2P P;  4MUC A;  3INB C;  4F4O C;  1OJW A;  1PPQ A;  1ZJK A;  5FO8 C;  3ZRZ A;  1CKL A;  1G4G A;  1TPG A;  4B2R A;  1HCC A;  1E88 A;  1GHQ B;  4ZH1 D;  2LOJ A;  2RL0 A;  2A55 A;  1QGB A;  1O9A A;  3RJ3 D;  2KMS A;  2W81 A;  4AYM A;  1Q3X A;  2B5I D;  2ERJ A;  2MCY A;  2XWJ I;  3O8E B;  1TPN A;  2IZ3 A;  1OK2 A;  1OK3 A;  2XQW C;  4AYE A;  3NFP I;  1OJV A;  2KRI A;  3ERB A;  5HYT B;  2CG7 A;  1E8B A;  1Z92 B;  4J38 B;  1TPM A;  1HFI A;  2W80 A;  4WJG 2;  1E5G A;  2V8E A;  1LY2 A;  3KXV A;  3IX0 A;  3R62 A;  2JGX A;  2RKY A;  2WII C; 
#chains in the Genus database with same CATH topology
 1MD8 A;  1GKN A;  1GPZ A;  2RLQ A;  3M7P A;  4YIZ A;  5I0Q B;  4K12 A;  4BWC A;  1GKG A;  4LOT A;  3SW0 X;  2Y8T A;  1OJY A;  3MQL A;  1HFH A;  3OP8 A;  1H2Q P;  3TVJ A;  5HYP A;  4APL A;  3IU3 I;  2MCZ A;  2YBY A;  5JPM G;  2JGW A;  2Y8R A;  2G7I A;  1FBR A;  2JRA A;  3KZJ A;  3GOV A;  3WSY A;  5HYU B;  1C1Z A;  1H03 P;  2RKZ A;  3ZLE A;  1G4F A;  2QY0 A;  1U5M A;  4PZ5 A;  2CG6 A;  2O39 C;  1ELV A;  2EC3 A;  3OXU D;  4CSY A;  4FXG G;  1VVC A;  4B2S A;  3OED C;  2XWB F;  2XRB A;  1OK1 A;  4ONT D;  4MSL A;  1OK9 A;  4A5W B;  4AYD A;  3K3T A;  4AYI A;  1MD7 A;  1SS2 A;  4LOS A;  1QUB A;  2BZM A;  1UOT P;  4C16 A;  3GXE A;  3ZD1 A;  2RLP A;  3T5O A;  3ZD2 A;  2CKU A;  3CAL A;  3F6K A;  5HZP B;  1RLH A;  3L89 M;  1SRZ A;  3EJH A;  1NWV A;  2EHF A;  2YRA A;  4IGD A;  4DJZ A;  4PO7 A;  2IZ4 A;  2UWN A;  4KKD A;  4N7E A;  1QO6 A;  2XRD A;  3NJA A;  4JHS A;  1VVD A;  4YNX A;  1H04 P;  1H2P P;  4MUC A;  3INB C;  4F4O C;  1OJW A;  1PPQ A;  1ZJK A;  5DN5 A;  5FO8 C;  3ZRZ A;  1CKL A;  1G4G A;  1TPG A;  3CI0 J;  4B2R A;  1HCC A;  1E88 A;  3FGR A;  1GHQ B;  4ZH1 D;  2LOJ A;  2RL0 A;  2A55 A;  2X2Z A;  1QGB A;  1O9A A;  3RJ3 D;  2KMS A;  2W81 A;  3WSX A;  1Q3X A;  4AYM A;  2B5I D;  2ERJ A;  3FGT A;  2MCY A;  2XWJ I;  3O8E B;  1TPN A;  2IZ3 A;  1OK2 A;  1OK3 A;  2XQW C;  4AYE A;  3NFP I;  1OJV A;  2KRI A;  3ERB A;  5HYT B;  2CG7 A;  3VWO A;  1E8B A;  1Z92 B;  4J38 B;  5DN4 A;  1TPM A;  1HFI A;  2W80 A;  2Y8S A;  3ZLD A;  2I2L A;  4WJG 2;  1E5G A;  2V8E A;  1LY2 A;  3KXV A;  3IX0 A;  3R62 A;  2JGX A;  2ZYC A;  2RKY A;  2WII C; 
#chains in the Genus database with same CATH homology
 1MD8 A;  1GKN A;  1GPZ A;  2RLQ A;  3M7P A;  5I0Q B;  4K12 A;  1GKG A;  4LOT A;  3SW0 X;  1OJY A;  3MQL A;  1HFH A;  3OP8 A;  1H2Q P;  3TVJ A;  5HYP A;  3IU3 I;  2MCZ A;  2YBY A;  5JPM G;  2JGW A;  2G7I A;  1FBR A;  2JRA A;  3KZJ A;  3GOV A;  5HYU B;  1C1Z A;  1H03 P;  2RKZ A;  1G4F A;  2QY0 A;  1U5M A;  4PZ5 A;  2CG6 A;  2O39 C;  1ELV A;  2EC3 A;  3OXU D;  4CSY A;  4FXG G;  1VVC A;  4B2S A;  3OED C;  2XWB F;  2XRB A;  1OK1 A;  4ONT D;  1OK9 A;  4A5W B;  4AYD A;  4AYI A;  1MD7 A;  1SS2 A;  4LOS A;  1QUB A;  2BZM A;  1UOT P;  4C16 A;  3GXE A;  3ZD1 A;  2RLP A;  3T5O A;  3ZD2 A;  2CKU A;  3CAL A;  5HZP B;  3L89 M;  1SRZ A;  3EJH A;  1NWV A;  2EHF A;  2YRA A;  4IGD A;  4DJZ A;  2IZ4 A;  2UWN A;  4KKD A;  1QO6 A;  2XRD A;  4JHS A;  1VVD A;  4YNX A;  1H04 P;  1H2P P;  4MUC A;  3INB C;  4F4O C;  1OJW A;  1PPQ A;  1ZJK A;  5FO8 C;  3ZRZ A;  1CKL A;  1G4G A;  1TPG A;  4B2R A;  1HCC A;  1E88 A;  1GHQ B;  4ZH1 D;  2LOJ A;  2RL0 A;  2A55 A;  1QGB A;  1O9A A;  3RJ3 D;  2KMS A;  2W81 A;  4AYM A;  1Q3X A;  2B5I D;  2ERJ A;  2MCY A;  2XWJ I;  3O8E B;  1TPN A;  2IZ3 A;  1OK2 A;  1OK3 A;  2XQW C;  4AYE A;  3NFP I;  1OJV A;  2KRI A;  3ERB A;  5HYT B;  2CG7 A;  1E8B A;  1Z92 B;  4J38 B;  1TPM A;  1HFI A;  2W80 A;  4WJG 2;  1E5G A;  2V8E A;  1LY2 A;  3KXV A;  3IX0 A;  3R62 A;  2JGX A;  2RKY A;  2WII C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...