5HZOA

Gfp mutant s205g
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
230
structure length
229
Chain Sequence
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQGALSKDPNEKRDHMVLLEFVTAAGITHGMDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Ultrafast Dynamics and Mechanisms of Proton Transfer in the GFP S205G Mutant
rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 55
structure length 229
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5hzoA00
2HQKA 1H4UA 1MYWA 1YJ2A 4NWSA 4XOWA 3OSQA 4JEOA 4IK8A 4RYWA 3ST2A 3CBEA 3DPXA 2VZXA 4W7AA 3RWAA 2FZUA 2HGDA 3LVCA 4Q7TA 4W6IA 1KYSA 3EVRA 3CFFA 4L1IA 3CD1A 4ZINA 1RMPA 5HZTA 3SVBA 2VVIA 4EDSA 4W6TA 4W7CA 2WHSA 2FL1A 4KAGA 3WLCA 4GOBA 3SSHA 5LK4A 2EMDA 2B3QA 2EMNA 2AWKA 2DUGA 2YFPA 4W7FA 4OJ0A 3SVCA 2QLGA 5BT0A 4HVFA 3LVDA 4H48A 4DKMA 3NT3A 1Q4CA 2IOVA 4LJDC 3DQUA 3GL4A 3DQ2A 2P4MA 3WLDA 1F0BA 2GW3A 3NF0A 3P28A 3U0LA 4H3NA 4DXQA 1UISA 2Y0GA 5DY6A 4W7XA 1KYRA 3DQ7A 4JF9A 1GL4A 3SSVA 2GX2A 4UTSA 4B5YA 2VAEA 4RTCA 4P76A 3W1CA 4W73A 2H5PA 4HQCA 2HFCA 2AWMA 3A8SA 2QLEA 4ZF5A 1EMFA 5EB6A 1OXEA 5HGEA 2YDZA 3ADFA 2OTBA 3DQ3A 3DQLA 4GESB 4KA9A 4L13A 1W7TA 4B30A 4Z4KA 1MOUA 4W72A 5EJUA 2OGRA 1C4FA 4W6PA 2VVHA 3VICA 3OSRA 4ANJA 1QYOA 4EN1A 2WISA 4HE4A 2HCGA 2VADA 4J89A 4W6RA 2QT2A 4KW4A 5T3IA 3LF4B 1G7KA 4EDOA 3DQEA 1GFLA 3SG6A 4H3MA 4JRBA 5DPJA 2A56B 2O24A 3NT9A 2G3OA 5DPIA 4JFGA 4ZIOA 3OGOA 4EULA 5EB7A 3SSLA 4KF5C 4LJDA 3PIBA 2G6YA 3IP2A 4W6JA 1HUYA 4H47A 3DPWA 3CD9A 2DD7A 1EMGA 4IZNA 3DQMA 3NEDA 3GJ1A 3EVPA 4Q9XA 4LJBA 2DUEA 3DQNA 3SG4A 3TMRA 3EKHA 1JBZA 1YHHA 4XOVA 4W76A 1BFPA 3DQCA 3CFAA 4ZBLA 1QYQA 2A46A 3EKJA 1EMLA 4U2VA 1OXDA 5HZSA 3ZTFA 4GF6B 3SG3A 3DQ4A 4TZAA 2Z6ZA 5BQLA 1ZUXA 4KW8A 4XGYA 2H8QA 2QLHA 1Q4DA 2A50B 3ED8A 4RYSA 1YHIA 2DD9A 4OY4A 5FVGA 5DU0A 4PPKA 2G5ZB 1H6RA 2WSNA 4LW5A 2YE1A 2H5OA 2RH7A 2QLIA 5DTYA 4DXNA 3MGFA 4ZF3A 4ZFSA 3WCKA 5DPGA 3LVAA 1B9CA 2HRSA 2A54B 2WSOA 3H1OA 2POXA 2PXSA 1KYPA 1Q4AA 1YZWA 5FVFA 4EMQA 2HGYA 2JADA 4OQWA 4AS8A 2H6VA 1F09A 2OKYA 2AWJA 3VHTB 2G6XA 1YFPA 3PJ5A 3UFZA 3M24A 2WHTA 2DDCA 4TZGA 2ZO7A 4W6AA 3DQFA 2A53B 5EXUA 2AWLA 3PJBA 2QU1A 4DXMA 5DTZA 2ICRA 5KTGA 5DQMA 4KGEA 3SVNA 2V4EC 1JC0A 3SVSA 3P8UA 3DQ9A 3DQJA 1QY3A 3LSAA 4W7RA 1ZGQA 4W6NA 4AR7A 2A47A 1W7UA 1OXFA 2WURA 2G2SB 3SG2A 2WHUA 1QXTA 4ZB1A 2OJKA 4IK3A 4W6GA 3RWTA 4W6KA 2WIQA 2G6EA 2G16B 3DQ8A 4W75A 3SSKA 5HBDA 3SV5A 1RMMA 3UG0A 4DXOA 3DPZA 3BXBA 1JBYA 4IK5A 5H89A 4IK4A 3BX9A 4DXIA 1S6ZA 3U0NA 2GX0A 3AI5A 2OTEA 3DQ5A 4KEXA 3U0KA 2AHAA 4IK1A 5LTPA 2GW4B 4DXPA 2IB5A 4PPLA 1EMBA 5DRFA 4H3LA 3IR8A 4XL5A 3SVOA 4N3DA 1KP5A 1W7SA 2QRFA 2HPWA 3SVRA 5BTTB 2O2BA 5BTTA 3AKOA 2A48A 4W6MA 5DTLA 2ZO6A 3TMTA 4ZF4A 4W6FA 4XVPA 1HCJA 1MOVA 4W74A 1EMEA 3U8AA 1ZGPA 3ST4A 2V4EB 3E5TA 3U8CA 2V4EA 3H1RA 3KCTA 3M22A 5LTRA 2Q6PA 5EXBA 1EMMA 4W77A 4Q9WA 4KPIA 4LQUA 4OHSA 5F9GA 3GEXA 1RM9A 4Q7UA 3SSYA 3CGLA 1XMZA 3ZUJA 2Z6XA 4W7EA 4PPJA 2ARLA 3SG5A 1XSSA 1RRXA 3SVDA 5HW9A 2H9WA 5AQBB 4Z4MA 4Q7RA 4W6BA 4W7DA 3KCSA 1XQMA 2ZMUA 3CFHA 4L12A 3NEZA 4JC2A 4KF5A 3VHTA 2C9JA 3SG7A 3LS3A 2QLGB 1Z1PA 4HQ8A 2DUHA 1EMAA 1Q4BA 3EK8A 4W6UA 3EK4A 3LF3A 2ZMWA 3I19A 1JC1A 4W69A 2QZ0A 5EBJA 2BTJA 2IE2A 2DDDA 5DPHA 5EHUA 3SVEA 5HZUA 4W6LA 1YJFA 5LTQA 2Q57A 5J2OA 1Q4EA 3K1KA 2O29A 4W6OA 3U8PA 3DQDA 3U0MA 1CV7A 4P1QA 4KGFA 3ST3A 