5HZSA

Crystal structure of dronpa-co2+
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
214
Chain Sequence
SVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorescent protein Dronpa
publication title Crystal structures of Dronpa complexed with quenchable metal ions provide insight into metal biosensor development
pubmed doi rcsb
source organism Echinophyllia sp. sc22
molecule tags Luminescent protein
total genus 59
structure length 214
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5hzsA00
1GL4A 3DQ2A 1OXDA 1Q4BA 1CV7A 2AWMA 2A52B 2ZO7A 3PJ7A 4DKNA 2DUEA 3DQMA 1HUYA 3K1KA 5DQMA 4AR7A 2HQZA 4TZGA 3EVRA 3AKOA 5H88A 4KW9A 4IK1A 4OJ0A 1XAEA 4DKMA 2DDDA 3DQ4A 3SVOA 3DQUA 4LJDA 1RMOA 4W6LA 3EKHA 2O2BA 3W1DA 1MYWA 1RMPA 3BX9A 3PJBA 4PPJA 4ZF3A 3U8PA 3KCSA 4HQ9A 3U0KA 1W7TA 2HQKA 4DXMA 4ZF5A 1HCJA 2V4EC 4KF5A 4W6DA 2A47A 5H89A 4LQUA 5BT0A 3H1RA 2HRSA 1XSSA 2QLIA 2PXWA 5HZTA 3S05A 4KAGA 3LF4B 5DPJA 2Q6PA 5EHUA 2HGDA 1GGXA 4GOBA 3EK7A 2OTEA 2B3QA 3GEXA 4HQ8A 3RWAA 5LTQA 4LJBA 4W7XA 2H5OA 3E5TA 3ZTFA 4XOVA 4ZF4A 1KYRA 4RYSA 2OJKA 2WHSA 2P4MA 3BXAA 2DUHA 2QLGB 4KF4A 2RH7A 1H6RA 2O29A 4W6JA 3SSPA 3NEDA 4KW4A 4W6SA 4OGSA 1EMGA 3GJ1A 4W6HA 4H47A 3LVDA 5EXBA 4Z4KA 4W6KA 1JC1A 2V4EB 2JADA 4W7AA 2C9IA 4JF9A 3ZULA 4W73A 3WLDA 4ZFSA 3SSKA 4J89A 2ZMUA 4H3LA 1XMZA 1G7KA 4Q7TA 2C9JA 3DQIA 4KPIA 4H48A 4OQWA 3ST0A 2YE1A 1H4UA 3DPXA 2QLGA 4JGEA 3W1CA 2VVJA 4W6NA 1JC0A 1BFPA 5DPIA 2WHTA 4W6FA 2VZXA 4Q7UA 4IK5A 4ZBLA 4KGEA 3DQ1A 3WCKA 3NEZA 4OY4A 2G16B 2G6XA 5EBJA 1EMCA 3WLCA 2FZUA 2IB5A 4XOWA 4XL5A 4LJCA 3E5WA 2DD9A 2POXA 4H3MA 5FVFA 4HQCA 3DQFA 3LVCA 1Q4DA 2DUFA 2G6EA 2HCGA 5LTPA 5HW9A 5EJUA 5T3IA 4L12A 3U0NA 3UFZA 2O24A 4J88A 3CB9A 2A53B 2QT2A 4NWSA 3DQ8A 3EVPA 1GFLA 4B5YA 3SVCA 2A50B 2BTJA 3VICA 4BDUA 2YE0A 2IOVA 5DTZA 4DXPA 5EXCI 3DPZA 2IE2A 2OKWA 2QRFA 1C4FA 1YHGA 3UG0A 4IK4A 3DQLA 1EMFA 3LSAA 4L13A 3O78A 2G6YA 2OKYA 1OXEA 3DQ5A 3DQCA 3LF3A 5BQLA 1EMAA 4W77A 2WSNA 4KGFA 1B9CA 3SSLA 2ZMWA 1EMBA 4N3DA 2OTBA 2GW3A 3P28A 1Z1QA 2WHUA 3DQHA 1YHHA 5EXUA 4Q9WA 2DUGA 2H5QA 4KF5C 4HE4A 3LS3A 5KTGA 3SVEA 1W7SA 4P76A 5EB6A 3LA1A 4DXOA 2H5PA 4DXIA 3SVDA 5DPHA 3PJ5A 4W6BA 3U0MA 2VADA 2WIQA 3CBEA 2VAEA 2GX2A 4JC2A 2A48A 2OGRA 2AWKA 4XGYA 1KYSA 4R6DA 1KP5A 3SS0A 2VVHA 5HZUA 2G2SB 3ZUFA 1EMLA 4LJDC 3SVUA 1RMMA 3DQNA 1QYFA 1Q4AA 3SG5A 3U8CA 4EN1A 2IB6A 2QZ0A 3ST2A 1YHIA 5DTYA 3RWTA 4ZIOA 2A54B 4UTSA 4EULA 2Z6XA 1EMKA 1QYOA 3SSTA 3DQ7A 1ZGOA 2Q57A 3GB3A 3SG7A 3I19A 2AWLA 2EMNA 4B30B 4PPLA 1Q4CA 2HFCA 4I2YA 3P8UA 2H8QA 4KW8A 3U0LA 4W6UA 3EKJA 3DQ3A 1QYQA 4R6BA 3H1OA 2EMDA 4W6IA 5DPGA 2V4EA 2Z6YA 1YZWA 3M24A 3ST4A 5DRGA 4IZNA 4KA9A 3DQJA 3SVNA 1YFPA 3CD1A 3A8SA 3DQKA 4W6CA 4W7EA 1XA9A 1F0BA 5DTLA 3OSRA 3EK8A 4W74A 3SVBA 5HBDA 4PPKA 3EK4A 3M22A 3IP2A 1JBZA 4U2VA 4EDSA 3DQ9A 3NT9A 4RYWA 4L1IA 2G3OA 3GL4A 3U8AA 1F09A 1ZGPA 2Z6ZA 4OHSA 2HJOA 3GJ2A 3SSHA 5DRFA 2QLEA 2AH8A 3AI4A 4RTCA 4Z4MA 2WURA 4H3NA 4W7FA 3PIBA 4ZB1A 4J8AA 3CD9A 4DXQA 3CFHA 4IK3A 3ED8A 2AWJA 2EMOA 2H6VA 3BXBA 3CFFA 4AS8A 5LK4A 4XVPA 3G9AA 2YDZA 3EVVA 2Y0GA 3DQAA 4HVFA 3VK1A 2WSOA 3LVAA 3DPWA 4W75A 2FWQA 1EMEA 2DUIA 2QU1A 1ZUXA 2HPWA 4Q7RA 3VHTB 5BTTB 5LTRA 1ZGQA 4W6PA 2G3DB 3SG4A 1XQMA 4W72A 4W6RA 4W6TA 3ZUJA 4Q9XA 2G5ZB 4PFEA 5FVIA 4P1QA 4IK8A 5AQBB 1W7UA 3CGLA 3IR8A 2Z1OA 2GW4B 1MOVA 4JEOA 2A46A 2ZO6A 4ZINA 