5HYUB

Structure of human c4b-binding protein alpha chain ccp domains 1 and 2 in complex with the hypervariable region of group a streptococcus m2 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
SNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M protein, serotype 2.1
publication title Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 21
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 5hyuB02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 5hyuB01
3L89M 2V8EA 4DJZA 1OJYA 3GXEA 2CG7A 1VVCA 2XWJI 4KKDA 4IGDA 1TPNA 3RJ3D 4ZH1D 1UOTP 2LOJA 3CALA 4FXGG 1ELVA 3ZD1A 4PZ5A 2MCZA 5HYUB 3ERBA 1E8BA 1G4GA 1OK3A 3IX0A 1C1ZA 3INBC 1SS2A 1GPZA 5I0QB 4LOSA 2BZMA 3MQLA 2WIIC 4MUCA 1PPQA 2XRBA 4YNXA 2UWNA 1OJWA 1Z92B 3R62A 5JPMG 4AYMA 4ONTD 4J38B 1OK9A 2KMSA 1OK1A 1H2QP 4WJG2 1GHQB 2EC3A 2CKUA 3TVJA 3M7PA 2RKZA 1LY2A 1G4FA 1MD7A 2O39C 2RKYA 1HCCA 2ERJA 3KXVA 2RLQA 2YBYA 3O8EB 1QGBA 1ZJKA 2G7IA 3OP8A 3EJHA 1E88A 1QO6A 1QUBA 4AYDA 2RLPA 2JGWA 2XWBF 4CSYA 3GOVA 1OJVA 3OEDC 1MD8A 2JRAA 3SW0X 2RL0A 2QY0A 1HFHA 3KZJA 3OXUD 3ZD2A 1TPGA 1GKGA 2A55A 2IZ3A 1H04P 2YRAA 1SRZA 1VVDA 5HYTB 2W80A 1U5MA 4AYIA 1E5GA 2IZ4A 1O9AA 2XQWC 4B2RA 4LOTA 2CG6A 2B5ID 1FBRA 2MCYA 1NWVA 1CKLA 2KRIA 1HFIA 1Q3XA 1TPMA 2W81A 4F4OC 5FO8C 4C16A 4JHSA 3T5OA 4AYEA 5HYPA 2EHFA 3IU3I 4K12A 3ZRZA 4A5WB 1OK2A 2JGXA 4B2SA 1H03P 1GKNA 3NFPI 5HZPB 1H2PP 2XRDA
chains in the Genus database with same CATH superfamily
3L89M 2V8EA 4DJZA 1OJYA 3GXEA 2CG7A 3VWOA 1VVCA 2XWJI 4KKDA 4IGDA 1TPNA 3RJ3D 4ZH1D 1UOTP 2LOJA 3CALA 4FXGG 1ELVA 3ZD1A 4PZ5A 2MCZA 4N7EA 5HYUB 3ERBA 1E8BA 2ZYCA 1G4GA 1OK3A 3IX0A 1C1ZA 3INBC 1SS2A 1GPZA 5I0QB 1RLHA 4LOSA 2BZMA 3MQLA 2WIIC 3FGTA 4YIZA 4MUCA 3WSXA 1PPQA 2XRBA 2Y8RA 4YNXA 4MSLA 2UWNA 1OJWA 1Z92B 3R62A 5JPMG 4AYMA 4ONTD 4J38B 1OK9A 2KMSA 2Y8SA 1OK1A 1H2QP 4WJG2 1GHQB 2EC3A 2I2LA 2CKUA 3TVJA 3M7PA 2RKZA 1LY2A 1G4FA 1MD7A 2O39C 2RKYA 1HCCA 2ERJA 3KXVA 3CI0J 2RLQA 2X2ZA 2YBYA 3O8EB 1QGBA 1ZJKA 2G7IA 3OP8A 