5HYUB

Structure of human c4b-binding protein alpha chain ccp domains 1 and 2 in complex with the hypervariable region of group a streptococcus m2 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
SNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M protein, serotype 2.1
publication title Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 21
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 5hyuB02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 5hyuB01
4F4OC 1G4FA 2KRIA 1HCCA 1SS2A 2JGWA 3ZRZA 4A5WB 2IZ4A 2MCZA 3KXVA 2MCYA 3M7PA 4PZ5A 1UOTP 2UWNA 1QGBA 1Z92B 1ZJKA 2BZMA 2XWBF 4MUCA 5HZPB 2G7IA 2XRDA 3L89M 4YNXA 4K12A 1C1ZA 4JHSA 1MD7A 3IU3I 1GKNA 4DJZA 3ZD1A 3OP8A 1OK2A 1GPZA 1H04P 1NWVA 3GOVA 5HYPA 4AYMA 2EHFA 5HYTB 4IGDA 2CG6A 3O8EB 2RKZA 1OK9A 1H2PP 1OJVA 1SRZA 2B5ID 1TPGA 1U5MA 1E88A 2W81A 4ZH1D 1OJYA 1VVCA 4LOTA 1H03P 2V8EA 1MD8A 1VVDA 4AYDA 3NFPI 2CKUA 2EC3A 1QO6A 2YBYA 3EJHA 4B2SA 3GXEA 1OK1A 1G4GA 1GHQB 4B2RA 2XWJI 2CG7A 4CSYA 2RL0A 1CKLA 2A55A 1OJWA 3OEDC 1PPQA 2LOJA 4ONTD 3OXUD 4LOSA 4AYIA 3KZJA 1QUBA 1E8BA 5FO8C 1FBRA 3ERBA 2KMSA 2IZ3A 3INBC 3RJ3D 2JRAA 4J38B 1E5GA 2QY0A 4C16A 1GKGA 3TVJA 1H2QP 4KKDA 1OK3A 1LY2A 3R62A 1HFHA 5HYUB 3T5OA 3CALA 1Q3XA 2RLQA 1TPMA 4WJG2 2RKYA 2JGXA 1O9AA 2RLPA 5I0QB 3SW0X 2YRAA 2O39C 1TPNA 3ZD2A 2XQWC 3IX0A 1ELVA 4FXGG 2XRBA 3MQLA 2W80A 1HFIA 2WIIC 4AYEA 5JPMG 2ERJA
chains in the Genus database with same CATH superfamily
4F4OC 1G4FA 2KRIA 2Y8TA 1HCCA 1SS2A 2JGWA 3ZRZA 4A5WB 2IZ4A 2MCZA 3KXVA 2MCYA 3M7PA 4PZ5A 1UOTP 2UWNA 1QGBA 1Z92B 1ZJKA 2BZMA 2XWBF 4MUCA 5HZPB 2G7IA 2XRDA 3L89M 4YNXA 4K12A 1C1ZA 4YIZA 3K3TA 4JHSA 4BWCA 1MD7A 3IU3I 1GKNA 4DJZA 3ZD1A 1RLHA 3OP8A 2Y8SA 1OK2A 3WSYA 5DN5A 1GPZA 1H04P 1NWVA 2I2LA 3GOVA 5DN4A 4AYMA 2EHFA 5HYTB 5HYPA 4IGDA 2CG6A 2X2ZA 3O8EB 2RKZA 3CI0J 1OK9A 1H2PP 1OJVA 1SRZA 2Y8RA 2B5ID 1TPGA 1U5MA 1E88A 2W81A 4ZH1D 1OJYA 1VVCA 4LOTA 1H03P 2V8EA 1MD8A 1VVDA 4AYDA 3NFPI 2CKUA 2EC3A 3ZLEA 1QO6A 2YBYA 3EJHA 