3NT3A 5HZSA 2AHAA 2HGYA 1Q73A 5HZOA 5FVGA 2WISA 1S6ZA 2H5RA 1UISA 3SV5A 3SRYA 1YJ2A 5DU0A 1YJFA 1QY3A 5H87A 2H9WA 3OGOA 2ICRA 4ORNA 4EDOA 4W7DA 4TZAA 4W6AA 3DQOA 3VHTA 5BTTA 5DQBA 2YFPA 3SSVA 4JRBA 1MOUA 2B3PA 4JFGA 4LQTA 3TMRA 4GESB 4ANJA 1Q4EA 3AI5A 3KCTA 4EMQA 5J2OA 4IK9A 1JBYA 3NF0A 5HGEA 3MGFA 4GF6B 3DQDA 4LW5A 4W6OA 5EB7A 3DQ6A 1RM9A 2GX0A 4W6MA 1QXTA 2ARLA 2DDCA 1RRXA 4W7CA 3BXCA 4W69A 4DXNA 3O77A 1OXFA 3SSYA 3SG6A 3ST3A 5FHVA 3E5VA 5F9GA 3V3DA 2FL1A 3OSQA 2PXSA 3ADFA 2A56B 3TMTA 3SVSA 3SG3A 2DD7A 4KEXA 3EVUA 3DQEA 3SVRA 2VVIA 4B30A 5DTXA 1Z1PA 4W6GA 5DY6A 3SG2A 4W76A 3CFAA 4W7RA 2QLHA 1EMMA 1KYPA
chains in the Genus database with same CATH superfamily
1GL4A 3DQ2A 1OXDA 1Q4BA 1CV7A 2AWMA 2A52B 2ZO7A 3PJ7A 4DKNA 2DUEA 3DQMA 1HUYA 3K1KA 5DQMA 4AR7A 2HQZA 4TZGA 3EVRA 3AKOA 5H88A 4KW9A 4IK1A 4OJ0A 1XAEA 4DKMA 2DDDA 3DQ4A 3SVOA 3DQUA 4LJDA 1RMOA 4W6LA 3EKHA 2O2BA 3W1DA 1MYWA 1RMPA 3BX9A 3PJBA 4PPJA 4ZF3A 3U8PA 3KCSA 4HQ9A 3U0KA 1W7TA 2HQKA 4DXMA 4ZF5A 1HCJA 2V4EC 4KF5A 4W6DA 2A47A 5H89A 4LQUA 5BT0A 3H1RA 2HRSA 1XSSA 2QLIA 2PXWA 5HZTA 3S05A 4KAGA 3LF4B 5DPJA 2Q6PA 5EHUA 2HGDA 1GGXA 4GOBA 3EK7A 2OTEA 2B3QA 3GEXA 4HQ8A 3RWAA 5LTQA 4LJBA 4W7XA 2H5OA 3E5TA 3ZTFA 4XOVA 4ZF4A 1KYRA 4RYSA 2OJKA 2WHSA 2P4MA 3BXAA 2DUHA 2QLGB 4KF4A 2RH7A 1H6RA 2O29A 4W6JA 3SSPA 3NEDA 4KW4A 4W6SA 4OGSA 1EMGA 3GJ1A 4W6HA 4H47A 3LVDA 5EXBA 4Z4KA 4W6KA 1JC1A 2V4EB 2JADA 4W7AA 2C9IA 4JF9A 3ZULA 4W73A 3WLDA 4ZFSA 3SSKA 4J89A 2ZMUA 4H3LA 1XMZA 1G7KA 4Q7TA 2C9JA 3DQIA 4KPIA 4H48A 4OQWA 3ST0A 2YE1A 1H4UA 3DPXA 2QLGA 4JGEA 3W1CA 2VVJA 4W6NA 1JC0A 1BFPA 5DPIA 2WHTA 4W6FA 2VZXA 4Q7UA 4IK5A 4ZBLA 4KGEA 3DQ1A 3WCKA 3NEZA 4OY4A 2G16B 2G6XA 5EBJA 1EMCA 3WLCA 2FZUA 2IB5A 4XOWA 4XL5A 4LJCA 3E5WA 2DD9A 2POXA 4H3MA 5FVFA 4HQCA 3DQFA 3LVCA 1Q4DA 2DUFA 2G6EA 2HCGA 5LTPA 5HW9A 5EJUA 5T3IA 4L12A 3U0NA 3UFZA 2O24A 4J88A 3CB9A 2A53B 2QT2A 4NWSA 3DQ8A 3EVPA 1GFLA 4B5YA 3SVCA 2A50B 2BTJA 3VICA 4BDUA 2YE0A 2IOVA 5DTZA 4DXPA 5EXCI 3DPZA 2IE2A 2OKWA 2QRFA 1C4FA 1YHGA 3UG0A 4IK4A 3DQLA 1EMFA 3LSAA 4L13A 3O78A 2G6YA 2OKYA 1OXEA 3DQ5A 3DQCA 3LF3A 5BQLA 1EMAA 4W77A 2WSNA 4KGFA 1B9CA 3SSLA 2ZMWA 1EMBA 4N3DA 2OTBA 2GW3A 3P28A 1Z1QA 2WHUA 3DQHA 1YHHA 5EXUA 4Q9WA 2DUGA 2H5QA 4KF5C 4HE4A 3LS3A 5KTGA 3SVEA 1W7SA 4P76A 5EB6A 3LA1A 4DXOA 2H5PA 4DXIA 3SVDA 5DPHA 3PJ5A 4W6BA 3U0MA 2VADA 2WIQA 3CBEA 2VAEA 2GX2A 4JC2A 2A48A 2OGRA 2AWKA 4XGYA 1KYSA 4R6DA 1KP5A 3SS0A 2VVHA 5HZUA 2G2SB 3ZUFA 1EMLA 4LJDC 3SVUA 1RMMA 3DQNA 1QYFA 1Q4AA 3SG5A 3U8CA 4EN1A 2IB6A 2QZ0A 3ST2A 1YHIA 5DTYA 3RWTA 4ZIOA 2A54B 4UTSA 4EULA 2Z6XA 1EMKA 1QYOA 3SSTA 3DQ7A 1ZGOA 2Q57A 3GB3A 3SG7A 3I19A 2AWLA 2EMNA 4B30B 4PPLA 1Q4CA 2HFCA 4I2YA 3P8UA 2H8QA 4KW8A 3U0LA 4W6UA 3EKJA 3DQ3A 1QYQA 4R6BA 3H1OA 2EMDA 4W6IA 5DPGA 2V4EA 2Z6YA 1YZWA 3M24A 3ST4A 5DRGA 4IZNA 4KA9A 3DQJA 3SVNA 1YFPA 3CD1A 3A8SA 3DQKA 4W6CA 4W7EA 1XA9A 1F0BA 5DTLA 3OSRA 3EK8A 4W74A 3SVBA 5HBDA 4PPKA 3EK4A 3M22A 3IP2A 1JBZA 4U2VA 4EDSA 3DQ9A 3NT9A 4RYWA 4L1IA 2G3OA 3GL4A 3U8AA 1F09A 1ZGPA 2Z6ZA 4OHSA 2HJOA 3GJ2A 3SSHA 5DRFA 2QLEA 2AH8A 3AI4A 4RTCA 4Z4MA 2WURA 4H3NA 4W7FA 3PIBA 4ZB1A 4J8AA 3CD9A 4DXQA 3CFHA 4IK3A 3ED8A 2AWJA 2EMOA 2H6VA 3BXBA 3CFFA 4AS8A 5LK4A 4XVPA 3G9AA 2YDZA 3EVVA 2Y0GA 3DQAA 4HVFA 3VK1A 2WSOA 3LVAA 3DPWA 4W75A 2FWQA 1EMEA 2DUIA 2QU1A 1ZUXA 2HPWA 4Q7RA 3VHTB 5BTTB 