3EJHA 1E88A 1QO6A 1QUBA 4AYDA 2RLPA 2JGWA 2XWBF 4CSYA 3GOVA 1OJVA 2Y8TA 3OEDC 3ZLDA 1MD8A 2JRAA 5DN5A 3FGRA 3SW0X 2RL0A 2QY0A 1HFHA 3KZJA 3OXUD 3ZD2A 1TPGA 1GKGA 2A55A 2IZ3A 1H04P 2YRAA 3F6KA 1SRZA 1VVDA 5HYTB 2W80A 1U5MA 4AYIA 1E5GA 4APLA 2IZ4A 1O9AA 2XQWC 4B2RA 4PO7A 4LOTA 2CG6A 2B5ID 1FBRA 3NJAA 5DN4A 2MCYA 1NWVA 1CKLA 2KRIA 1HFIA 3WSYA 1Q3XA 1TPMA 2W81A 4F4OC 5FO8C 4C16A 4JHSA 3T5OA 4AYEA 5HYPA 2EHFA 3IU3I 3K3TA 4K12A 3ZRZA 4A5WB 1OK2A 4BWCA 2JGXA 4B2SA 1H03P 1GKNA 3NFPI 5HZPB 1H2PP 2XRDA 3ZLEA
chains in the Genus database with same CATH topology
3L89M 2V8EA 4DJZA 1OJYA 3GXEA 2CG7A 1VVCA 2XWJI 4KKDA 4IGDA 1TPNA 3RJ3D 4ZH1D 1UOTP 2LOJA 3CALA 4FXGG 1ELVA 3ZD1A 4PZ5A 2MCZA 5HYUB 3ERBA 1E8BA 1G4GA 1OK3A 3IX0A 1C1ZA 3INBC 1SS2A 1GPZA 5I0QB 4LOSA 2BZMA 3MQLA 2WIIC 4MUCA 1PPQA 2XRBA 4YNXA 2UWNA 1OJWA 1Z92B 3R62A 5JPMG 4AYMA 4ONTD 4J38B 1OK9A 2KMSA 1OK1A 1H2QP 4WJG2 1GHQB 2EC3A 2CKUA 3TVJA 3M7PA 2RKZA 1LY2A 1G4FA 1MD7A 2O39C 2RKYA 1HCCA 2ERJA 3KXVA 2RLQA 2YBYA 3O8EB 1QGBA 1ZJKA 2G7IA 3OP8A 3EJHA 1E88A 1QO6A 1QUBA 4AYDA 2RLPA 2JGWA 2XWBF 4CSYA 3GOVA 1OJVA 3OEDC 1MD8A 2JRAA 3SW0X 2RL0A 2QY0A 1HFHA 3KZJA 3OXUD 3ZD2A 1TPGA 1GKGA 2A55A 2IZ3A 1H04P 2YRAA 1SRZA 1VVDA 5HYTB 2W80A 1U5MA 4AYIA 1E5GA 2IZ4A 1O9AA 2XQWC 4B2RA 4LOTA 2CG6A 2B5ID 1FBRA 2MCYA 1NWVA 1CKLA 2KRIA 1HFIA 1Q3XA 1TPMA 2W81A 4F4OC 5FO8C 4C16A 4JHSA 3T5OA 4AYEA 5HYPA 2EHFA 3IU3I 4K12A 3ZRZA 4A5WB 1OK2A 2JGXA 4B2SA 1H03P 1GKNA 3NFPI 5HZPB 1H2PP 2XRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L89 M;  2V8E A;  4DJZ A;  1OJY A;  3GXE A;  2CG7 A;  1VVC A;  2XWJ I;  4KKD A;  4IGD A;  1TPN A;  3RJ3 D;  4ZH1 D;  1UOT P;  2LOJ A;  3CAL A;  4FXG G;  1ELV A;  3ZD1 A;  4PZ5 A;  2MCZ A;  5HYU B;  3ERB A;  1E8B A;  1G4G A;  1OK3 A;  3IX0 A;  1C1Z A;  3INB C;  1SS2 A;  1GPZ A;  5I0Q B;  4LOS A;  2BZM A;  3MQL A;  2WII C;  4MUC A;  1PPQ A;  2XRB A;  4YNX A;  2UWN A;  1OJW A;  1Z92 B;  3R62 A;  5JPM G;  4AYM A;  4ONT D;  4J38 B;  1OK9 A;  2KMS A;  1OK1 