5HZXA

Crystal structure of zebrafish mth1 in complex with th588
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
TSKLLTLVLVVQPGRVLLGMKKRGFGAGKWNGFGGKVQTGETIEQAARRELLEESGLTVDTLHKIGNIKFEFIGETELMDVHIFRADNYEGEPAESDEMRPQWFDIDKIPFSQMWADDILWFPLMLQKKRFLGYFKFQGHDVIVEHKLDEVEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nudix (Nucleoside diphosphate linked moiety X)-type motif 1
publication title Hypoxic Signaling and the Cellular Redox Tumor Environment Determine Sensitivity to MTH1 Inhibition.
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 44
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5hzxA00
1K2EA 1MQWA 2G74A 3P5TA 1MUTA 1NFZA 1KTGA 5FSIA 3X0LA 5ANUA 2A8TA 5CFJA 3BAPA 3COUA 3H95A 3FK9A 2YYHA 2FVVA 2I8UA 4N1UA 3N77A 1V8SA 1RRSA 3X0JA 3A6SA 3GZ8A 3O8SA 5BS6A 1QVJA 3MDGA 4JZUA 5IW5A 1F3YA 2DUKA 2Q9PA 3A6VA 5ANWA 5HZXA 3OGAA 5CFIA 1V8IA 3CNGA 1V8NA 4MPOA 2RRKA 2YVMA 3DUPA 3GWYA 3X0QA 2A8SA 2VNPA 2G73A 2I6KA 1V8MA 2I8TA 3U53A 1Q33A 3X0OA 1JKNA 4DYWA 5IW4A 2DHOA 1RYAA 1V8YA 3SHDA 1V8WA 5DPKA 1VHGA 1VC9A 1IRYA 2VNQA 2XSQA 4S2VA 3EF5A 1X83A 5DD4A 5DEQA 5GHMA 3J7Ye 2O1CA 2GT2A 3MGMA 2AZWA 4JZTA 4S2WA 3HYQA 2DSBA 3DKUA 1NFSA 3I7VA 5GHJA 1Q27A 4JZVA 1GA7A 2R5WA 2B0VA 3X0SA 5GHQA 2JVBA 3HHJA 3F6AA 1KT9A 1PPWA 3FCMA 1V8TA 3G0QA 3AC9A 1PPVA 3FSPA 2CL3A 3Q4IA 4HVYA 1OW2A 3WHWA 2FKBA 3SMDA 1VIUA 3X0PA 3GZ6A 2YVPA 3GG6A 1I9AA 5ANSA 5ANVA 2B2KA 1U20A 3MCFA 3I7UA 2O5FA 1K26A 1NQZA 4KYXA 3ZR0A 1HZTA 3Q2SA 4KG4A 1V8UA 3O52A 3I9XA 2A8QA 3Q93A 5FSMA 1RRQA 2DSDA 1MQEA 1PUQA 2A6TA 1HX3A 1TUMA 3Q2TA 2A8PA 2A8RA 4IJXA 1XSCA 1NQYA 1PUNA 1KHZA 1VRLA 3EESA 4YPRA 5ANTA 3X0KA 2ICJA 4YOQA 3BHOA 2GT4A 1VC8A 5DDGA 3X0IA 1PVFA 5I8UA 2W4EA 5C7QA 1VCDA 2J8QA 2KDVA 5FSOA 4C9WA 4YPHA 1XSBA 3A6TA 3P6YA 5FSLA 1X84A 3BM4A 1MP2A 5LPGA 3N9UA 2DSCA 1VIQA 2QJOA 4KTBA 1G0SA 3L85A 3FJYA 1XSAA 2O5WA 3QSJA 2ICKA 4KG3A 4N1TA 4NFWA 5ISYA 2PNYA 2GB5A 1VHZA 4K6EA 1SJYA 1R67A 5GHOA 1MR2A 2FMLA 4ILQA 3MDIA 3ZR1A 2B06A 