5LTRA 1ZGQA 4W6PA 2G3DB 3SG4A 1XQMA 4W72A 4W6RA 4W6TA 3ZUJA 4Q9XA 2G5ZB 4PFEA 5FVIA 4P1QA 4IK8A 5AQBB 1W7UA 3CGLA 3IR8A 2Z1OA 2GW4B 1MOVA 4JEOA 2A46A 2ZO6A 4ZINA 3NT3A 5HZSA 2AHAA 2HGYA 1Q73A 5HZOA 5FVGA 2WISA 1S6ZA 2H5RA 1UISA 3SV5A 3SRYA 1YJ2A 5DU0A 1YJFA 1QY3A 5H87A 2H9WA 3OGOA 2ICRA 4ORNA 4EDOA 4W7DA 4TZAA 4W6AA 3DQOA 3VHTA 5BTTA 5DQBA 2YFPA 3SSVA 4JRBA 1MOUA 2B3PA 4JFGA 4LQTA 3TMRA 4GESB 4ANJA 1Q4EA 3AI5A 3KCTA 4EMQA 5J2OA 4IK9A 1JBYA 3NF0A 5HGEA 3MGFA 4GF6B 3DQDA 4LW5A 4W6OA 5EB7A 3DQ6A 1RM9A 2GX0A 4W6MA 1QXTA 2ARLA 2DDCA 1RRXA 4W7CA 3BXCA 4W69A 4DXNA 3O77A 1OXFA 3SSYA 3SG6A 3ST3A 5FHVA 3E5VA 5F9GA 3V3DA 2FL1A 3OSQA 2PXSA 3ADFA 2A56B 3TMTA 3SVSA 3SG3A 2DD7A 4KEXA 3EVUA 3DQEA 3SVRA 2VVIA 4B30A 5DTXA 1Z1PA 4W6GA 5DY6A 3SG2A 4W76A 3CFAA 4W7RA 2QLHA 1EMMA 1KYPA
chains in the Genus database with same CATH topology
1GL4A 3DQ2A 1OXDA 1Q4BA 1CV7A 2AWMA 2A52B 2ZO7A 3PJ7A 4DKNA 2DUEA 3DQMA 1HUYA 3K1KA 5DQMA 4AR7A 2HQZA 4TZGA 3EVRA 3AKOA 5H88A 4KW9A 4IK1A 4OJ0A 1XAEA 4DKMA 2DDDA 3DQ4A 3SVOA 3DQUA 4LJDA 1RMOA 4W6LA 3EKHA 2O2BA 3W1DA 1MYWA 1RMPA 3BX9A 3PJBA 4PPJA 4ZF3A 3U8PA 3KCSA 4HQ9A 3U0KA 1W7TA 2HQKA 4DXMA 4ZF5A 1HCJA 2V4EC 4KF5A 4W6DA 2A47A 5H89A 4LQUA 5BT0A 3H1RA 2HRSA 1XSSA 2QLIA 2PXWA 5HZTA 3S05A 4KAGA 3LF4B 5DPJA 2Q6PA 5EHUA 2HGDA 1GGXA 4GOBA 3EK7A 2OTEA 2B3QA 3GEXA 4HQ8A 3RWAA 5LTQA 4LJBA 4W7XA 2H5OA 3E5TA 3ZTFA 4XOVA 4ZF4A 1KYRA 4RYSA 2OJKA 2WHSA 2P4MA 3BXAA 2DUHA 2QLGB 4KF4A 2RH7A 1H6RA 2O29A 4W6JA 3SSPA 3NEDA 4KW4A 4W6SA 4OGSA 1EMGA 3GJ1A 4W6HA 4H47A 3LVDA 5EXBA 4Z4KA 4W6KA 1JC1A 2V4EB 2JADA 4W7AA 2C9IA 4JF9A 3ZULA 4W73A 3WLDA 4ZFSA 3SSKA 4J89A 2ZMUA 4H3LA 1XMZA 1G7KA 4Q7TA 2C9JA 3DQIA 4KPIA 4H48A 4OQWA 3ST0A 2YE1A 1H4UA 3DPXA 2QLGA 4JGEA 3W1CA 2VVJA 4W6NA 1JC0A 1BFPA 5DPIA 2WHTA 4W6FA 2VZXA 4Q7UA 4IK5A 4ZBLA 4KGEA 3DQ1A 3WCKA 3NEZA 4OY4A 2G16B 2G6XA 5EBJA 1EMCA 3WLCA 2FZUA 2IB5A 4XOWA 4XL5A 4LJCA 3E5WA 2DD9A 2POXA 4H3MA 5FVFA 4HQCA 3DQFA 3LVCA 1Q4DA 2DUFA 2G6EA 2HCGA 5LTPA 5HW9A 5EJUA 5T3IA 4L12A 3U0NA 3UFZA 2O24A 4J88A 3CB9A 2A53B 2QT2A 4NWSA 3DQ8A 3EVPA 1GFLA 4B5YA 3SVCA 2A50B 2BTJA 3VICA 4BDUA 2YE0A 2IOVA 5DTZA 4DXPA 5EXCI 3DPZA 2IE2A 2OKWA 2QRFA 1C4FA 1YHGA 3UG0A 4IK4A 3DQLA 1EMFA 3LSAA 4L13A 3O78A 2G6YA 2OKYA 1OXEA 3DQ5A 3DQCA 3LF3A 5BQLA 1EMAA 4W77A 2WSNA 4KGFA 1B9CA 3SSLA 2ZMWA 1EMBA 4N3DA 2OTBA 2GW3A 3P28A 1Z1QA 2WHUA 3DQHA 1YHHA 5EXUA 4Q9WA 2DUGA 2H5QA 4KF5C 4HE4A 3LS3A 5KTGA 3SVEA 1W7SA 4P76A 5EB6A 3LA1A 4DXOA 2H5PA 4DXIA 3SVDA 5DPHA 3PJ5A 4W6BA 3U0MA 2VADA 2WIQA 3CBEA 2VAEA 2GX2A 4JC2A 2A48A 2OGRA 2AWKA 4XGYA 1KYSA 4R6DA 1KP5A 3SS0A 2VVHA 5HZUA 2G2SB 3ZUFA 1EMLA 4LJDC 3SVUA 1RMMA 3DQNA 1QYFA 1Q4AA 3SG5A 3U8CA 4EN1A 2IB6A 2QZ0A 3ST2A 1YHIA 5DTYA 3RWTA 4ZIOA 2A54B 4UTSA 4EULA 2Z6XA 1EMKA 1QYOA 3SSTA 3DQ7A 1ZGOA 2Q57A 3GB3A 3SG7A 3I19A 2AWLA 2EMNA 4B30B 4PPLA 1Q4CA 2HFCA 4I2YA 3P8UA 2H8QA 4KW8A 3U0LA 4W6UA 3EKJA 3DQ3A 1QYQA 4R6BA 3H1OA 2EMDA 4W6IA 5DPGA 2V4EA 2Z6YA 1YZWA 3M24A 3ST4A 5DRGA 4IZNA 4KA9A 3DQJA 3SVNA 1YFPA 3CD1A 3A8SA 3DQKA 4W6CA 4W7EA 1XA9A 1F0BA 5DTLA 3OSRA 3EK8A 4W74A 3SVBA 5HBDA 4PPKA 3EK4A 3M22A 3IP2A 1JBZA 4U2VA 4EDSA 3DQ9A 3NT9A 4RYWA 4L1IA 2G3OA 3GL4A 3U8AA 1F09A 1ZGPA 2Z6ZA 4OHSA 2HJOA 3GJ2A 3SSHA 5DRFA 2QLEA 2AH8A 3AI4A 4RTCA 4Z4MA 2WURA 4H3NA 4W7FA 3PIBA 4ZB1A 4J8AA 3CD9A 4DXQA 3CFHA 4IK3A 3ED8A 2AWJA 2EMOA 