2EMOA 5H87A 1EMCA 3E5WA 3EVUA 5H88A 4W6CA 3SVUA 4HQ9A 3LA1A 3SSPA 4R6DA 2DUIA 2Z6YA 3DQAA 3EK7A 5DQBA 4W6SA 3G9AA 2AH8A 2C9IA 3ZUFA 4DKNA 1GGXA 4JGEA 4I2YA 1Q73A 5DTXA 2OKWA 4B30B 3CB9A 3E5VA 3O77A 4W6DA 3BXCA 4OGSA 4ORNA 4W6HA 5DRGA 3S05A 5EXCI 2PXWA 4LJCA 1EMKA 2HQZA 4BDUA 1Z1QA 3DQIA 3GB3A 4J8AA 2VVJA 4LQTA 1XAEA 3BXAA 4PFEA 4J88A 2B3PA 3ST0A 3DQ6A 3AI4A 1ZGOA 3W1DA 3GJ2A 2Z1OA 3O78A 4KW9A 3DQHA 3SS0A 3DQ1A 1XA9A 1QYFA 5FVIA 2G3DB 4KF4A 2HJOA 2YE0A 3DQKA 3SSTA 3SRYA 2A52B 1YHGA 3V3DA 2FWQA 3DQOA 3EVVA 3VK1A 2DUFA 2H5QA 2H5RA 4R6BA 4IK9A 1RMOA 5HZOA 5FHVA 2IB6A 3ZULA 3PJ7A
chains in the Genus database with same CATH superfamily
2HQKA 1H4UA 1MYWA 1YJ2A 4NWSA 4XOWA 3OSQA 4JEOA 4IK8A 4RYWA 3ST2A 3CBEA 3DPXA 2VZXA 4W7AA 3RWAA 2FZUA 2HGDA 3LVCA 4Q7TA 4W6IA 1KYSA 3EVRA 3CFFA 4L1IA 3CD1A 4ZINA 1RMPA 5HZTA 3SVBA 2VVIA 4EDSA 4W6TA 4W7CA 2WHSA 2FL1A 4KAGA 3WLCA 4GOBA 3SSHA 5LK4A 2EMDA 2B3QA 2EMNA 2AWKA 2DUGA 2YFPA 4W7FA 4OJ0A 3SVCA 2QLGA 5BT0A 4HVFA 3LVDA 4H48A 4DKMA 3NT3A 1Q4CA 2IOVA 4LJDC 3DQUA 3GL4A 3DQ2A 2P4MA 3WLDA 1F0BA 2GW3A 3NF0A 3P28A 3U0LA 4H3NA 4DXQA 1UISA 2Y0GA 5DY6A 4W7XA 1KYRA 3DQ7A 4JF9A 1GL4A 3SSVA 2GX2A 4UTSA 4B5YA 2VAEA 4RTCA 4P76A 3W1CA 4W73A 2H5PA 4HQCA 2HFCA 2AWMA 3A8SA 2QLEA 4ZF5A 1EMFA 5EB6A 1OXEA 5HGEA 2YDZA 3ADFA 2OTBA 3DQ3A 3DQLA 4GESB 4KA9A 4L13A 1W7TA 4B30A 4Z4KA 1MOUA 4W72A 5EJUA 2OGRA 1C4FA 4W6PA 2VVHA 3VICA 3OSRA 4ANJA 1QYOA 4EN1A 2WISA 4HE4A 2HCGA 2VADA 4J89A 4W6RA 2QT2A 4KW4A 5T3IA 3LF4B 1G7KA 4EDOA 3DQEA 1GFLA 3SG6A 4H3MA 4JRBA 5DPJA 2A56B 2O24A 3NT9A 2G3OA 5DPIA 4JFGA 4ZIOA 3OGOA 4EULA 5EB7A 3SSLA 4KF5C 4LJDA 3PIBA 2G6YA 3IP2A 4W6JA 1HUYA 4H47A 3DPWA 3CD9A 2DD7A 1EMGA 4IZNA 3DQMA 3NEDA 3GJ1A 3EVPA 4Q9XA 4LJBA 2DUEA 3DQNA 3SG4A 3TMRA 3EKHA 1JBZA 1YHHA 4XOVA 4W76A 1BFPA 3DQCA 3CFAA 4ZBLA 1QYQA 2A46A 3EKJA 1EMLA 4U2VA 1OXDA 5HZSA 3ZTFA 4GF6B 3SG3A 3DQ4A 4TZAA 2Z6ZA 5BQLA 1ZUXA 4KW8A 4XGYA 2H8QA 2QLHA 1Q4DA 2A50B 3ED8A 4RYSA 1YHIA 2DD9A 4OY4A 5FVGA 5DU0A 4PPKA 2G5ZB 1H6RA 2WSNA 4LW5A 2YE1A 2H5OA 2RH7A 2QLIA 5DTYA 4DXNA 3MGFA 4ZF3A 4ZFSA 3WCKA 5DPGA 3LVAA 1B9CA 2HRSA 2A54B 2WSOA 3H1OA 2POXA 2PXSA 1KYPA 1Q4AA 1YZWA 5FVFA 4EMQA 2HGYA 2JADA 4OQWA 4AS8A 2H6VA 1F09A 2OKYA 2AWJA 3VHTB 2G6XA 1YFPA 3PJ5A 3UFZA 3M24A 2WHTA 2DDCA 4TZGA 2ZO7A 4W6AA 3DQFA 2A53B 5EXUA 2AWLA 3PJBA 2QU1A 4DXMA 5DTZA 2ICRA 5KTGA 5DQMA 4KGEA 3SVNA 2V4EC 1JC0A 3SVSA 3P8UA 3DQ9A 3DQJA 1QY3A 3LSAA 4W7RA 1ZGQA 4W6NA 4AR7A 2A47A 1W7UA 1OXFA 2WURA 2G2SB 3SG2A 2WHUA 1QXTA 4ZB1A 2OJKA 4IK3A 4W6GA 3RWTA 4W6KA 2WIQA 2G6EA 2G16B 3DQ8A 4W75A 3SSKA 5HBDA 3SV5A 1RMMA 3UG0A 4DXOA 3DPZA 3BXBA 1JBYA 4IK5A 5H89A 4IK4A 3BX9A 4DXIA 1S6ZA 3U0NA 2GX0A 3AI5A 2OTEA 3DQ5A 4KEXA 3U0KA 2AHAA 4IK1A 5LTPA 2GW4B 4DXPA 2IB5A 4PPLA 1EMBA 5DRFA 4H3LA 3IR8A 4XL5A 3SVOA 4N3DA 1KP5A 1W7SA 2QRFA 2HPWA 3SVRA 5BTTB 2O2BA 5BTTA 3AKOA 2A48A 4W6MA 5DTLA 2ZO6A 3TMTA 4ZF4A 4W6FA 4XVPA 1HCJA 1MOVA 4W74A 1EMEA 3U8AA 1ZGPA 3ST4A 2V4EB 3E5TA 3U8CA 2V4EA 3H1RA 3KCTA 3M22A 5LTRA 2Q6PA 5EXBA 1EMMA 4W77A 4Q9WA 4KPIA 4LQUA 4OHSA 5F9GA 3GEXA 1RM9A 4Q7UA 3SSYA 3CGLA 1XMZA 3ZUJA 2Z6XA 4W7EA 4PPJA 2ARLA 3SG5A 1XSSA 1RRXA 3SVDA 5HW9A 2H9WA 5AQBB 4Z4MA 4Q7RA 4W6BA 4W7DA 3KCSA 1XQMA 2ZMUA 3CFHA 4L12A 3NEZA 4JC2A 4KF5A 3VHTA 2C9JA 3SG7A 3LS3A 2QLGB 1Z1PA 4HQ8A 2DUHA 1EMAA 1Q4BA 3EK8A 4W6UA 3EK4A 3LF3A 2ZMWA 3I19A 