A;  1H2Q P;  4WJG 2;  1GHQ B;  2EC3 A;  2CKU A;  3TVJ A;  3M7P A;  2RKZ A;  1LY2 A;  1G4F A;  1MD7 A;  2O39 C;  2RKY A;  1HCC A;  2ERJ A;  3KXV A;  2RLQ A;  2YBY A;  3O8E B;  1QGB A;  1ZJK A;  2G7I A;  3OP8 A;  3EJH A;  1E88 A;  1QO6 A;  1QUB A;  4AYD A;  2RLP A;  2JGW A;  2XWB F;  4CSY A;  3GOV A;  1OJV A;  3OED C;  1MD8 A;  2JRA A;  3SW0 X;  2RL0 A;  2QY0 A;  1HFH A;  3KZJ A;  3OXU D;  3ZD2 A;  1TPG A;  1GKG A;  2A55 A;  2IZ3 A;  1H04 P;  2YRA A;  1SRZ A;  1VVD A;  5HYT B;  2W80 A;  1U5M A;  4AYI A;  1E5G A;  2IZ4 A;  1O9A A;  2XQW C;  4B2R A;  4LOT A;  2CG6 A;  2B5I D;  1FBR A;  2MCY A;  1NWV A;  1CKL A;  2KRI A;  1HFI A;  1Q3X A;  1TPM A;  2W81 A;  4F4O C;  5FO8 C;  4C16 A;  4JHS A;  3T5O A;  4AYE A;  5HYP A;  2EHF A;  3IU3 I;  4K12 A;  3ZRZ A;  4A5W B;  1OK2 A;  2JGX A;  4B2S A;  1H03 P;  1GKN A;  3NFP I;  5HZP B;  1H2P P;  2XRD A; 
#chains in the Genus database with same CATH topology
 3L89 M;  2V8E A;  4DJZ A;  1OJY A;  3GXE A;  2CG7 A;  3VWO A;  1VVC A;  2XWJ I;  4KKD A;  4IGD A;  1TPN A;  3RJ3 D;  4ZH1 D;  1UOT P;  2LOJ A;  3CAL A;  4FXG G;  1ELV A;  3ZD1 A;  4PZ5 A;  2MCZ A;  4N7E A;  5HYU B;  3ERB A;  1E8B A;  2ZYC A;  1G4G A;  1OK3 A;  3IX0 A;  1C1Z A;  3INB C;  1SS2 A;  1GPZ A;  5I0Q B;  1RLH A;  4LOS A;  2BZM A;  3MQL A;  2WII C;  3FGT A;  4YIZ A;  4MUC A;  3WSX A;  1PPQ A;  2XRB A;  2Y8R A;  4YNX A;  4MSL A;  2UWN A;  1OJW A;  1Z92 B;  3R62 A;  5JPM G;  4AYM A;  4ONT D;  4J38 B;  1OK9 A;  2KMS A;  2Y8S A;  1OK1 A;  1H2Q P;  4WJG 2;  1GHQ B;  2EC3 A;  2I2L A;  2CKU A;  3TVJ A;  3M7P A;  2RKZ A;  1LY2 A;  1G4F A;  1MD7 A;  2O39 C;  2RKY A;  1HCC A;  2ERJ A;  3KXV A;  3CI0 J;  2RLQ A;  2X2Z A;  2YBY A;  3O8E B;  1QGB A;  1ZJK A;  2G7I A;  3OP8 A;  3EJH A;  1E88 A;  1QO6 A;  1QUB A;  4AYD A;  2RLP A;  2JGW A;  2XWB F;  4CSY A;  3GOV A;  1OJV A;  2Y8T A;  3OED C;  3ZLD A;  1MD8 A;  2JRA A;  5DN5 A;  3FGR A;  3SW0 X;  2RL0 A;  2QY0 A;  1HFH A;  3KZJ A;  3OXU D;  3ZD2 A;  1TPG A;  1GKG