2H6VA 3BXBA 3CFFA 4AS8A 5LK4A 4XVPA 3G9AA 2YDZA 3EVVA 2Y0GA 3DQAA 4HVFA 3VK1A 2WSOA 3LVAA 3DPWA 4W75A 2FWQA 1EMEA 2DUIA 2QU1A 1ZUXA 2HPWA 4Q7RA 3VHTB 5BTTB 5LTRA 1ZGQA 4W6PA 2G3DB 3SG4A 1XQMA 4W72A 4W6RA 4W6TA 3ZUJA 4Q9XA 2G5ZB 4PFEA 5FVIA 4P1QA 4IK8A 5AQBB 1W7UA 3CGLA 3IR8A 2Z1OA 2GW4B 1MOVA 4JEOA 2A46A 2ZO6A 4ZINA 3NT3A 5HZSA 2AHAA 2HGYA 1Q73A 5HZOA 5FVGA 2WISA 1S6ZA 2H5RA 1UISA 3SV5A 3SRYA 1YJ2A 5DU0A 1YJFA 1QY3A 5H87A 2H9WA 3OGOA 2ICRA 4ORNA 4EDOA 4W7DA 4TZAA 4W6AA 3DQOA 3VHTA 5BTTA 5DQBA 2YFPA 3SSVA 4JRBA 1MOUA 2B3PA 4JFGA 4LQTA 3TMRA 4GESB 4ANJA 1Q4EA 3AI5A 3KCTA 4EMQA 5J2OA 4IK9A 1JBYA 3NF0A 5HGEA 3MGFA 4GF6B 3DQDA 4LW5A 4W6OA 5EB7A 3DQ6A 1RM9A 2GX0A 4W6MA 1QXTA 2ARLA 2DDCA 1RRXA 4W7CA 3BXCA 4W69A 4DXNA 3O77A 1OXFA 3SSYA 3SG6A 3ST3A 5FHVA 3E5VA 5F9GA 3V3DA 2FL1A 3OSQA 2PXSA 3ADFA 2A56B 3TMTA 3SVSA 3SG3A 2DD7A 4KEXA 3EVUA 3DQEA 3SVRA 2VVIA 4B30A 5DTXA 1Z1PA 4W6GA 5DY6A 3SG2A 4W76A 3CFAA 4W7RA 2QLHA 1EMMA 1KYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL4 A;  3DQ2 A;  1OXD A;  1Q4B A;  1CV7 A;  2AWM A;  2A52 B;  2ZO7 A;  3PJ7 A;  4DKN A;  2DUE A;  3DQM A;  1HUY A;  3K1K A;  5DQM A;  4AR7 A;  2HQZ A;  4TZG A;  3EVR A;  3AKO A;  5H88 A;  4KW9 A;  4IK1 A;  4OJ0 A;  1XAE A;  4DKM A;  2DDD A;  3DQ4 A;  3SVO A;  3DQU A;  4LJD A;  1RMO A;  4W6L A;  3EKH A;  2O2B A;  3W1D A;  1MYW A;  1RMP A;  3BX9 A;  3PJB A;  4PPJ A;  4ZF3 A;  3U8P A;  3KCS A;  4HQ9 A;  3U0K A;  1W7T A;  2HQK A;  4DXM A;  4ZF5 A;  1HCJ A;  2V4E C;  4KF5 A;  4W6D A;  2A47 A;  5H89 A;  4LQU A;  5BT0 A;  3H1R A;  2HRS A;  1XSS A;  2QLI A;  2PXW A;  5HZT A;  3S05 A;  4KAG A;  3LF4 B;  5DPJ A;  2Q6P A;  5EHU A;  2HGD A;  1GGX A;  4GOB A;  3EK7 A;  2OTE A;  2B3Q A;  3GEX A;  4HQ8 A;  3RWA A;  5LTQ A;  4LJB A;  4W7X A;  2H5O A;  3E5T A;  3ZTF A;  4XOV A;  4ZF4 A;  1KYR A;  4RYS A;  2OJK A;  2WHS A;  2P4M A;  3BXA A;  2DUH A;  2QLG B;  4KF4 A;  2RH7 A;  1H6R A;  2O29 A;  4W6J A;  3SSP A;  3NED A;  4KW4 A;  4W6S A;  4OGS A;  1EMG A;  3GJ1 A;  4W6H A;  4H47 A;  3LVD A;  5EXB A;  4Z4K A;  4W6K A;  1JC1 A;  2V4E B;  2JAD A;  4W7A A;  2C9I A;  4JF9 A;  3ZUL A;  4W73 A;  3WLD A;  4ZFS A;  3SSK A;  4J89 A;  2ZMU A;  4H3L A;  1XMZ A;  1G7K A;  4Q7T A;  2C9J A;  3DQI A;  4KPI A;  4H48 A;  4OQW A;  3ST0 A;  2YE1 A;  1H4U A;  3DPX A;  2QLG A;  4JGE A;  3W1C A;  2VVJ A;  4W6N A;  1JC0 A;  1BFP A;  5DPI A;  2WHT A;  4W6F A;  2VZX A;  4Q7U A;  4IK5 A;  4ZBL A;  4KGE A;  3DQ1 A;  3WCK A;  3NEZ A;  4OY4 A;  2G16 B;  2G6X A;  5EBJ A;  1EMC A;  3WLC A;  2FZU A;  2IB5 A;  4XOW A;  4XL5 A;  4LJC A;  3E5W A;  2DD9 A;  2POX A;  4H3M A;  5FVF A;  4HQC A;  3DQF A;  3LVC A;  1Q4D A;  2DUF A;  2G6E A;  2HCG A;  5LTP A;  5HW9 A;  5EJU A;  5T3I A;  4L12 A;  3U0N A;  3UFZ A;  2O24 A;  4J88 A;  3CB9 A;  2A53 B;  2QT2 A;  4NWS A;  3DQ8 A;  3EVP A;  1GFL A;  4B5Y A;  3SVC A;  2A50 B;  2BTJ A;  3VIC A;  4BDU A;  2YE0 A;  2IOV A;  5DTZ A;  4DXP A;  5EXC I;  3DPZ A;  2IE2 A;  2OKW A;  2QRF A;  1C4F A;  1YHG A;  3UG0 A;  4IK4 A;  3DQL A;  1EMF A;  3LSA A;  4L13 A;  3O78 A;  2G6Y A;  2OKY A;  1OXE A;  3DQ5 A;  3DQC A;  3LF3 A;  5BQL A;  1EMA A;  4W77 A;  2WSN A;  4KGF A;  1B9C A;  3SSL A;  2ZMW A;  1EMB A;  4N3D A;  2OTB A;  2GW3 A;  3P28 A;  1Z1Q A;  2WHU A;  3DQH A;  1YHH A;  5EXU A;  4Q9W A;  2DUG A;  2H5Q A;  