1JC1A 4W69A 2QZ0A 5EBJA 2BTJA 2IE2A 2DDDA 5DPHA 5EHUA 3SVEA 5HZUA 4W6LA 1YJFA 5LTQA 2Q57A 5J2OA 1Q4EA 3K1KA 2O29A 4W6OA 3U8PA 3DQDA 3U0MA 1CV7A 4P1QA 4KGFA 3ST3A 2EMOA 5H87A 1EMCA 3E5WA 3EVUA 5H88A 4W6CA 3SVUA 4HQ9A 3LA1A 3SSPA 4R6DA 2DUIA 2Z6YA 3DQAA 3EK7A 5DQBA 4W6SA 3G9AA 2AH8A 2C9IA 3ZUFA 4DKNA 1GGXA 4JGEA 4I2YA 1Q73A 5DTXA 2OKWA 4B30B 3CB9A 3E5VA 3O77A 4W6DA 3BXCA 4OGSA 4ORNA 4W6HA 5DRGA 3S05A 5EXCI 2PXWA 4LJCA 1EMKA 2HQZA 4BDUA 1Z1QA 3DQIA 3GB3A 4J8AA 2VVJA 4LQTA 1XAEA 3BXAA 4PFEA 4J88A 2B3PA 3ST0A 3DQ6A 3AI4A 1ZGOA 3W1DA 3GJ2A 2Z1OA 3O78A 4KW9A 3DQHA 3SS0A 3DQ1A 1XA9A 1QYFA 5FVIA 2G3DB 4KF4A 2HJOA 2YE0A 3DQKA 3SSTA 3SRYA 2A52B 1YHGA 3V3DA 2FWQA 3DQOA 3EVVA 3VK1A 2DUFA 2H5QA 2H5RA 4R6BA 4IK9A 1RMOA 5HZOA 5FHVA 2IB6A 3ZULA 3PJ7A
chains in the Genus database with same CATH topology
2HQKA 1H4UA 1MYWA 1YJ2A 4NWSA 4XOWA 3OSQA 4JEOA 4IK8A 4RYWA 3ST2A 3CBEA 3DPXA 2VZXA 4W7AA 3RWAA 2FZUA 2HGDA 3LVCA 4Q7TA 4W6IA 1KYSA 3EVRA 3CFFA 4L1IA 3CD1A 4ZINA 1RMPA 5HZTA 3SVBA 2VVIA 4EDSA 4W6TA 4W7CA 2WHSA 2FL1A 4KAGA 3WLCA 4GOBA 3SSHA 5LK4A 2EMDA 2B3QA 2EMNA 2AWKA 2DUGA 2YFPA 4W7FA 4OJ0A 3SVCA 2QLGA 5BT0A 4HVFA 3LVDA 4H48A 4DKMA 3NT3A 1Q4CA 2IOVA 4LJDC 3DQUA 3GL4A 3DQ2A 2P4MA 3WLDA 1F0BA 2GW3A 3NF0A 3P28A 3U0LA 4H3NA 4DXQA 1UISA 2Y0GA 5DY6A 4W7XA 1KYRA 3DQ7A 4JF9A 1GL4A 3SSVA 2GX2A 4UTSA 4B5YA 2VAEA 4RTCA 4P76A 3W1CA 4W73A 2H5PA 4HQCA 2HFCA 2AWMA 3A8SA 2QLEA 4ZF5A 1EMFA 5EB6A 1OXEA 5HGEA 2YDZA 3ADFA 2OTBA 3DQ3A 3DQLA 4GESB 4KA9A 4L13A 1W7TA 4B30A 4Z4KA 1MOUA 4W72A 5EJUA 2OGRA 1C4FA 4W6PA 2VVHA 3VICA 3OSRA 4ANJA 1QYOA 4EN1A 2WISA 4HE4A 2HCGA 2VADA 4J89A 4W6RA 2QT2A 4KW4A 5T3IA 3LF4B 1G7KA 4EDOA 3DQEA 1GFLA 3SG6A 4H3MA 4JRBA 5DPJA 2A56B 2O24A 3NT9A 2G3OA 5DPIA 4JFGA 4ZIOA 3OGOA 4EULA 5EB7A 3SSLA 4KF5C 4LJDA 3PIBA 2G6YA 3IP2A 4W6JA 1HUYA 4H47A 3DPWA 3CD9A 2DD7A 1EMGA 4IZNA 3DQMA 3NEDA 3GJ1A 3EVPA 4Q9XA 4LJBA 2DUEA 3DQNA 3SG4A 3TMRA 3EKHA 1JBZA 1YHHA 4XOVA 4W76A 1BFPA 3DQCA 3CFAA 4ZBLA 1QYQA 2A46A 3EKJA 1EMLA 4U2VA 1OXDA 5HZSA 3ZTFA 4GF6B 3SG3A 3DQ4A 4TZAA 2Z6ZA 5BQLA 1ZUXA 4KW8A 4XGYA 2H8QA 2QLHA 1Q4DA 2A50B 3ED8A 4RYSA 1YHIA 2DD9A 4OY4A 5FVGA 5DU0A 4PPKA 2G5ZB 1H6RA 2WSNA 4LW5A 2YE1A 2H5OA 2RH7A 2QLIA 5DTYA 4DXNA 3MGFA 4ZF3A 4ZFSA 3WCKA 5DPGA 3LVAA 1B9CA 2HRSA 2A54B 2WSOA 3H1OA 2POXA 2PXSA 1KYPA 1Q4AA 1YZWA 5FVFA 4EMQA 2HGYA 2JADA 4OQWA 4AS8A 2H6VA 1F09A 2OKYA 2AWJA 3VHTB 2G6XA 1YFPA 3PJ5A 3UFZA 3M24A 2WHTA 2DDCA 4TZGA 2ZO7A 4W6AA 3DQFA 2A53B 5EXUA 2AWLA 3PJBA 2QU1A 4DXMA 5DTZA 2ICRA 5KTGA 5DQMA 4KGEA 3SVNA 2V4EC 1JC0A 3SVSA 3P8UA 3DQ9A 3DQJA 1QY3A 3LSAA 4W7RA 1ZGQA 4W6NA 4AR7A 2A47A 1W7UA 1OXFA 2WURA 2G2SB 3SG2A 2WHUA 1QXTA 4ZB1A 2OJKA 4IK3A 4W6GA 3RWTA 4W6KA 2WIQA 2G6EA 2G16B 3DQ8A 4W75A 3SSKA 5HBDA 3SV5A 1RMMA 3UG0A 4DXOA 3DPZA 3BXBA 1JBYA 4IK5A 5H89A 4IK4A 3BX9A 4DXIA 1S6ZA 3U0NA 2GX0A 3AI5A 2OTEA 3DQ5A 4KEXA 3U0KA 2AHAA 4IK1A 5LTPA 2GW4B 4DXPA 2IB5A 4PPLA 1EMBA 5DRFA 4H3LA 3IR8A 4XL5A 3SVOA 4N3DA 1KP5A 1W7SA 2QRFA 2HPWA 3SVRA 5BTTB 2O2BA 5BTTA 3AKOA 2A48A 4W6MA 5DTLA 2ZO6A 3TMTA 4ZF4A 4W6FA 4XVPA 1HCJA 1MOVA 4W74A 1EMEA 3U8AA 1ZGPA 3ST4A 2V4EB 3E5TA 3U8CA 2V4EA 3H1RA 3KCTA 3M22A 5LTRA 2Q6PA 5EXBA 1EMMA 4W77A 4Q9WA 4KPIA 4LQUA 4OHSA 5F9GA 3GEXA 1RM9A 4Q7UA 3SSYA 3CGLA 1XMZA 3ZUJA 2Z6XA 4W7EA 4PPJA 2ARLA 3SG5A 1XSSA 1RRXA 3SVDA 5HW9A 2H9WA 5AQBB 4Z4MA 