A;  2A55 A;  2IZ3 A;  1H04 P;  2YRA A;  3F6K A;  1SRZ A;  1VVD A;  5HYT B;  2W80 A;  1U5M A;  4AYI A;  1E5G A;  4APL A;  2IZ4 A;  1O9A A;  2XQW C;  4B2R A;  4PO7 A;  4LOT A;  2CG6 A;  2B5I D;  1FBR A;  3NJA A;  5DN4 A;  2MCY A;  1NWV A;  1CKL A;  2KRI A;  1HFI A;  3WSY A;  1Q3X A;  1TPM A;  2W81 A;  4F4O C;  5FO8 C;  4C16 A;  4JHS A;  3T5O A;  4AYE A;  5HYP A;  2EHF A;  3IU3 I;  3K3T A;  4K12 A;  3ZRZ A;  4A5W B;  1OK2 A;  4BWC A;  2JGX A;  4B2S A;  1H03 P;  1GKN A;  3NFP I;  5HZP B;  1H2P P;  2XRD A;  3ZLE A; 
#chains in the Genus database with same CATH homology
 3L89 M;  2V8E A;  4DJZ A;  1OJY A;  3GXE A;  2CG7 A;  1VVC A;  2XWJ I;  4KKD A;  4IGD A;  1TPN A;  3RJ3 D;  4ZH1 D;  1UOT P;  2LOJ A;  3CAL A;  4FXG G;  1ELV A;  3ZD1 A;  4PZ5 A;  2MCZ A;  5HYU B;  3ERB A;  1E8B A;  1G4G A;  1OK3 A;  3IX0 A;  1C1Z A;  3INB C;  1SS2 A;  1GPZ A;  5I0Q B;  4LOS A;  2BZM A;  3MQL A;  2WII C;  4MUC A;  1PPQ A;  2XRB A;  4YNX A;  2UWN A;  1OJW A;  1Z92 B;  3R62 A;  5JPM G;  4AYM A;  4ONT D;  4J38 B;  1OK9 A;  2KMS A;  1OK1 A;  1H2Q P;  4WJG 2;  1GHQ B;  2EC3 A;  2CKU A;  3TVJ A;  3M7P A;  2RKZ A;  1LY2 A;  1G4F A;  1MD7 A;  2O39 C;  2RKY A;  1HCC A;  2ERJ A;  3KXV A;  2RLQ A;  2YBY A;  3O8E B;  1QGB A;  1ZJK A;  2G7I A;  3OP8 A;  3EJH A;  1E88 A;  1QO6 A;  1QUB A;  4AYD A;  2RLP A;  2JGW A;  2XWB F;  4CSY A;  3GOV A;  1OJV A;  3OED C;  1MD8 A;  2JRA A;  3SW0 X;  2RL0 A;  2QY0 A;  1HFH A;  3KZJ A;  3OXU D;  3ZD2 A;  1TPG A;  1GKG A;  2A55 A;  2IZ3 A;  1H04 P;  2YRA A;  1SRZ A;  1VVD A;  5HYT B;  2W80 A;  1U5M A;  4AYI A;  1E5G A;  2IZ4 A;  1O9A A;  2XQW C;  4B2R A;  4LOT A;  2CG6 A;  2B5I D;  1FBR A;  2MCY A;  1NWV A;  1CKL A;  2KRI A;  1HFI A;  1Q3X A;  1TPM A;  2W81 A;  4F4O C;  5FO8 C;  4C16 A;  4JHS A;  3T5O A;  4AYE A;  5HYP A;  2EHF A;  3IU3 I;  4K12 A;  3ZRZ A;  4A5W B;  1OK2 A;  2JGX A;  4B2S A;  1H03 P;  1GKN A;  3NFP I;  5HZP B;  1H2P P;  2XRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...