1SOIA 3SONA 4HFQA 5GHIA 2KDWA 5FSKA 2YVOA 5GHNA 1SU2A 1X51A 3O6ZA 1V8LA 1JRKA 3A6UA 3E57A 3GZ5A 1V8RA 2YVNA 3FFUA 3KVHA 4JZSA 5C8LA 2QJTA 1SZ3A 3F13A 3Q91A 1Q54A 3X0NA 3O69A 3R03A 4C9XA 3X0MA 5FSNA 5GHPA 4S2YA 4V14A 1PPXA 5BONA 1G9QA 3O61A 4NFXA 2QKMB 3ACAA 3EXQA 4ICKA 3X0RA 2PQVA 3GRNA 4ZG0A 5C7TA 3RH7A 1VK6A 1MK1A 3EEUA 3ID9A 1V8VA 4S2XA 1PUSA 3Q1PA
chains in the Genus database with same CATH superfamily
1K2EA 1MQWA 2G74A 3P5TA 1MUTA 1NFZA 1KTGA 5FSIA 3X0LA 5ANUA 2A8TA 5CFJA 2CZRA 3BAPA 3COUA 3H95A 3FK9A 2YYHA 2FVVA 2I8UA 4N1UA 3N77A 1V8SA 1RRSA 3X0JA 3A6SA 3GZ8A 3O8SA 5BS6A 1QVJA 3MDGA 4JZUA 5IW5A 1F3YA 2DUKA 2Q9PA 3A6VA 5ANWA 5HZXA 3OGAA 5CFIA 1V8IA 3CNGA 1V8NA 4MPOA 2RRKA 2YVMA 3DUPA 3GWYA 3X0QA 2A8SA 2VNPA 2G73A 2I6KA 1V8MA 2I8TA 3U53A 1Q33A 3X0OA 1JKNA 4DYWA 5IW4A 2DHOA 1RYAA 1V8YA 3SHDA 1V8WA 5DPKA 1VHGA 1VC9A 1IRYA 2VNQA 2XSQA 4S2VA 3EF5A 1X83A 5DD4A 5DEQA 5GHMA 3J7Ye 2O1CA 2GT2A 3MGMA 2AZWA 4JZTA 4S2WA 3HYQA 2DSBA 3DKUA 1NFSA 3I7VA 5GHJA 1Q27A 4JZVA 1GA7A 2R5WA 2B0VA 3X0SA 5GHQA 2JVBA 3HHJA 3F6AA 1KT9A 1PPWA 3FCMA 1V8TA 3G0QA 3AC9A 1PPVA 3FSPA 2CL3A 3Q4IA 4HVYA 1OW2A 3WHWA 2FKBA 3SMDA 1VIUA 3X0PA 3GZ6A 2YVPA 3GG6A 1I9AA 5ANSA 5ANVA 2B2KA 1U20A 3MCFA 3I7UA 2O5FA 1K26A 1NQZA 4KYXA 3ZR0A 1HZTA 3Q2SA 4KG4A 1V8UA 3O52A 3I9XA 2A8QA 3Q93A 5FSMA 1RRQA 2DSDA 1MQEA 1PUQA 2A6TA 1HX3A 1TUMA 3Q2TA 2A8PA 2A8RA 4IJXA 1XSCA 1NQYA 1PUNA 1KHZA 1VRLA 3EESA 4YPRA 5ANTA 3X0KA 2ICJA 4YOQA 3BHOA 2GT4A 1VC8A 5DDGA 3X0IA 1PVFA 5I8UA 2W4EA 5C7QA 1VCDA 2J8QA 2KDVA 5FSOA 4C9WA 4YPHA 1XSBA 3A6TA 3P6YA 5FSLA 1X84A 3BM4A 1MP2A 5LPGA 3N9UA 2DSCA 1VIQA 2QJOA 4KTBA 1G0SA 3L85A 3FJYA 1XSAA 2O5WA 3QSJA 2ICKA 4KG3A 4N1TA 4NFWA 5ISYA 2PNYA 2GB5A 1VHZA 4K6EA 1SJYA 1R67A 5GHOA 1MR2A 2FMLA 4ILQA 3MDIA 3ZR1A 2B06A 1SOIA 3SONA 4HFQA 5GHIA 2KDWA 5FSKA 2YVOA 5GHNA 1SU2A 1X51A 3O6ZA 1V8LA 1JRKA 3A6UA 3E57A 3GZ5A 1V8RA 2YVNA 3FFUA 3KVHA 4JZSA 5C8LA 2QJTA 1SZ3A 3F13A 3Q91A 1Q54A 3X0NA 3O69A 3R03A 4C9XA 3X0MA 5FSNA 5GHPA 4S2YA 4V14A 1PPXA 5BONA 1G9QA 3O61A 4NFXA 2QKMB 3ACAA 3EXQA 4ICKA 4J7HA 4J7GA 3X0RA 2PQVA 3GRNA 4ZG0A 5C7TA 3RH7A 1VK6A 1MK1A 3EEUA 3ID9A 1V8VA 4S2XA 1PUSA 3Q1PA