4Q7RA 4W6BA 4W7DA 3KCSA 1XQMA 2ZMUA 3CFHA 4L12A 3NEZA 4JC2A 4KF5A 3VHTA 2C9JA 3SG7A 3LS3A 2QLGB 1Z1PA 4HQ8A 2DUHA 1EMAA 1Q4BA 3EK8A 4W6UA 3EK4A 3LF3A 2ZMWA 3I19A 1JC1A 4W69A 2QZ0A 5EBJA 2BTJA 2IE2A 2DDDA 5DPHA 5EHUA 3SVEA 5HZUA 4W6LA 1YJFA 5LTQA 2Q57A 5J2OA 1Q4EA 3K1KA 2O29A 4W6OA 3U8PA 3DQDA 3U0MA 1CV7A 4P1QA 4KGFA 3ST3A 2EMOA 5H87A 1EMCA 3E5WA 3EVUA 5H88A 4W6CA 3SVUA 4HQ9A 3LA1A 3SSPA 4R6DA 2DUIA 2Z6YA 3DQAA 3EK7A 5DQBA 4W6SA 3G9AA 2AH8A 2C9IA 3ZUFA 4DKNA 1GGXA 4JGEA 4I2YA 1Q73A 5DTXA 2OKWA 4B30B 3CB9A 3E5VA 3O77A 4W6DA 3BXCA 4OGSA 4ORNA 4W6HA 5DRGA 3S05A 5EXCI 2PXWA 4LJCA 1EMKA 2HQZA 4BDUA 1Z1QA 3DQIA 3GB3A 4J8AA 2VVJA 4LQTA 1XAEA 3BXAA 4PFEA 4J88A 2B3PA 3ST0A 3DQ6A 3AI4A 1ZGOA 3W1DA 3GJ2A 2Z1OA 3O78A 4KW9A 3DQHA 3SS0A 3DQ1A 1XA9A 1QYFA 5FVIA 2G3DB 4KF4A 2HJOA 2YE0A 3DQKA 3SSTA 3SRYA 2A52B 1YHGA 3V3DA 2FWQA 3DQOA 3EVVA 3VK1A 2DUFA 2H5QA 2H5RA 4R6BA 4IK9A 1RMOA 5HZOA 5FHVA 2IB6A 3ZULA 3PJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQK A;  1H4U A;  1MYW A;  1YJ2 A;  4NWS A;  4XOW A;  3OSQ A;  4JEO A;  4IK8 A;  4RYW A;  3ST2 A;  3CBE A;  3DPX A;  2VZX A;  4W7A A;  3RWA A;  2FZU A;  2HGD A;  3LVC A;  4Q7T A;  4W6I A;  1KYS A;  3EVR A;  3CFF A;  4L1I A;  3CD1 A;  4ZIN A;  1RMP A;  5HZT A;  3SVB A;  2VVI A;  4EDS A;  4W6T A;  4W7C A;  2WHS A;  2FL1 A;  4KAG A;  3WLC A;  4GOB A;  3SSH A;  5LK4 A;  2EMD A;  2B3Q A;  2EMN A;  2AWK A;  2DUG A;  2YFP A;  4W7F A;  4OJ0 A;  3SVC A;  2QLG A;  5BT0 A;  4HVF A;  3LVD A;  4H48 A;  4DKM A;  3NT3 A;  1Q4C A;  2IOV A;  4LJD C;  3DQU A;  3GL4 A;  3DQ2 A;  2P4M A;  3WLD A;  1F0B A;  2GW3 A;  3NF0 A;  3P28 A;  3U0L A;  4H3N A;  4DXQ A;  1UIS A;  2Y0G A;  5DY6 A;  4W7X A;  1KYR A;  3DQ7 A;  4JF9 A;  1GL4 A;  3SSV A;  2GX2 A;  4UTS A;  4B5Y A;  2VAE A;  4RTC A;  4P76 A;  3W1C A;  4W73 A;  2H5P A;  4HQC A;  2HFC A;  2AWM A;  3A8S A;  2QLE A;  4ZF5 A;  1EMF A;  5EB6 A;  1OXE A;  5HGE A;  2YDZ A;  3ADF A;  2OTB A;  3DQ3 A;  3DQL A;  4GES B;  4KA9 A;  4L13 A;  1W7T A;  4B30 A;  4Z4K A;  1MOU A;  4W72 A;  5EJU A;  2OGR A;  1C4F A;  4W6P A;  2VVH A;  3VIC A;  3OSR A;  4ANJ A;  1QYO A;  4EN1 A;  2WIS A;  4HE4 A;  2HCG A;  2VAD A;  4J89 A;  4W6R A;  2QT2 A;  4KW4 A;  5T3I A;  3LF4 B;  1G7K A;  4EDO A;  3DQE A;  1GFL A;  3SG6 A;  4H3M A;  4JRB A;  5DPJ A;  2A56 B;  2O24 A;  3NT9 A;  2G3O A;  5DPI A;  4JFG A;  4ZIO A;  3OGO A;  4EUL A;  5EB7 A;  3SSL A;  4KF5 C;  4LJD A;  3PIB A;  2G6Y A;  3IP2 A;  4W6J A;  1HUY A;  4H47 A;  3DPW A;  3CD9 A;  2DD7 A;  1EMG A;  4IZN A;  3DQM A;  3NED A;  3GJ1 A;  3EVP A;  4Q9X A;  4LJB A;  2DUE A;  3DQN A;  3SG4 A;  3TMR A;  3EKH A;  1JBZ A;  1YHH A;  4XOV A;  4W76 A;  1BFP A;  3DQC A;  3CFA A;  4ZBL A;  1QYQ A;  2A46 A;  3EKJ A;  1EML A;  4U2V A;  1OXD A;  5HZS A;  3ZTF A;  4GF6 B;  3SG3 A;  3DQ4 A;  4TZA A;  2Z6Z A;  5BQL A;  1ZUX A;  4KW8 A;  4XGY A;  2H8Q A;  2QLH A;  1Q4D A;  2A50 B;  3ED8 A;  4RYS A;  1YHI A;  2DD9 A;  4OY4 A;  5FVG A;  5DU0 A;  4PPK A;  2G5Z B;  1H6R A;  2WSN A;  4LW5 A;  2YE1 A;  2H5O A;  2RH7 A;  2QLI A;  5DTY A;  4DXN A;  3MGF A;  4ZF3 A;  4ZFS A;  3WCK A;  5DPG A;  3LVA A;  1B9C A;  2HRS A;  2A54 B;  2WSO A;  3H1O A;  2POX A;  2PXS A;  1KYP A;  1Q4A A;  1YZW A;  5FVF A;  4EMQ A;  2HGY A;  2JAD A;  4OQW A;  4AS8 A;  2H6V A;  1F09 A;  2OKY A;  2AWJ A;  3VHT