4B2SA 3GXEA 3FGTA 1OK1A 4APLA 1G4GA 1GHQB 4B2RA 2XWJI 2CG7A 4CSYA 2RL0A 1CKLA 2A55A 1OJWA 3OEDC 1PPQA 2LOJA 4ONTD 3OXUD 4LOSA 4AYIA 3KZJA 4MSLA 1QUBA 3ZLDA 1E8BA 5FO8C 1FBRA 3F6KA 3ERBA 2KMSA 2IZ3A 3INBC 3WSXA 4PO7A 3RJ3D 2JRAA 4J38B 1E5GA 2QY0A 4C16A 1GKGA 3NJAA 3TVJA 1H2QP 4KKDA 1OK3A 1LY2A 3R62A 1HFHA 5HYUB 3T5OA 3CALA 1Q3XA 2RLQA 1TPMA 4WJG2 2RKYA 2JGXA 1O9AA 2RLPA 5I0QB 3SW0X 2YRAA 2O39C 1TPNA 2ZYCA 3ZD2A 3VWOA 2XQWC 3IX0A 1ELVA 4FXGG 2XRBA 3FGRA 3MQLA 2W80A 1HFIA 2WIIC 4N7EA 4AYEA 5JPMG 2ERJA
chains in the Genus database with same CATH topology
4F4OC 1G4FA 2KRIA 1HCCA 1SS2A 2JGWA 3ZRZA 4A5WB 2IZ4A 2MCZA 3KXVA 2MCYA 3M7PA 4PZ5A 1UOTP 2UWNA 1QGBA 1Z92B 1ZJKA 2BZMA 2XWBF 4MUCA 5HZPB 2G7IA 2XRDA 3L89M 4YNXA 4K12A 1C1ZA 4JHSA 1MD7A 3IU3I 1GKNA 4DJZA 3ZD1A 3OP8A 1OK2A 1GPZA 1H04P 1NWVA 3GOVA 5HYPA 4AYMA 2EHFA 5HYTB 4IGDA 2CG6A 3O8EB 2RKZA 1OK9A 1H2PP 1OJVA 1SRZA 2B5ID 1TPGA 1U5MA 1E88A 2W81A 4ZH1D 1OJYA 1VVCA 4LOTA 1H03P 2V8EA 1MD8A 1VVDA 4AYDA 3NFPI 2CKUA 2EC3A 1QO6A 2YBYA 3EJHA 4B2SA 3GXEA 1OK1A 1G4GA 1GHQB 4B2RA 2XWJI 2CG7A 4CSYA 2RL0A 1CKLA 2A55A 1OJWA 3OEDC 1PPQA 2LOJA 4ONTD 3OXUD 4LOSA 4AYIA 3KZJA 1QUBA 1E8BA 5FO8C 1FBRA 3ERBA 2KMSA 2IZ3A 3INBC 3RJ3D 2JRAA 4J38B 1E5GA 2QY0A 4C16A 1GKGA 3TVJA 1H2QP 4KKDA 1OK3A 1LY2A 3R62A 1HFHA 5HYUB 3T5OA 3CALA 1Q3XA 2RLQA 1TPMA 4WJG2 2RKYA 2JGXA 1O9AA 2RLPA 5I0QB 3SW0X 2YRAA 2O39C 1TPNA 3ZD2A 2XQWC 3IX0A 1ELVA 4FXGG 2XRBA 3MQLA 2W80A 1HFIA 2WIIC 4AYEA 5JPMG 2ERJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F4O C;  1G4F A;  2KRI A;  1HCC A;  1SS2 A;  2JGW A;  3ZRZ A;  4A5W B;  2IZ4 A;  2MCZ A;  3KXV A;  2MCY A;  3M7P A;  4PZ5 A;  1UOT P;  2UWN A;  1QGB A;  1Z92 B;  1ZJK A;  2BZM A;  2XWB F;  4MUC A;  5HZP B;  2G7I A;  2XRD A;  3L89 M;  4YNX A;  4K12 A;  1C1Z A;  4JHS A;  1MD7 A;  3IU3 I;  1GKN A;  4DJZ A;  3ZD1 A;  3OP8 A;  1OK2 A;  1GPZ A;  1H04 P;  1NWV A;  3GOV A;  5HYP A;  4AYM A;  2EHF A;  5HYT B;  4IGD A;  2CG6 A;  3O8E B;  2RKZ A;  1OK9 A;  1H2P