chains in the Genus database with same CATH topology
1K2EA 1MQWA 2G74A 3P5TA 1MUTA 1NFZA 1KTGA 5FSIA 3X0LA 5ANUA 2A8TA 5CFJA 2CZRA 3BAPA 3COUA 3H95A 3FK9A 2YYHA 2FVVA 2I8UA 4N1UA 3N77A 1V8SA 1RRSA 3X0JA 3A6SA 3GZ8A 3O8SA 5BS6A 1QVJA 3MDGA 4JZUA 5IW5A 1F3YA 2DUKA 2Q9PA 3A6VA 5ANWA 5HZXA 3OGAA 5CFIA 1V8IA 3CNGA 1V8NA 4MPOA 2RRKA 2YVMA 3DUPA 3GWYA 3X0QA 2A8SA 2VNPA 2G73A 2I6KA 1V8MA 2I8TA 3U53A 1Q33A 3X0OA 1JKNA 4DYWA 5IW4A 2DHOA 1RYAA 1V8YA 3SHDA 1V8WA 5DPKA 1VHGA 1VC9A 1IRYA 2VNQA 2XSQA 4S2VA 3EF5A 1X83A 5DD4A 5DEQA 5GHMA 3J7Ye 2O1CA 2GT2A 3MGMA 2AZWA 4JZTA 4S2WA 3HYQA 2DSBA 3DKUA 1NFSA 3I7VA 5GHJA 1Q27A 4JZVA 1GA7A 2R5WA 2B0VA 3X0SA 5GHQA 2JVBA 3HHJA 3F6AA 1KT9A 1PPWA 3FCMA 1V8TA 3G0QA 3AC9A 1PPVA 3FSPA 2CL3A 3Q4IA 4HVYA 1OW2A 3WHWA 2FKBA 3SMDA 1VIUA 3X0PA 3GZ6A 2YVPA 3GG6A 1I9AA 5ANSA 5ANVA 2B2KA 1U20A 3MCFA 3I7UA 2O5FA 1K26A 1NQZA 4KYXA 3ZR0A 1HZTA 3Q2SA 4KG4A 1V8UA 3O52A 3I9XA 2A8QA 3Q93A 5FSMA 1RRQA 2DSDA 1MQEA 1PUQA 2A6TA 1HX3A 1TUMA 3Q2TA 2A8PA 2A8RA 4IJXA 1XSCA 1NQYA 1PUNA 1KHZA 1VRLA 3EESA 4YPRA 5ANTA 3X0KA 2ICJA 4YOQA 3BHOA 2GT4A 1VC8A 5DDGA 3X0IA 1PVFA 5I8UA 2W4EA 5C7QA 1VCDA 2J8QA 2KDVA 5FSOA 4C9WA 4YPHA 1XSBA 3A6TA 3P6YA 5FSLA 1X84A 3BM4A 1MP2A 5LPGA 3N9UA 2DSCA 1VIQA 2QJOA 4KTBA 1G0SA 3L85A 3FJYA 1XSAA 2O5WA 3QSJA 2ICKA 4KG3A 4N1TA 4NFWA 5ISYA 2PNYA 2GB5A 1VHZA 4K6EA 1SJYA 1R67A 5GHOA 1MR2A 2FMLA 4ILQA 3MDIA 3ZR1A 2B06A 1SOIA 3SONA 4HFQA 5GHIA 2KDWA 5FSKA 2YVOA 5GHNA 1SU2A 1X51A 3O6ZA 1V8LA 1JRKA 3A6UA 3E57A 3GZ5A 1V8RA 2YVNA 3FFUA 3KVHA 4JZSA 5C8LA 2QJTA 1SZ3A 3F13A 3Q91A 1Q54A 3X0NA 3O69A 3R03A 4C9XA 3X0MA 5FSNA 5GHPA 4S2YA 4V14A 1PPXA 5BONA 1G9QA 3O61A 4NFXA 2QKMB 3ACAA 3EXQA 4ICKA 4J7HA 4J7GA 3X0RA 2PQVA 3GRNA 4ZG0A 5C7TA 3RH7A 1VK6A 1MK1A 3EEUA 3ID9A 1V8VA 4S2XA 1PUSA 3Q1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2E