B;  2G6X A;  1YFP A;  3PJ5 A;  3UFZ A;  3M24 A;  2WHT A;  2DDC A;  4TZG A;  2ZO7 A;  4W6A A;  3DQF A;  2A53 B;  5EXU A;  2AWL A;  3PJB A;  2QU1 A;  4DXM A;  5DTZ A;  2ICR A;  5KTG A;  5DQM A;  4KGE A;  3SVN A;  2V4E C;  1JC0 A;  3SVS A;  3P8U A;  3DQ9 A;  3DQJ A;  1QY3 A;  3LSA A;  4W7R A;  1ZGQ A;  4W6N A;  4AR7 A;  2A47 A;  1W7U A;  1OXF A;  2WUR A;  2G2S B;  3SG2 A;  2WHU A;  1QXT A;  4ZB1 A;  2OJK A;  4IK3 A;  4W6G A;  3RWT A;  4W6K A;  2WIQ A;  2G6E A;  2G16 B;  3DQ8 A;  4W75 A;  3SSK A;  5HBD A;  3SV5 A;  1RMM A;  3UG0 A;  4DXO A;  3DPZ A;  3BXB A;  1JBY A;  4IK5 A;  5H89 A;  4IK4 A;  3BX9 A;  4DXI A;  1S6Z A;  3U0N A;  2GX0 A;  3AI5 A;  2OTE A;  3DQ5 A;  4KEX A;  3U0K A;  2AHA A;  4IK1 A;  5LTP A;  2GW4 B;  4DXP A;  2IB5 A;  4PPL A;  1EMB A;  5DRF A;  4H3L A;  3IR8 A;  4XL5 A;  3SVO A;  4N3D A;  1KP5 A;  1W7S A;  2QRF A;  2HPW A;  3SVR A;  5BTT B;  2O2B A;  5BTT A;  3AKO A;  2A48 A;  4W6M A;  5DTL A;  2ZO6 A;  3TMT A;  4ZF4 A;  4W6F A;  4XVP A;  1HCJ A;  1MOV A;  4W74 A;  1EME A;  3U8A A;  1ZGP A;  3ST4 A;  2V4E B;  3E5T A;  3U8C A;  2V4E A;  3H1R A;  3KCT A;  3M22 A;  5LTR A;  2Q6P A;  5EXB A;  1EMM A;  4W77 A;  4Q9W A;  4KPI A;  4LQU A;  4OHS A;  5F9G A;  3GEX A;  1RM9 A;  4Q7U A;  3SSY A;  3CGL A;  1XMZ A;  3ZUJ A;  2Z6X A;  4W7E A;  4PPJ A;  2ARL A;  3SG5 A;  1XSS A;  1RRX A;  3SVD A;  5HW9 A;  2H9W A;  5AQB B;  4Z4M A;  4Q7R A;  4W6B A;  4W7D A;  3KCS A;  1XQM A;  2ZMU A;  3CFH A;  4L12 A;  3NEZ A;  4JC2 A;  4KF5 A;  3VHT A;  2C9J A;  3SG7 A;  3LS3 A;  2QLG B;  1Z1P A;  4HQ8 A;  2DUH A;  1EMA A;  1Q4B A;  3EK8 A;  4W6U A;  3EK4 A;  3LF3 A;  2ZMW A;  3I19 A;  1JC1 A;  4W69 A;  2QZ0 A;  5EBJ A;  2BTJ A;  2IE2 A;  2DDD A;  5DPH A;  5EHU A;  3SVE A;  5HZU A;  4W6L A;  1YJF A;  5LTQ A;  2Q57 A;  5J2O A;  1Q4E A;  3K1K A;  2O29 A;  4W6O A;  3U8P A;  3DQD A;  3U0M A;  1CV7 A;  4P1Q A;  4KGF A;  3ST3 A;  2EMO A;  5H87 A;  1EMC A;  3E5W A;  3EVU A;  5H88 A;  4W6C A;  3SVU A;  4HQ9 A;  3LA1 A;  3SSP A;  4R6D A;  2DUI A;  2Z6Y A;  3DQA A;  3EK7 A;  5DQB A;  4W6S A;  3G9A A;  2AH8 A;  2C9I A;  3ZUF A;  4DKN A;  1GGX A;  4JGE A;  4I2Y A;  1Q73 A;  5DTX A;  2OKW A;  4B30 B;  3CB9 A;  3E5V A;  3O77 A;  4W6D A;  3BXC A;  4OGS A;  4ORN A;  4W6H A;  5DRG A;  3S05 A;  5EXC I;  2PXW A;  4LJC A;  1EMK A;  2HQZ A;  4BDU A;  1Z1Q A;  3DQI A;  3GB3 A;  4J8A A;  2VVJ A;  4LQT A;  1XAE A;  3BXA A;  4PFE A;  4J88 A;  2B3P A;  3ST0 A;  3DQ6 A;  3AI4 A;  1ZGO A;  3W1D A;  3GJ2 A;  2Z1O A;  3O78 A;  4KW9 A;  3DQH A;  3SS0 A;  3DQ1 A;  1XA9 A;  1QYF A;  5FVI A;  2G3D B;  4KF4 A;  2HJO A;  2YE0 A;  3DQK A;  3SST A;  3SRY A;  2A52 B;  1YHG A;  3V3D A;  2FWQ A;  3DQO A;  3EVV A;  3VK1 A;  2DUF A;  2H5Q A;  2H5R A;  4R6B A;  4IK9 A;  1RMO A;  5HZO A;  5FHV A;  2IB6 A;  3ZUL A;  3PJ7 A; 
#chains in the Genus database with same CATH topology