4KF5 C;  4HE4 A;  3LS3 A;  5KTG A;  3SVE A;  1W7S A;  4P76 A;  5EB6 A;  3LA1 A;  4DXO A;  2H5P A;  4DXI A;  3SVD A;  5DPH A;  3PJ5 A;  4W6B A;  3U0M A;  2VAD A;  2WIQ A;  3CBE A;  2VAE A;  2GX2 A;  4JC2 A;  2A48 A;  2OGR A;  2AWK A;  4XGY A;  1KYS A;  4R6D A;  1KP5 A;  3SS0 A;  2VVH A;  5HZU A;  2G2S B;  3ZUF A;  1EML A;  4LJD C;  3SVU A;  1RMM A;  3DQN A;  1QYF A;  1Q4A A;  3SG5 A;  3U8C A;  4EN1 A;  2IB6 A;  2QZ0 A;  3ST2 A;  1YHI A;  5DTY A;  3RWT A;  4ZIO A;  2A54 B;  4UTS A;  4EUL A;  2Z6X A;  1EMK A;  1QYO A;  3SST A;  3DQ7 A;  1ZGO A;  2Q57 A;  3GB3 A;  3SG7 A;  3I19 A;  2AWL A;  2EMN A;  4B30 B;  4PPL A;  1Q4C A;  2HFC A;  4I2Y A;  3P8U A;  2H8Q A;  4KW8 A;  3U0L A;  4W6U A;  3EKJ A;  3DQ3 A;  1QYQ A;  4R6B A;  3H1O A;  2EMD A;  4W6I A;  5DPG A;  2V4E A;  2Z6Y A;  1YZW A;  3M24 A;  3ST4 A;  5DRG A;  4IZN A;  4KA9 A;  3DQJ A;  3SVN A;  1YFP A;  3CD1 A;  3A8S A;  3DQK A;  4W6C A;  4W7E A;  1XA9 A;  1F0B A;  5DTL A;  3OSR A;  3EK8 A;  4W74 A;  3SVB A;  5HBD A;  4PPK A;  3EK4 A;  3M22 A;  3IP2 A;  1JBZ A;  4U2V A;  4EDS A;  3DQ9 A;  3NT9 A;  4RYW A;  4L1I A;  2G3O A;  3GL4 A;  3U8A A;  1F09 A;  1ZGP A;  2Z6Z A;  4OHS A;  2HJO A;  3GJ2 A;  3SSH A;  5DRF A;  2QLE A;  2AH8 A;  3AI4 A;  4RTC A;  4Z4M A;  2WUR A;  4H3N A;  4W7F A;  3PIB A;  4ZB1 A;  4J8A A;  3CD9 A;  4DXQ A;  3CFH A;  4IK3 A;  3ED8 A;  2AWJ A;  2EMO A;  2H6V A;  3BXB A;  3CFF A;  4AS8 A;  5LK4 A;  4XVP A;  3G9A A;  2YDZ A;  3EVV A;  2Y0G A;  3DQA A;  4HVF A;  3VK1 A;  2WSO A;  3LVA A;  3DPW A;  4W75 A;  2FWQ A;  1EME A;  2DUI A;  2QU1 A;  1ZUX A;  2HPW A;  4Q7R A;  3VHT B;  5BTT B;  5LTR A;  1ZGQ A;  4W6P A;  2G3D B;  3SG4 A;  1XQM A;  4W72 A;  4W6R A;  4W6T A;  3ZUJ A;  4Q9X A;  2G5Z B;  4PFE A;  5FVI A;  4P1Q A;  4IK8 A;  5AQB B;  1W7U A;  3CGL A;  3IR8 A;  2Z1O A;  2GW4 B;  1MOV A;  4JEO A;  2A46 A;  2ZO6 A;  4ZIN A;  3NT3 A;  5HZS A;  2AHA A;  2HGY A;  1Q73 A;  5HZO A;  5FVG A;  2WIS A;  1S6Z A;  2H5R A;  1UIS A;  3SV5 A;  3SRY A;  1YJ2 A;  5DU0 A;  1YJF A;  1QY3 A;  5H87 A;  2H9W A;  3OGO A;  2ICR A;  4ORN A;  4EDO A;  4W7D A;  4TZA A;  4W6A A;  3DQO A;  3VHT A;  5BTT A;  5DQB A;  2YFP A;  3SSV A;  4JRB A;  1MOU A;  2B3P A;  4JFG A;  4LQT A;  3TMR A;  4GES B;  4ANJ A;  1Q4E A;  3AI5 A;  3KCT A;  4EMQ A;  5J2O A;  4IK9 A;  1JBY A;  3NF0 A;  5HGE A;  3MGF A;  4GF6 B;  3DQD A;  4LW5 A;  4W6O A;  5EB7 A;  3DQ6 A;  1RM9 A;  2GX0 A;  4W6M A;  1QXT A;  2ARL A;  2DDC A;  1RRX A;  4W7C A;  3BXC A;  4W69 A;  4DXN A;  3O77 A;  1OXF A;  3SSY A;  3SG6 A;  3ST3 A;  5FHV A;  3E5V A;  5F9G A;  3V3D A;  2FL1 A;  3OSQ A;  2PXS A;  3ADF A;  2A56 B;  3TMT A;  3SVS A;  3SG3 A;  2DD7 A;  4KEX A;  3EVU A;  3DQE A;  3SVR A;  2VVI A;  4B30 A;  5DTX A;  1Z1P A;  4W6G A;  5DY6 A;  3SG2 A;  4W76 A;  3CFA A;  4W7R A;  2QLH A;  1EMM A;  1KYP A; 
#chains in the Genus database with same CATH topology