A;  1MQW A;  2G74 A;  3P5T A;  1MUT A;  1NFZ A;  1KTG A;  5FSI A;  3X0L A;  5ANU A;  2A8T A;  5CFJ A;  3BAP A;  3COU A;  3H95 A;  3FK9 A;  2YYH A;  2FVV A;  2I8U A;  4N1U A;  3N77 A;  1V8S A;  1RRS A;  3X0J A;  3A6S A;  3GZ8 A;  3O8S A;  5BS6 A;  1QVJ A;  3MDG A;  4JZU A;  5IW5 A;  1F3Y A;  2DUK A;  2Q9P A;  3A6V A;  5ANW A;  5HZX A;  3OGA A;  5CFI A;  1V8I A;  3CNG A;  1V8N A;  4MPO A;  2RRK A;  2YVM A;  3DUP A;  3GWY A;  3X0Q A;  2A8S A;  2VNP A;  2G73 A;  2I6K A;  1V8M A;  2I8T A;  3U53 A;  1Q33 A;  3X0O A;  1JKN A;  4DYW A;  5IW4 A;  2DHO A;  1RYA A;  1V8Y A;  3SHD A;  1V8W A;  5DPK A;  1VHG A;  1VC9 A;  1IRY A;  2VNQ A;  2XSQ A;  4S2V A;  3EF5 A;  1X83 A;  5DD4 A;  5DEQ A;  5GHM A;  3J7Y e;  2O1C A;  2GT2 A;  3MGM A;  2AZW A;  4JZT A;  4S2W A;  3HYQ A;  2DSB A;  3DKU A;  1NFS A;  3I7V A;  5GHJ A;  1Q27 A;  4JZV A;  1GA7 A;  2R5W A;  2B0V A;  3X0S A;  5GHQ A;  2JVB A;  3HHJ A;  3F6A A;  1KT9 A;  1PPW A;  3FCM A;  1V8T A;  3G0Q A;  3AC9 A;  1PPV A;  3FSP A;  2CL3 A;  3Q4I A;  4HVY A;  1OW2 A;  3WHW A;  2FKB A;  3SMD A;  1VIU A;  3X0P A;  3GZ6 A;  2YVP A;  3GG6 A;  1I9A A;  5ANS A;  5ANV A;  2B2K A;  1U20 A;  3MCF A;  3I7U A;  2O5F A;  1K26 A;  1NQZ A;  4KYX A;  3ZR0 A;  1HZT A;  3Q2S A;  4KG4 A;  1V8U A;  3O52 A;  3I9X A;  2A8Q A;  3Q93 A;  5FSM A;  1RRQ A;  2DSD A;  1MQE A;  1PUQ A;  2A6T A;  1HX3 A;  1TUM A;  3Q2T A;  2A8P A;  2A8R A;  4IJX A;  1XSC A;  1NQY A;  1PUN A;  1KHZ A;  1VRL A;  3EES A;  4YPR A;  5ANT A;  3X0K A;  2ICJ A;  4YOQ A;  3BHO A;  2GT4 A;  1VC8 A;  5DDG A;  3X0I A;  1PVF A;  5I8U A;  2W4E A;  5C7Q A;  1VCD A;  2J8Q A;  2KDV A;  5FSO A;  4C9W A;  4YPH A;  1XSB A;  3A6T A;  3P6Y A;  5FSL A;  1X84 A;  3BM4 A;  1MP2 A;  5LPG A;  3N9U A;  2DSC A;  1VIQ A;  2QJO A;  4KTB A;  1G0S A;  3L85 A;  3FJY A;  1XSA A;  2O5W A;  3QSJ A;  2ICK A;  4KG3 A;  4N1T A;  4NFW A;  5ISY A;  2PNY A;  2GB5 A;  1VHZ A;  4K6E A;  1SJY A;  1R67 A;  5GHO A;  1MR2 