 2HQK A;  1H4U A;  1MYW A;  1YJ2 A;  4NWS A;  4XOW A;  3OSQ A;  4JEO A;  4IK8 A;  4RYW A;  3ST2 A;  3CBE A;  3DPX A;  2VZX A;  4W7A A;  3RWA A;  2FZU A;  2HGD A;  3LVC A;  4Q7T A;  4W6I A;  1KYS A;  3EVR A;  3CFF A;  4L1I A;  3CD1 A;  4ZIN A;  1RMP A;  5HZT A;  3SVB A;  2VVI A;  4EDS A;  4W6T A;  4W7C A;  2WHS A;  2FL1 A;  4KAG A;  3WLC A;  4GOB A;  3SSH A;  5LK4 A;  2EMD A;  2B3Q A;  2EMN A;  2AWK A;  2DUG A;  2YFP A;  4W7F A;  4OJ0 A;  3SVC A;  2QLG A;  5BT0 A;  4HVF A;  3LVD A;  4H48 A;  4DKM A;  3NT3 A;  1Q4C A;  2IOV A;  4LJD C;  3DQU A;  3GL4 A;  3DQ2 A;  2P4M A;  3WLD A;  1F0B A;  2GW3 A;  3NF0 A;  3P28 A;  3U0L A;  4H3N A;  4DXQ A;  1UIS A;  2Y0G A;  5DY6 A;  4W7X A;  1KYR A;  3DQ7 A;  4JF9 A;  1GL4 A;  3SSV A;  2GX2 A;  4UTS A;  4B5Y A;  2VAE A;  4RTC A;  4P76 A;  3W1C A;  4W73 A;  2H5P A;  4HQC A;  2HFC A;  2AWM A;  3A8S A;  2QLE A;  4ZF5 A;  1EMF A;  5EB6 A;  1OXE A;  5HGE A;  2YDZ A;  3ADF A;  2OTB A;  3DQ3 A;  3DQL A;  4GES B;  4KA9 A;  4L13 A;  1W7T A;  4B30 A;  4Z4K A;  1MOU A;  4W72 A;  5EJU A;  2OGR A;  1C4F A;  4W6P A;  2VVH A;  3VIC A;  3OSR A;  4ANJ A;  1QYO A;  4EN1 A;  2WIS A;  4HE4 A;  2HCG A;  2VAD A;  4J89 A;  4W6R A;  2QT2 A;  4KW4 A;  5T3I A;  3LF4 B;  1G7K A;  4EDO A;  3DQE A;  1GFL A;  3SG6 A;  4H3M A;  4JRB A;  5DPJ A;  2A56 B;  2O24 A;  3NT9 A;  2G3O A;  5DPI A;  4JFG A;  4ZIO A;  3OGO A;  4EUL A;  5EB7 A;  3SSL A;  4KF5 C;  4LJD A;  3PIB A;  2G6Y A;  3IP2 A;  4W6J A;  1HUY A;  4H47 A;  3DPW A;  3CD9 A;  2DD7 A;  1EMG A;  4IZN A;  3DQM A;  3NED A;  3GJ1 A;  3EVP A;  4Q9X A;  4LJB A;  2DUE A;  3DQN A;  3SG4 A;  3TMR A;  3EKH A;  1JBZ A;  1YHH A;  4XOV A;  4W76 A;  1BFP A;  3DQC A;  3CFA A;  4ZBL A;  1QYQ A;  2A46 A;  3EKJ A;  1EML A;  4U2V A;  1OXD A;  5HZS A;  3ZTF A;  4GF6 B;  3SG3 A;  3DQ4 A;  4TZA A;  2Z6Z A;  5BQL A;  1ZUX A;  4KW8 A;  4XGY A;  2H8Q A;  2QLH A;  1Q4D A;  2A50 B;  3ED8 A;  4RYS A;  1YHI A;  2DD9 A;  4OY4 A;  5FVG A;  5DU0 A;  4PPK A;  2G5Z B;  1H6R A;  2WSN A;  4LW5 A;  2YE1 A;  2H5O A;  2RH7 A;  2QLI A;  5DTY A;  4DXN A;  3MGF A;  4ZF3 A;  4ZFS A;  3WCK A;  5DPG A;  3LVA A;  1B9C A;  2HRS A;  2A54 B;  2WSO A;  3H1O A;  2POX A;  2PXS A;  1KYP A;  1Q4A A;  1YZW A;  5FVF A;  4EMQ A;  2HGY A;  2JAD A;  4OQW A;  4AS8 A;  2H6V A;  1F09 A;  2OKY A;  2AWJ A;  3VHT B;  2G6X A;  1YFP A;  3PJ5 A;  3UFZ A;  3M24 A;  2WHT A;  2DDC A;  4TZG A;  2ZO7 A;  4W6A A;  3DQF A;  2A53 B;  5EXU A;  2AWL A;  3PJB A;  2QU1 A;  4DXM A;  5DTZ A;  2ICR A;  5KTG A;  5DQM A;  4KGE A;  3SVN A;  2V4E C;  1JC0 A;  3SVS A;  3P8U A;  3DQ9 A;  3DQJ A;  1QY3 A;  3LSA A;  4W7R A;  1ZGQ A;  4W6N A;  4AR7 A;  2A47 A;  1W7U A;  1OXF A;  2WUR A;  2G2S B;  3SG2 A;  2WHU A;  1QXT A;  4ZB1 A;  2OJK A;  4IK3 A;  4W6G A;  3RWT A;  4W6K A;  2WIQ A;  2G6E A;  2G16 B;  3DQ8 A;  4W75 A;  3SSK A;  5HBD A;  3SV5 A;  1RMM A;  3UG0 A;  4DXO A;  3DPZ A;  3BXB A;  1JBY A;  4IK5 A;  5H89 A;  4IK4 A;  3BX9 A;  4DXI A;  1S6Z A;  3U0N A;  2GX0 A;  3AI5 A;  2OTE A;  3DQ5 A;  4KEX A;  3U0K A;  2AHA A;  4IK1 A;  5LTP A;  2GW4 B;  4DXP A;  2IB5 A;  4PPL A;  1EMB A;  5DRF A;  4H3L A;  3IR8 A;  4XL5 A;  3SVO A;  4N3D A;  1KP5 A;  1W7S A;  2QRF A;  2HPW A;  3SVR A;  5BTT B;  2O2B A;  5BTT A;  3AKO A;  2A48 A;  4W6M A;  5DTL A;  2ZO6 A;  3TMT A;  4ZF4 A;  4W6F A;  4XVP A;  1HCJ A;  1MOV A;  4W74 A;  1EME A;  3U8A A;  1ZGP A;  3ST4 A;  2V4E B;  3E5T A;  3U8C A;  2V4E A;  3H1R A;  3KCT A;  3M22 A;  5LTR A;  2Q6P A;  5EXB A;  1EMM A;  4W77 A;  4Q9W A;  4KPI A;  4LQU A;  4OHS A;  5F9G A;  3GEX A;  1RM9 A;  4Q7U A;  3SSY A;  3CGL A;  1XMZ A;  3ZUJ A;  2Z6X A;  4W7E A;  4PPJ A;  2ARL A;  3SG5 A;  1XSS A;  1RRX A;  3SVD A;  5HW9 A;  2H9W A;  5AQB B;  4Z4M A;  4Q7R A;  4W6B A;  4W7D A;  