 1GL4 A;  3DQ2 A;  1OXD A;  1Q4B A;  1CV7 A;  2AWM A;  2A52 B;  2ZO7 A;  3PJ7 A;  4DKN A;  2DUE A;  3DQM A;  1HUY A;  3K1K A;  5DQM A;  4AR7 A;  2HQZ A;  4TZG A;  3EVR A;  3AKO A;  5H88 A;  4KW9 A;  4IK1 A;  4OJ0 A;  1XAE A;  4DKM A;  2DDD A;  3DQ4 A;  3SVO A;  3DQU A;  4LJD A;  1RMO A;  4W6L A;  3EKH A;  2O2B A;  3W1D A;  1MYW A;  1RMP A;  3BX9 A;  3PJB A;  4PPJ A;  4ZF3 A;  3U8P A;  3KCS A;  4HQ9 A;  3U0K A;  1W7T A;  2HQK A;  4DXM A;  4ZF5 A;  1HCJ A;  2V4E C;  4KF5 A;  4W6D A;  2A47 A;  5H89 A;  4LQU A;  5BT0 A;  3H1R A;  2HRS A;  1XSS A;  2QLI A;  2PXW A;  5HZT A;  3S05 A;  4KAG A;  3LF4 B;  5DPJ A;  2Q6P A;  5EHU A;  2HGD A;  1GGX A;  4GOB A;  3EK7 A;  2OTE A;  2B3Q A;  3GEX A;  4HQ8 A;  3RWA A;  5LTQ A;  4LJB A;  4W7X A;  2H5O A;  3E5T A;  3ZTF A;  4XOV A;  4ZF4 A;  1KYR A;  4RYS A;  2OJK A;  2WHS A;  2P4M A;  3BXA A;  2DUH A;  2QLG B;  4KF4 A;  2RH7 A;  1H6R A;  2O29 A;  4W6J A;  3SSP A;  3NED A;  4KW4 A;  4W6S A;  4OGS A;  1EMG A;  3GJ1 A;  4W6H A;  4H47 A;  3LVD A;  5EXB A;  4Z4K A;  4W6K A;  1JC1 A;  2V4E B;  2JAD A;  4W7A A;  2C9I A;  4JF9 A;  3ZUL A;  4W73 A;  3WLD A;  4ZFS A;  3SSK A;  4J89 A;  2ZMU A;  4H3L A;  1XMZ A;  1G7K A;  4Q7T A;  2C9J A;  3DQI A;  4KPI A;  4H48 A;  4OQW A;  3ST0 A;  2YE1 A;  1H4U A;  3DPX A;  2QLG A;  4JGE A;  3W1C A;  2VVJ A;  4W6N A;  1JC0 A;  1BFP A;  5DPI A;  2WHT A;  4W6F A;  2VZX A;  4Q7U A;  4IK5 A;  4ZBL A;  4KGE A;  3DQ1 A;  3WCK A;  3NEZ A;  4OY4 A;  2G16 B;  2G6X A;  5EBJ A;  1EMC A;  3WLC A;  2FZU A;  2IB5 A;  4XOW A;  4XL5 A;  4LJC A;  3E5W A;  2DD9 A;  2POX A;  4H3M A;  5FVF A;  4HQC A;  3DQF A;  3LVC A;  1Q4D A;  2DUF A;  2G6E A;  2HCG A;  5LTP A;  5HW9 A;  5EJU A;  5T3I A;  4L12 A;  3U0N A;  3UFZ A;  2O24 A;  4J88 A;  3CB9 A;  2A53 B;  2QT2 A;  4NWS A;  3DQ8 A;  3EVP A;  1GFL A;  4B5Y A;  3SVC A;  2A50 B;  2BTJ A;  3VIC A;  4BDU A;  2YE0 A;  2IOV A;  5DTZ A;  4DXP A;  5EXC I;  3DPZ A;  2IE2 A;  2OKW A;  2QRF A;  1C4F A;  1YHG A;  3UG0 A;  4IK4 A;  3DQL A;  1EMF A;  3LSA A;  4L13 A;  3O78 A;  2G6Y A;  2OKY A;  1OXE A;  3DQ5 A;  3DQC A;  3LF3 A;  5BQL A;  1EMA A;  4W77 A;  2WSN A;  4KGF A;  1B9C A;  3SSL A;  2ZMW A;  1EMB A;  4N3D A;  2OTB A;  2GW3 A;  3P28 A;  1Z1Q A;  2WHU A;  3DQH A;  1YHH A;  5EXU A;  4Q9W A;  2DUG A;  2H5Q A;  4KF5 C;  4HE4 A;  3LS3 A;  5KTG A;  3SVE A;  1W7S A;  4P76 A;  5EB6 A;  3LA1 A;  4DXO A;  2H5P A;  4DXI A;  3SVD A;  5DPH A;  3PJ5 A;  4W6B A;  3U0M A;  2VAD A;  2WIQ A;  3CBE A;  2VAE A;  2GX2 A;  4JC2 A;  2A48 A;  2OGR A;  2AWK A;  4XGY A;  1KYS A;  4R6D A;  1KP5 A;  3SS0 A;  2VVH A;  5HZU A;  2G2S B;  3ZUF A;  1EML A;  4LJD C;  3SVU A;  1RMM A;  3DQN A;  1QYF A;  1Q4A A;  3SG5 A;  3U8C A;  4EN1 A;  2IB6 A;  2QZ0 A;  3ST2 A;  1YHI A;  5DTY A;  3RWT A;  4ZIO A;  2A54 B;  4UTS A;  4EUL A;  2Z6X A;  1EMK A;  1QYO A;  3SST A;  3DQ7 A;  1ZGO A;  2Q57 A;  3GB3 A;  3SG7 A;  3I19 A;  2AWL A;  2EMN A;  4B30 B;  4PPL A;  1Q4C A;  2HFC A;  4I2Y A;  3P8U A;  2H8Q A;  4KW8 A;  3U0L A;  4W6U A;  3EKJ A;  3DQ3 A;  1QYQ A;  4R6B A;  3H1O A;  2EMD A;  4W6I A;  5DPG A;  2V4E A;  2Z6Y A;  1YZW A;  3M24 A;  3ST4 A;  5DRG A;  4IZN A;  4KA9 A;  3DQJ A;  3SVN A;  1YFP A;  3CD1 A;  3A8S A;  3DQK A;  4W6C A;  4W7E A;  1XA9 A;  1F0B A;  5DTL A;  3OSR A;  3EK8 A;  4W74 A;  3SVB A;  5HBD A;  4PPK A;  3EK4 A;  3M22 A;  3IP2 A;  1JBZ A;  4U2V A;  4EDS A;  3DQ9 A;  3NT9 A;  4RYW A;  4L1I A;  2G3O A;  3GL4 A;  3U8A A;  1F09 A;  1ZGP A;  2Z6Z A;  4OHS A;  2HJO A;  3GJ2 A;  3SSH A;  5DRF A;  2QLE A;  2AH8 A;  3AI4 A;  4RTC A;  4Z4M A;  2WUR A;  4H3N A;  4W7F A;  3PIB A;  4ZB1 A;  4J8A A;  3CD9 A;  4DXQ A;  3CFH A;  4IK3 A;  3ED8 A;  2AWJ A;  2EMO A;  2H6V A;  3BXB A;  3CFF A;  4AS8 A;  5LK4 A;  4XVP A;  