P;  1OJV A;  1SRZ A;  2B5I D;  1TPG A;  1U5M A;  1E88 A;  2W81 A;  4ZH1 D;  1OJY A;  1VVC A;  4LOT A;  1H03 P;  2V8E A;  1MD8 A;  1VVD A;  4AYD A;  3NFP I;  2CKU A;  2EC3 A;  1QO6 A;  2YBY A;  3EJH A;  4B2S A;  3GXE A;  1OK1 A;  1G4G A;  1GHQ B;  4B2R A;  2XWJ I;  2CG7 A;  4CSY A;  2RL0 A;  1CKL A;  2A55 A;  1OJW A;  3OED C;  1PPQ A;  2LOJ A;  4ONT D;  3OXU D;  4LOS A;  4AYI A;  3KZJ A;  1QUB A;  1E8B A;  5FO8 C;  1FBR A;  3ERB A;  2KMS A;  2IZ3 A;  3INB C;  3RJ3 D;  2JRA A;  4J38 B;  1E5G A;  2QY0 A;  4C16 A;  1GKG A;  3TVJ A;  1H2Q P;  4KKD A;  1OK3 A;  1LY2 A;  3R62 A;  1HFH A;  5HYU B;  3T5O A;  3CAL A;  1Q3X A;  2RLQ A;  1TPM A;  4WJG 2;  2RKY A;  2JGX A;  1O9A A;  2RLP A;  5I0Q B;  3SW0 X;  2YRA A;  2O39 C;  1TPN A;  3ZD2 A;  2XQW C;  3IX0 A;  1ELV A;  4FXG G;  2XRB A;  3MQL A;  2W80 A;  1HFI A;  2WII C;  4AYE A;  5JPM G;  2ERJ A; 
#chains in the Genus database with same CATH topology
 4F4O C;  1G4F A;  2KRI A;  2Y8T A;  1HCC A;  1SS2 A;  2JGW A;  3ZRZ A;  4A5W B;  2IZ4 A;  2MCZ A;  3KXV A;  2MCY A;  3M7P A;  4PZ5 A;  1UOT P;  2UWN A;  1QGB A;  1Z92 B;  1ZJK A;  2BZM A;  2XWB F;  4MUC A;  5HZP B;  2G7I A;  2XRD A;  3L89 M;  4YNX A;  4K12 A;  1C1Z A;  4YIZ A;  3K3T A;  4JHS A;  4BWC A;  1MD7 A;  3IU3 I;  1GKN A;  4DJZ A;  3ZD1 A;  1RLH A;  3OP8 A;  2Y8S A;  1OK2 A;  3WSY A;  5DN5 A;  1GPZ A;  1H04 P;  1NWV A;  2I2L A;  3GOV A;  5DN4 A;  4AYM A;  2EHF A;  5HYT B;  5HYP A;  4IGD A;  2CG6 A;  2X2Z A;  3O8E B;  2RKZ A;  3CI0 J;  1OK9 A;  1H2P P;  1OJV A;  1SRZ A;  2Y8R A;  2B5I D;  1TPG A;  1U5M A;  1E88 A;  2W81 A;  4ZH1 D;  1OJY A;  1VVC A;  4LOT A;  1H03 P;  2V8E A;  1MD8 A;  1VVD A;  4AYD A;  3NFP I;  2CKU A;  2EC3 A;  3ZLE A;  1QO6 A;  2YBY A;  3EJH A;  4B2S A;  3GXE A;  3FGT A;  1OK1 A;  4APL A;  1G4G A;  1GHQ B;  4B2R A;  2XWJ I;  2CG7 A;  4CSY A;  2RL0 A;  1CKL A;  2A55 A;  1OJW A;  3OED C;  1PPQ A;  2LOJ A;  4ONT D;  3OXU D;  4LOS A;  4AYI A;  3KZJ A;  4MSL A;  1QUB A;  3ZLD A;  1E8B