3KCS A;  1XQM A;  2ZMU A;  3CFH A;  4L12 A;  3NEZ A;  4JC2 A;  4KF5 A;  3VHT A;  2C9J A;  3SG7 A;  3LS3 A;  2QLG B;  1Z1P A;  4HQ8 A;  2DUH A;  1EMA A;  1Q4B A;  3EK8 A;  4W6U A;  3EK4 A;  3LF3 A;  2ZMW A;  3I19 A;  1JC1 A;  4W69 A;  2QZ0 A;  5EBJ A;  2BTJ A;  2IE2 A;  2DDD A;  5DPH A;  5EHU A;  3SVE A;  5HZU A;  4W6L A;  1YJF A;  5LTQ A;  2Q57 A;  5J2O A;  1Q4E A;  3K1K A;  2O29 A;  4W6O A;  3U8P A;  3DQD A;  3U0M A;  1CV7 A;  4P1Q A;  4KGF A;  3ST3 A;  2EMO A;  5H87 A;  1EMC A;  3E5W A;  3EVU A;  5H88 A;  4W6C A;  3SVU A;  4HQ9 A;  3LA1 A;  3SSP A;  4R6D A;  2DUI A;  2Z6Y A;  3DQA A;  3EK7 A;  5DQB A;  4W6S A;  3G9A A;  2AH8 A;  2C9I A;  3ZUF A;  4DKN A;  1GGX A;  4JGE A;  4I2Y A;  1Q73 A;  5DTX A;  2OKW A;  4B30 B;  3CB9 A;  3E5V A;  3O77 A;  4W6D A;  3BXC A;  4OGS A;  4ORN A;  4W6H A;  5DRG A;  3S05 A;  5EXC I;  2PXW A;  4LJC A;  1EMK A;  2HQZ A;  4BDU A;  1Z1Q A;  3DQI A;  3GB3 A;  4J8A A;  2VVJ A;  4LQT A;  1XAE A;  3BXA A;  4PFE A;  4J88 A;  2B3P A;  3ST0 A;  3DQ6 A;  3AI4 A;  1ZGO A;  3W1D A;  3GJ2 A;  2Z1O A;  3O78 A;  4KW9 A;  3DQH A;  3SS0 A;  3DQ1 A;  1XA9 A;  1QYF A;  5FVI A;  2G3D B;  4KF4 A;  2HJO A;  2YE0 A;  3DQK A;  3SST A;  3SRY A;  2A52 B;  1YHG A;  3V3D A;  2FWQ A;  3DQO A;  3EVV A;  3VK1 A;  2DUF A;  2H5Q A;  2H5R A;  4R6B A;  4IK9 A;  1RMO A;  5HZO A;  5FHV A;  2IB6 A;  3ZUL A;  3PJ7 A; 
#chains in the Genus database with same CATH homology
 2HQK A;  1H4U A;  1MYW A;  1YJ2 A;  4NWS A;  4XOW A;  3OSQ A;  4JEO A;  4IK8 A;  4RYW A;  3ST2 A;  3CBE A;  3DPX A;  2VZX A;  4W7A A;  3RWA A;  2FZU A;  2HGD A;  3LVC A;  4Q7T A;  4W6I A;  1KYS A;  3EVR A;  3CFF A;  4L1I A;  3CD1 A;  4ZIN A;  1RMP A;  5HZT A;  3SVB A;  2VVI A;  4EDS A;  4W6T A;  4W7C A;  2WHS A;  2FL1 A;  4KAG A;  3WLC A;  4GOB A;  3SSH A;  5LK4 A;  2EMD A;  2B3Q A;  2EMN A;  2AWK A;  2DUG A;  2YFP A;  4W7F A;  4OJ0 A;  3SVC A;  2QLG A;  5BT0 A;  4HVF A;  3LVD A;  4H48 A;  4DKM A;  3NT3 A;  1Q4C A;  2IOV A;  4LJD C;  3DQU A;  3GL4 A;  3DQ2 A;  2P4M A;  3WLD A;  1F0B A;  2GW3 A;  3NF0 A;  3P28 A;  3U0L A;  4H3N A;  4DXQ A;  1UIS A;  2Y0G A;  5DY6 A;  4W7X A;  1KYR A;  3DQ7 A;  4JF9 A;  1GL4 A;  3SSV A;  2GX2 A;  4UTS A;  4B5Y A;  2VAE A;  4RTC A;  4P76 A;  3W1C A;  4W73 A;  2H5P A;  4HQC A;  2HFC A;  2AWM A;  3A8S A;  2QLE A;  4ZF5 A;  1EMF A;  5EB6 A;  1OXE A;  5HGE A;  2YDZ A;  3ADF A;  2OTB A;  3DQ3 A;  3DQL A;  4GES B;  4KA9 A;  4L13 A;  1W7T A;  4B30 A;  4Z4K A;  1MOU A;  4W72 A;  5EJU A;  2OGR A;  1C4F A;  4W6P A;  2VVH A;  3VIC A;  3OSR A;  4ANJ A;  1QYO A;  4EN1 A;  2WIS A;  4HE4 A;  2HCG A;  2VAD A;  4J89 A;  4W6R A;  2QT2 A;  4KW4 A;  5T3I A;  3LF4 B;  1G7K A;  4EDO A;  3DQE A;  1GFL A;  3SG6 A;  4H3M A;  4JRB A;  5DPJ A;  2A56 B;  2O24 A;  3NT9 A;  2G3O A;  5DPI A;  4JFG A;  4ZIO A;  3OGO A;  4EUL A;  5EB7 A;  3SSL A;  4KF5 C;  4LJD A;  3PIB A;  2G6Y A;  3IP2 A;  4W6J A;  1HUY A;  4H47 A;  3DPW A;  3CD9 A;  2DD7 A;  1EMG A;  4IZN A;  3DQM A;  3NED A;  3GJ1 A;  3EVP A;  4Q9X A;  4LJB A;  2DUE A;  3DQN A;  3SG4 A;  3TMR A;  3EKH A;  1JBZ A;  1YHH A;  4XOV A;  4W76 A;  1BFP A;  3DQC A;  3CFA A;  4ZBL A;  1QYQ A;  2A46 A;  3EKJ A;  1EML A;  4U2V A;  1OXD A;  5HZS A;  3ZTF A;  4GF6 B;  3SG3 A;  3DQ4 A;  4TZA A;  2Z6Z A;  5BQL A;  1ZUX A;  4KW8 A;  4XGY A;  