A;  2FML A;  4ILQ A;  3MDI A;  3ZR1 A;  2B06 A;  1SOI A;  3SON A;  4HFQ A;  5GHI A;  2KDW A;  5FSK A;  2YVO A;  5GHN A;  1SU2 A;  1X51 A;  3O6Z A;  1V8L A;  1JRK A;  3A6U A;  3E57 A;  3GZ5 A;  1V8R A;  2YVN A;  3FFU A;  3KVH A;  4JZS A;  5C8L A;  2QJT A;  1SZ3 A;  3F13 A;  3Q91 A;  1Q54 A;  3X0N A;  3O69 A;  3R03 A;  4C9X A;  3X0M A;  5FSN A;  5GHP A;  4S2Y A;  4V14 A;  1PPX A;  5BON A;  1G9Q A;  3O61 A;  4NFX A;  2QKM B;  3ACA A;  3EXQ A;  4ICK A;  3X0R A;  2PQV A;  3GRN A;  4ZG0 A;  5C7T A;  3RH7 A;  1VK6 A;  1MK1 A;  3EEU A;  3ID9 A;  1V8V A;  4S2X A;  1PUS A;  3Q1P A; 
#chains in the Genus database with same CATH topology
 1K2E A;  1MQW A;  2G74 A;  3P5T A;  1MUT A;  1NFZ A;  1KTG A;  5FSI A;  3X0L A;  5ANU A;  2A8T A;  5CFJ A;  2CZR A;  3BAP A;  3COU A;  3H95 A;  3FK9 A;  2YYH A;  2FVV A;  2I8U A;  4N1U A;  3N77 A;  1V8S A;  1RRS A;  3X0J A;  3A6S A;  3GZ8 A;  3O8S A;  5BS6 A;  1QVJ A;  3MDG A;  4JZU A;  5IW5 A;  1F3Y A;  2DUK A;  2Q9P A;  3A6V A;  5ANW A;  5HZX A;  3OGA A;  5CFI A;  1V8I A;  3CNG A;  1V8N A;  4MPO A;  2RRK A;  2YVM A;  3DUP A;  3GWY A;  3X0Q A;  2A8S A;  2VNP A;  2G73 A;  2I6K A;  1V8M A;  2I8T A;  3U53 A;  1Q33 A;  3X0O A;  1JKN A;  4DYW A;  5IW4 A;  2DHO A;  1RYA A;  1V8Y A;  3SHD A;  1V8W A;  5DPK A;  1VHG A;  1VC9 A;  1IRY A;  2VNQ A;  2XSQ A;  4S2V A;  3EF5 A;  1X83 A;  5DD4 A;  5DEQ A;  5GHM A;  3J7Y e;  2O1C A;  2GT2 A;  3MGM A;  2AZW A;  4JZT A;  4S2W A;  3HYQ A;  2DSB A;  3DKU A;  1NFS A;  3I7V A;  5GHJ A;  1Q27 A;  4JZV A;  1GA7 A;  2R5W A;  2B0V A;  3X0S A;  5GHQ A;  2JVB A;  3HHJ A;  3F6A A;  1KT9 A;  1PPW A;  3FCM A;  1V8T A;  3G0Q A;  3AC9 A;  1PPV A;  3FSP A;  2CL3 A;  3Q4I A;  4HVY A;  1OW2 A;  3WHW A;  2FKB A;  3SMD A;  1VIU A;  3X0P A;  3GZ6 A;  2YVP A;  3GG6 A;  1I9A A;  5ANS A;  5ANV A;  2B2K A;  1U20 A;  3MCF A;  3I7U A;  2O5F A;  1K26 A;  1NQZ A;  4KYX A;  3ZR0 A;  1HZT A;  3Q2S A;  4KG4 A;  1V8U A;  3O52 A;  3I9X A;  2A8Q A;  3Q93 A;  