A;  5FO8 C;  1FBR A;  3F6K A;  3ERB A;  2KMS A;  2IZ3 A;  3INB C;  3WSX A;  4PO7 A;  3RJ3 D;  2JRA A;  4J38 B;  1E5G A;  2QY0 A;  4C16 A;  1GKG A;  3NJA A;  3TVJ A;  1H2Q P;  4KKD A;  1OK3 A;  1LY2 A;  3R62 A;  1HFH A;  5HYU B;  3T5O A;  3CAL A;  1Q3X A;  2RLQ A;  1TPM A;  4WJG 2;  2RKY A;  2JGX A;  1O9A A;  2RLP A;  5I0Q B;  3SW0 X;  2YRA A;  2O39 C;  1TPN A;  2ZYC A;  3ZD2 A;  3VWO A;  2XQW C;  3IX0 A;  1ELV A;  4FXG G;  2XRB A;  3FGR A;  3MQL A;  2W80 A;  1HFI A;  2WII C;  4N7E A;  4AYE A;  5JPM G;  2ERJ A; 
#chains in the Genus database with same CATH homology
 4F4O C;  1G4F A;  2KRI A;  1HCC A;  1SS2 A;  2JGW A;  3ZRZ A;  4A5W B;  2IZ4 A;  2MCZ A;  3KXV A;  2MCY A;  3M7P A;  4PZ5 A;  1UOT P;  2UWN A;  1QGB A;  1Z92 B;  1ZJK A;  2BZM A;  2XWB F;  4MUC A;  5HZP B;  2G7I A;  2XRD A;  3L89 M;  4YNX A;  4K12 A;  1C1Z A;  4JHS A;  1MD7 A;  3IU3 I;  1GKN A;  4DJZ A;  3ZD1 A;  3OP8 A;  1OK2 A;  1GPZ A;  1H04 P;  1NWV A;  3GOV A;  5HYP A;  4AYM A;  2EHF A;  5HYT B;  4IGD A;  2CG6 A;  3O8E B;  2RKZ A;  1OK9 A;  1H2P P;  1OJV A;  1SRZ A;  2B5I D;  1TPG A;  1U5M A;  1E88 A;  2W81 A;  4ZH1 D;  1OJY A;  1VVC A;  4LOT A;  1H03 P;  2V8E A;  1MD8 A;  1VVD A;  4AYD A;  3NFP I;  2CKU A;  2EC3 A;  1QO6 A;  2YBY A;  3EJH A;  4B2S A;  3GXE A;  1OK1 A;  1G4G A;  1GHQ B;  4B2R A;  2XWJ I;  2CG7 A;  4CSY A;  2RL0 A;  1CKL A;  2A55 A;  1OJW A;  3OED C;  1PPQ A;  2LOJ A;  4ONT D;  3OXU D;  4LOS A;  4AYI A;  3KZJ A;  1QUB A;  1E8B A;  5FO8 C;  1FBR A;  3ERB A;  2KMS A;  2IZ3 A;  3INB C;  3RJ3 D;  2JRA A;  4J38 B;  1E5G A;  2QY0 A;  4C16 A;  1GKG A;  3TVJ A;  1H2Q P;  4KKD A;  1OK3 A;  1LY2 A;  3R62 A;  1HFH A;  5HYU B;  3T5O A;  3CAL A;  1Q3X A;  2RLQ A;  1TPM A;  4WJG 2;  2RKY A;  2JGX A;  1O9A A;  2RLP A;  5I0Q B;  3SW0 X;  2YRA A;  2O39 C;  1TPN A;  3ZD2 A;  2XQW C;  3IX0 A;  1ELV A;  4FXG G;  2XRB A;  3MQL A;  2W80 A;  1HFI A;  2WII C;  4AYE A;  5JPM G;  2ERJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...