2H8Q A;  2QLH A;  1Q4D A;  2A50 B;  3ED8 A;  4RYS A;  1YHI A;  2DD9 A;  4OY4 A;  5FVG A;  5DU0 A;  4PPK A;  2G5Z B;  1H6R A;  2WSN A;  4LW5 A;  2YE1 A;  2H5O A;  2RH7 A;  2QLI A;  5DTY A;  4DXN A;  3MGF A;  4ZF3 A;  4ZFS A;  3WCK A;  5DPG A;  3LVA A;  1B9C A;  2HRS A;  2A54 B;  2WSO A;  3H1O A;  2POX A;  2PXS A;  1KYP A;  1Q4A A;  1YZW A;  5FVF A;  4EMQ A;  2HGY A;  2JAD A;  4OQW A;  4AS8 A;  2H6V A;  1F09 A;  2OKY A;  2AWJ A;  3VHT B;  2G6X A;  1YFP A;  3PJ5 A;  3UFZ A;  3M24 A;  2WHT A;  2DDC A;  4TZG A;  2ZO7 A;  4W6A A;  3DQF A;  2A53 B;  5EXU A;  2AWL A;  3PJB A;  2QU1 A;  4DXM A;  5DTZ A;  2ICR A;  5KTG A;  5DQM A;  4KGE A;  3SVN A;  2V4E C;  1JC0 A;  3SVS A;  3P8U A;  3DQ9 A;  3DQJ A;  1QY3 A;  3LSA A;  4W7R A;  1ZGQ A;  4W6N A;  4AR7 A;  2A47 A;  1W7U A;  1OXF A;  2WUR A;  2G2S B;  3SG2 A;  2WHU A;  1QXT A;  4ZB1 A;  2OJK A;  4IK3 A;  4W6G A;  3RWT A;  4W6K A;  2WIQ A;  2G6E A;  2G16 B;  3DQ8 A;  4W75 A;  3SSK A;  5HBD A;  3SV5 A;  1RMM A;  3UG0 A;  4DXO A;  3DPZ A;  3BXB A;  1JBY A;  4IK5 A;  5H89 A;  4IK4 A;  3BX9 A;  4DXI A;  1S6Z A;  3U0N A;  2GX0 A;  3AI5 A;  2OTE A;  3DQ5 A;  4KEX A;  3U0K A;  2AHA A;  4IK1 A;  5LTP A;  2GW4 B;  4DXP A;  2IB5 A;  4PPL A;  1EMB A;  5DRF A;  4H3L A;  3IR8 A;  4XL5 A;  3SVO A;  4N3D A;  1KP5 A;  1W7S A;  2QRF A;  2HPW A;  3SVR A;  5BTT B;  2O2B A;  5BTT A;  3AKO A;  2A48 A;  4W6M A;  5DTL A;  2ZO6 A;  3TMT A;  4ZF4 A;  4W6F A;  4XVP A;  1HCJ A;  1MOV A;  4W74 A;  1EME A;  3U8A A;  1ZGP A;  3ST4 A;  2V4E B;  3E5T A;  3U8C A;  2V4E A;  3H1R A;  3KCT A;  3M22 A;  5LTR A;  2Q6P A;  5EXB A;  1EMM A;  4W77 A;  4Q9W A;  4KPI A;  4LQU A;  4OHS A;  5F9G A;  3GEX A;  1RM9 A;  4Q7U A;  3SSY A;  3CGL A;  1XMZ A;  3ZUJ A;  2Z6X A;  4W7E A;  4PPJ A;  2ARL A;  3SG5 A;  1XSS A;  1RRX A;  3SVD A;  5HW9 A;  2H9W A;  5AQB B;  4Z4M A;  4Q7R A;  4W6B A;  4W7D A;  3KCS A;  1XQM A;  2ZMU A;  3CFH A;  4L12 A;  3NEZ A;  4JC2 A;  4KF5 A;  3VHT A;  2C9J A;  3SG7 A;  3LS3 A;  2QLG B;  1Z1P A;  4HQ8 A;  2DUH A;  1EMA A;  1Q4B A;  3EK8 A;  4W6U A;  3EK4 A;  3LF3 A;  2ZMW A;  3I19 A;  1JC1 A;  4W69 A;  2QZ0 A;  5EBJ A;  2BTJ A;  2IE2 A;  2DDD A;  5DPH A;  5EHU A;  3SVE A;  5HZU A;  4W6L A;  1YJF A;  5LTQ A;  2Q57 A;  5J2O A;  1Q4E A;  3K1K A;  2O29 A;  4W6O A;  3U8P A;  3DQD A;  3U0M A;  1CV7 A;  4P1Q A;  4KGF A;  3ST3 A;  2EMO A;  5H87 A;  1EMC A;  3E5W A;  3EVU A;  5H88 A;  4W6C A;  3SVU A;  4HQ9 A;  3LA1 A;  3SSP A;  4R6D A;  2DUI A;  2Z6Y A;  3DQA A;  3EK7 A;  5DQB A;  4W6S A;  3G9A A;  2AH8 A;  2C9I A;  3ZUF A;  4DKN A;  1GGX A;  4JGE A;  4I2Y A;  1Q73 A;  5DTX A;  2OKW A;  4B30 B;  3CB9 A;  3E5V A;  3O77 A;  4W6D A;  3BXC A;  4OGS A;  4ORN A;  4W6H A;  5DRG A;  3S05 A;  5EXC I;  2PXW A;  4LJC A;  1EMK A;  2HQZ A;  4BDU A;  1Z1Q A;  3DQI A;  3GB3 A;  4J8A A;  2VVJ A;  4LQT A;  1XAE A;  3BXA A;  4PFE A;  4J88 A;  2B3P A;  3ST0 A;  3DQ6 A;  3AI4 A;  1ZGO A;  3W1D A;  3GJ2 A;  2Z1O A;  3O78 A;  4KW9 A;  3DQH A;  3SS0 A;  3DQ1 A;  1XA9 A;  1QYF A;  5FVI A;  2G3D B;  4KF4 A;  2HJO A;  2YE0 A;  3DQK A;  3SST A;  3SRY A;  2A52 B;  1YHG A;  3V3D A;  2FWQ A;  3DQO A;  3EVV A;  3VK1 A;  2DUF A;  2H5Q A;  2H5R A;  4R6B A;  4IK9 A;  1RMO A;  5HZO A;  5FHV A;  2IB6 A;  3ZUL A;  3PJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...