5FSM A;  1RRQ A;  2DSD A;  1MQE A;  1PUQ A;  2A6T A;  1HX3 A;  1TUM A;  3Q2T A;  2A8P A;  2A8R A;  4IJX A;  1XSC A;  1NQY A;  1PUN A;  1KHZ A;  1VRL A;  3EES A;  4YPR A;  5ANT A;  3X0K A;  2ICJ A;  4YOQ A;  3BHO A;  2GT4 A;  1VC8 A;  5DDG A;  3X0I A;  1PVF A;  5I8U A;  2W4E A;  5C7Q A;  1VCD A;  2J8Q A;  2KDV A;  5FSO A;  4C9W A;  4YPH A;  1XSB A;  3A6T A;  3P6Y A;  5FSL A;  1X84 A;  3BM4 A;  1MP2 A;  5LPG A;  3N9U A;  2DSC A;  1VIQ A;  2QJO A;  4KTB A;  1G0S A;  3L85 A;  3FJY A;  1XSA A;  2O5W A;  3QSJ A;  2ICK A;  4KG3 A;  4N1T A;  4NFW A;  5ISY A;  2PNY A;  2GB5 A;  1VHZ A;  4K6E A;  1SJY A;  1R67 A;  5GHO A;  1MR2 A;  2FML A;  4ILQ A;  3MDI A;  3ZR1 A;  2B06 A;  1SOI A;  3SON A;  4HFQ A;  5GHI A;  2KDW A;  5FSK A;  2YVO A;  5GHN A;  1SU2 A;  1X51 A;  3O6Z A;  1V8L A;  1JRK A;  3A6U A;  3E57 A;  3GZ5 A;  1V8R A;  2YVN A;  3FFU A;  3KVH A;  4JZS A;  5C8L A;  2QJT A;  1SZ3 A;  3F13 A;  3Q91 A;  1Q54 A;  3X0N A;  3O69 A;  3R03 A;  4C9X A;  3X0M A;  5FSN A;  5GHP A;  4S2Y A;  4V14 A;  1PPX A;  5BON A;  1G9Q A;  3O61 A;  4NFX A;  2QKM B;  3ACA A;  3EXQ A;  4ICK A;  4J7H A;  4J7G A;  3X0R A;  2PQV A;  3GRN A;  4ZG0 A;  5C7T A;  3RH7 A;  1VK6 A;  1MK1 A;  3EEU A;  3ID9 A;  1V8V A;  4S2X A;  1PUS A;  3Q1P A; 
#chains in the Genus database with same CATH homology
 1K2E A;  1MQW A;  2G74 A;  3P5T A;  1MUT A;  1NFZ A;  1KTG A;  5FSI A;  3X0L A;  5ANU A;  2A8T A;  5CFJ A;  2CZR A;  3BAP A;  3COU A;  3H95 A;  3FK9 A;  2YYH A;  2FVV A;  2I8U A;  4N1U A;  3N77 A;  1V8S A;  1RRS A;  3X0J A;  3A6S A;  3GZ8 A;  3O8S A;  5BS6 A;  1QVJ A;  3MDG A;  4JZU A;  5IW5 A;  1F3Y A;  2DUK A;  2Q9P A;  3A6V A;  5ANW A;  5HZX A;  3OGA A;  5CFI A;  1V8I A;  3CNG A;  1V8N A;  4MPO A;  2RRK A;  2YVM A;  3DUP A;  3GWY A;  3X0Q A;  2A8S A;  2VNP A;  2G73 A;  2I6K A;  1V8M A;  2I8T A;  3U53 A;  1Q33 A;  3X0O A;  1JKN A;  4DYW A;  5IW4 A;  2DHO A;  1RYA A;  1V8Y A;  3SHD A;  1V8W A;  5DPK A;  1VHG A;  1VC9 A;  1IRY A;  