3G9A A;  2YDZ A;  3EVV A;  2Y0G A;  3DQA A;  4HVF A;  3VK1 A;  2WSO A;  3LVA A;  3DPW A;  4W75 A;  2FWQ A;  1EME A;  2DUI A;  2QU1 A;  1ZUX A;  2HPW A;  4Q7R A;  3VHT B;  5BTT B;  5LTR A;  1ZGQ A;  4W6P A;  2G3D B;  3SG4 A;  1XQM A;  4W72 A;  4W6R A;  4W6T A;  3ZUJ A;  4Q9X A;  2G5Z B;  4PFE A;  5FVI A;  4P1Q A;  4IK8 A;  5AQB B;  1W7U A;  3CGL A;  3IR8 A;  2Z1O A;  2GW4 B;  1MOV A;  4JEO A;  2A46 A;  2ZO6 A;  4ZIN A;  3NT3 A;  5HZS A;  2AHA A;  2HGY A;  1Q73 A;  5HZO A;  5FVG A;  2WIS A;  1S6Z A;  2H5R A;  1UIS A;  3SV5 A;  3SRY A;  1YJ2 A;  5DU0 A;  1YJF A;  1QY3 A;  5H87 A;  2H9W A;  3OGO A;  2ICR A;  4ORN A;  4EDO A;  4W7D A;  4TZA A;  4W6A A;  3DQO A;  3VHT A;  5BTT A;  5DQB A;  2YFP A;  3SSV A;  4JRB A;  1MOU A;  2B3P A;  4JFG A;  4LQT A;  3TMR A;  4GES B;  4ANJ A;  1Q4E A;  3AI5 A;  3KCT A;  4EMQ A;  5J2O A;  4IK9 A;  1JBY A;  3NF0 A;  5HGE A;  3MGF A;  4GF6 B;  3DQD A;  4LW5 A;  4W6O A;  5EB7 A;  3DQ6 A;  1RM9 A;  2GX0 A;  4W6M A;  1QXT A;  2ARL A;  2DDC A;  1RRX A;  4W7C A;  3BXC A;  4W69 A;  4DXN A;  3O77 A;  1OXF A;  3SSY A;  3SG6 A;  3ST3 A;  5FHV A;  3E5V A;  5F9G A;  3V3D A;  2FL1 A;  3OSQ A;  2PXS A;  3ADF A;  2A56 B;  3TMT A;  3SVS A;  3SG3 A;  2DD7 A;  4KEX A;  3EVU A;  3DQE A;  3SVR A;  2VVI A;  4B30 A;  5DTX A;  1Z1P A;  4W6G A;  5DY6 A;  3SG2 A;  4W76 A;  3CFA A;  4W7R A;  2QLH A;  1EMM A;  1KYP A; 
#chains in the Genus database with same CATH homology
 1GL4 A;  3DQ2 A;  1OXD A;  1Q4B A;  1CV7 A;  2AWM A;  2A52 B;  2ZO7 A;  3PJ7 A;  4DKN A;  2DUE A;  3DQM A;  1HUY A;  3K1K A;  5DQM A;  4AR7 A;  2HQZ A;  4TZG A;  3EVR A;  3AKO A;  5H88 A;  4KW9 A;  4IK1 A;  4OJ0 A;  1XAE A;  4DKM A;  2DDD A;  3DQ4 A;  3SVO A;  3DQU A;  4LJD A;  1RMO A;  4W6L A;  3EKH A;  2O2B A;  3W1D A;  1MYW A;  1RMP A;  3BX9 A;  3PJB A;  4PPJ A;  4ZF3 A;  3U8P A;  3KCS A;  4HQ9 A;  3U0K A;  1W7T A;  2HQK A;  4DXM A;  4ZF5 A;  1HCJ A;  2V4E C;  4KF5 A;  4W6D A;  2A47 A;  5H89 A;  4LQU A;  5BT0 A;  3H1R A;  2HRS A;  1XSS A;  2QLI A;  2PXW A;  5HZT A;  3S05 A;  4KAG A;  3LF4 B;  5DPJ A;  2Q6P A;  5EHU A;  2HGD A;  1GGX A;  4GOB A;  3EK7 A;  2OTE A;  2B3Q A;  3GEX A;  4HQ8 A;  3RWA A;  5LTQ A;  4LJB A;  4W7X A;  2H5O A;  3E5T A;  3ZTF A;  4XOV A;  4ZF4 A;  1KYR A;  4RYS A;  2OJK A;  2WHS A;  2P4M A;  3BXA A;  2DUH A;  2QLG B;  4KF4 A;  2RH7 A;  1H6R A;  2O29 A;  4W6J A;  3SSP A;  3NED A;  4KW4 A;  4W6S A;  4OGS A;  1EMG A;  3GJ1 A;  4W6H A;  4H47 A;  3LVD A;  5EXB A;  4Z4K A;  4W6K A;  1JC1 A;  2V4E B;  2JAD A;  4W7A A;  2C9I A;  4JF9 A;  3ZUL A;  4W73 A;  3WLD A;  4ZFS A;  3SSK A;  4J89 A;  2ZMU A;  4H3L A;  1XMZ A;  1G7K A;  4Q7T A;  2C9J A;  3DQI A;  4KPI A;  4H48 A;  4OQW A;  3ST0 A;  2YE1 A;  1H4U A;  3DPX A;  2QLG A;  4JGE A;  3W1C A;  2VVJ A;  4W6N A;  1JC0 A;  1BFP A;  5DPI A;  2WHT A;  4W6F A;  2VZX A;  4Q7U A;  4IK5 A;  4ZBL A;  4KGE A;  3DQ1 A;  3WCK A;  3NEZ A;  4OY4 A;  2G16 B;  2G6X A;  5EBJ A;  1EMC A;  3WLC A;  2FZU A;  2IB5 A;  4XOW A;  4XL5 A;  4LJC A;  3E5W A;  2DD9 A;  2POX A;  4H3M A;  5FVF A;  4HQC A;  3DQF A;  3LVC A;  1Q4D A;  2DUF A;  2G6E A;  2HCG A;  5LTP A;  5HW9 A;  5EJU A;  5T3I A;  4L12 A;  3U0N A;  3UFZ A;  2O24 A;  4J88 A;  3CB9 A;  2A53 B;  2QT2 A;  4NWS A;  3DQ8 A;  3EVP A;  1GFL A;  4B5Y A;  3SVC A;  2A50 B;  2BTJ A;  3VIC A;  4BDU A;  2YE0 A;  2IOV A;  5DTZ A;  4DXP A;  5EXC I;  3DPZ A;  2IE2 A;  2OKW A;  2QRF A;  1C4F A;  1YHG A;  3UG0 A;  4IK4 A;  3DQL A;  1EMF A;  3LSA A;  4L13 A;  3O78 A;  2G6Y A;  2OKY A;  1OXE A;  3DQ5 A;  3DQC A;  3LF3 A;  5BQL A;  1EMA A;  4W77 A;  2WSN A;  4KGF A;  1B9C A;  3SSL A;  2ZMW A;  1EMB A;  4N3D A;  2OTB A;  2GW3 A;  3P28 A;  1Z1Q A;  2WHU A;  3DQH A;  1YHH A;  5EXU A;  4Q9W A;  2DUG A;  2H5Q A;  4KF5 C;  4HE4 A;  3LS3 A;  5KTG A;  3SVE A;  1W7S A;  4P76 A;  5EB6 A;  3LA1 A;  4DXO A;  2H5P A;  4DXI A;  3SVD A;  5DPH A;  3PJ5 A;  4W6B A;  3U0M A;  2VAD A;  2WIQ A;  3CBE A;  2VAE A;  2GX2 A;  4JC2 A;  2A48 A;  2OGR A;  2AWK A;  4XGY A;  1KYS A;  4R6D A;  1KP5 A;  3SS0 A;  2VVH A;  5HZU A;  2G2S B;  3ZUF A;  1EML A;  4LJD C;  3SVU A;  1RMM A;  3DQN A;  1QYF A;  1Q4A A;  3SG5 A;  3U8C A;  4EN1 A;  2IB6 A;  2QZ0 A;  3ST2 A;  1YHI A;  5DTY A;  3RWT A;  4ZIO A;  2A54 B;  4UTS A;  4EUL A;  2Z6X A;  1EMK A;  1QYO A;  3SST A;  3DQ7 A;  1ZGO A;  2Q57 A;  3GB3 A;  3SG7 A;  3I19 A;  2AWL A;  2EMN A;  4B30 B;  4PPL A;  1Q4C A;  2HFC A;  4I2Y A;  3P8U A;  2H8Q A;  4KW8 A;  3U0L A;  4W6U A;  3EKJ A;  3DQ3 A;  1QYQ A;  4R6B A;  3H1O A;  2EMD A;  4W6I A;  5DPG A;  2V4E A;  2Z6Y A;  1YZW A;  3M24 A;  3ST4 A;  5DRG A;  4IZN A;  4KA9 A;  3DQJ A;  3SVN A;  1YFP A;  3CD1 A;  3A8S A;  3DQK A;  4W6C A;  4W7E A;  1XA9 A;  1F0B A;  5DTL A;  3OSR A;  3EK8 A;  4W74 A;  3SVB A;  5HBD A;  4PPK A;  3EK4 A;  3M22 A;  3IP2 A;  1JBZ A;  4U2V A;  4EDS A;  3DQ9 A;  3NT9 A;  4RYW A;  4L1I A;  2G3O A;  3GL4 A;  3U8A A;  1F09 A;  1ZGP A;  2Z6Z A;  4OHS A;  2HJO A;  3GJ2 A;  3SSH A;  5DRF A;  2QLE A;  2AH8 A;  3AI4 A;  4RTC A;  4Z4M A;  2WUR A;  4H3N A;  4W7F A;  3PIB A;  4ZB1 A;  4J8A A;  3CD9 A;  4DXQ A;  3CFH A;  4IK3 A;  3ED8 A;  2AWJ A;  2EMO A;  2H6V A;  3BXB A;  3CFF A;  4AS8 A;  5LK4 A;  4XVP A;  3G9A A;  2YDZ A;  3EVV A;  2Y0G A;  3DQA A;  4HVF A;  3VK1 A;  2WSO A;  3LVA A;  3DPW A;  4W75 A;  2FWQ A;  1EME A;  2DUI A;  2QU1 A;  1ZUX A;  2HPW A;  4Q7R A;  3VHT B;  5BTT B;  5LTR A;  1ZGQ A;  4W6P A;  2G3D B;  3SG4 A;  1XQM A;  4W72 A;  4W6R A;  4W6T A;  3ZUJ A;  4Q9X A;  2G5Z B;  4PFE A;  5FVI A;  4P1Q A;  4IK8 A;  5AQB B;  1W7U A;  3CGL A;  3IR8 A;  2Z1O A;  2GW4 B;  1MOV A;  4JEO A;  2A46 A;  2ZO6 A;  4ZIN A;  3NT3 A;  5HZS A;  2AHA A;  2HGY A;  1Q73 A;  5HZO A;  5FVG A;  2WIS A;  1S6Z A;  2H5R A;  1UIS A;  3SV5 A;  3SRY A;  1YJ2 A;  5DU0 A;  1YJF A;  1QY3 A;  5H87 A;  2H9W A;  3OGO A;  2ICR A;  4ORN A;  4EDO A;  4W7D A;  4TZA A;  4W6A A;  3DQO A;  3VHT A;  5BTT A;  5DQB A;  2YFP A;  3SSV A;  4JRB A;  1MOU A;  2B3P A;  4JFG A;  4LQT A;  3TMR A;  4GES B;  4ANJ A;  1Q4E A;  3AI5 A;  3KCT A;  4EMQ A;  5J2O A;  4IK9 A;  1JBY A;  3NF0 A;  5HGE A;  3MGF A;  4GF6 B;  3DQD A;  4LW5 A;  4W6O A;  5EB7 A;  3DQ6 A;  1RM9 A;  2GX0 A;  4W6M A;  1QXT A;  2ARL A;  2DDC A;  1RRX A;  4W7C A;  3BXC A;  4W69 A;  4DXN A;  3O77 A;  1OXF A;  3SSY A;  3SG6 A;  3ST3 A;  5FHV A;  3E5V A;  5F9G A;  3V3D A;  2FL1 A;  3OSQ A;  2PXS A;  3ADF A;  2A56 B;  3TMT A;  3SVS A;  3SG3 A;  2DD7 A;  4KEX A;  3EVU A;  3DQE A;  3SVR A;  2VVI A;  4B30 A;  5DTX A;  1Z1P A;  4W6G A;  5DY6 A;  3SG2 A;  4W76 A;  3CFA A;  4W7R A;  2QLH A;  1EMM A;  1KYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...