2VNQ A;  2XSQ A;  4S2V A;  3EF5 A;  1X83 A;  5DD4 A;  5DEQ A;  5GHM A;  3J7Y e;  2O1C A;  2GT2 A;  3MGM A;  2AZW A;  4JZT A;  4S2W A;  3HYQ A;  2DSB A;  3DKU A;  1NFS A;  3I7V A;  5GHJ A;  1Q27 A;  4JZV A;  1GA7 A;  2R5W A;  2B0V A;  3X0S A;  5GHQ A;  2JVB A;  3HHJ A;  3F6A A;  1KT9 A;  1PPW A;  3FCM A;  1V8T A;  3G0Q A;  3AC9 A;  1PPV A;  3FSP A;  2CL3 A;  3Q4I A;  4HVY A;  1OW2 A;  3WHW A;  2FKB A;  3SMD A;  1VIU A;  3X0P A;  3GZ6 A;  2YVP A;  3GG6 A;  1I9A A;  5ANS A;  5ANV A;  2B2K A;  1U20 A;  3MCF A;  3I7U A;  2O5F A;  1K26 A;  1NQZ A;  4KYX A;  3ZR0 A;  1HZT A;  3Q2S A;  4KG4 A;  1V8U A;  3O52 A;  3I9X A;  2A8Q A;  3Q93 A;  5FSM A;  1RRQ A;  2DSD A;  1MQE A;  1PUQ A;  2A6T A;  1HX3 A;  1TUM A;  3Q2T A;  2A8P A;  2A8R A;  4IJX A;  1XSC A;  1NQY A;  1PUN A;  1KHZ A;  1VRL A;  3EES A;  4YPR A;  5ANT A;  3X0K A;  2ICJ A;  4YOQ A;  3BHO A;  2GT4 A;  1VC8 A;  5DDG A;  3X0I A;  1PVF A;  5I8U A;  2W4E A;  5C7Q A;  1VCD A;  2J8Q A;  2KDV A;  5FSO A;  4C9W A;  4YPH A;  1XSB A;  3A6T A;  3P6Y A;  5FSL A;  1X84 A;  3BM4 A;  1MP2 A;  5LPG A;  3N9U A;  2DSC A;  1VIQ A;  2QJO A;  4KTB A;  1G0S A;  3L85 A;  3FJY A;  1XSA A;  2O5W A;  3QSJ A;  2ICK A;  4KG3 A;  4N1T A;  4NFW A;  5ISY A;  2PNY A;  2GB5 A;  1VHZ A;  4K6E A;  1SJY A;  1R67 A;  5GHO A;  1MR2 A;  2FML A;  4ILQ A;  3MDI A;  3ZR1 A;  2B06 A;  1SOI A;  3SON A;  4HFQ A;  5GHI A;  2KDW A;  5FSK A;  2YVO A;  5GHN A;  1SU2 A;  1X51 A;  3O6Z A;  1V8L A;  1JRK A;  3A6U A;  3E57 A;  3GZ5 A;  1V8R A;  2YVN A;  3FFU A;  3KVH A;  4JZS A;  5C8L A;  2QJT A;  1SZ3 A;  3F13 A;  3Q91 A;  1Q54 A;  3X0N A;  3O69 A;  3R03 A;  4C9X A;  3X0M A;  5FSN A;  5GHP A;  4S2Y A;  4V14 A;  1PPX A;  5BON A;  1G9Q A;  3O61 A;  4NFX A;  2QKM B;  3ACA A;  3EXQ A;  4ICK A;  4J7H A;  4J7G A;  3X0R A;  2PQV A;  3GRN A;  4ZG0 A;  5C7T A;  3RH7 A;  1VK6 A;  1MK1 A;  3EEU A;  3ID9 A;  1V8V A;  4S2X A;  1PUS A;  3Q1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...