5I0CA

Crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
89
Chain Sequence
EIREGHNKFYINDQGKQIAEIVFVPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted acyltransferase YjdJ with acyl-CoA N-acyltransferase domain from Escherichia coli str. K-12
rcsb
molecule keywords Uncharacterized protein YjdJ
molecule tags Hydrolase
source organism Escherichia coli (strain k12)
total genus 25
structure length 89
sequence length 90
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5i0cA00
5IX3A 3H4QA 3DR8A 4H6UA 3D2MA 4II9A 2Q4VA 4AG9A 4YFJA 5KTDA 5FVJA 2B3VA 1LRZA 4UWIA 3P2HA 3PGPA 2AE6A 4AVCA 3EY5A 3R1KA 2QMLA 4E2AA 3IWGA 5IV0A 4JJXA 4B5OA 5E96A 4PSXA 3KKWA 4UA3A 1YLEA 2GIVA 4MY3A 3BJ7A 4R3KA 2OZGA 2VBQA 3GYAA 1TIQA 4KUAA 4E0AA 3DR6A 2R98A 3CXQA 3BJ8A 5H84A 1Q2CA 1YK3A 1MJAA 2BEIA 5EBVA 3E0KA 1IYKA 1S7NA 4U9YA 4JD6A 2QECA 3R9GA 1B87A 1UFHA 4RI1A 2G3TA 4CRZB 3D3SA 5J8CA 2QIRA 1CM0A 4KVXA 3FB3A 4MHDA 1S7KA 2Z11A 4F6AA 4XPKA 2CY2A 3QAHA 2PR1A 2Z0ZA 1S3ZA 2Q44A 4HNYB 5I0CA 1OZPA 1R57A 2Q4YA 2FXFA 4XPDB 4NCZA 4KOTA 2RC4A 2P6EA 2D4OA 4U5YA 3OWCA 2C27A 3TOBA 2BL1A 3G8WA 4IF5A 2FS5A 4R57A 4PSWA 4NEXA 4K30A 4FD4A 1Y9KA 3TO6A 4YRHA 2REEA 2WPWA 1QSNA 1I21A 4QC6A 3F8KA 3S6FA 3S6GA 1B6BA 3TOAA 3IGRA 2OH1A 4CAXA 1GHEA 4Y49C 2CNSA 5ISVA 2A4NA 4R3LA 3UY5A 1BOBA 3TE4A 3W6XA 3W91A 5F48A 4KOUA 4NF1A 2FIAA 2FIWA 2VXKA 4CRYB 3R9FA 3D8PA 3LODA 3FYNA 1MK4A 4HKFA 2HV2A 3FNCA 2K5TA 2NMTA 4QVTA 2G3AA 4M85A 3F5BA 5GCNA 1Y7RA 4QBJA 1XE4A 2P6FA 4JWPA 3B8GA 2VQYA 1IICA 1IB1E 2ZW6A 1S60A 2CNTA 4KOYA 4MBUA 2FSRA 3TT2A 1M4DA 4HNWB 4X5KA 4ORFA 1PUAA 3TO9A 4KUBA 1U6MA 4H89A 1MJ9A 2JDCA 2OU2A 2PRBA 1WK4A 2ZW5A 4BMHA 2IL4A 5DWNA 2FE7A 4XPDC 2FT0A 1VKCA 3RYOA 4KLVA 1PU9A 3DDDA 3DNSA 4RS2A 4OAEA 1KUVA 4NXYA 2ZPAA 2PSWA 1M4IA 4MJ8A 5KTCA 5F47A 2VEZA 2ZW7A 4YGOA 3TFYA 1YVOA 2ZXVA 2BUEA 2AJ6A 1CJWA 3V8IA 1K4JA 3I3GA 1Z4EA 4FD5A 3WR7A 2ATRA 4AVAA 2PDOA 2GE3A 2G0BA 1I12A 1XIXA 3EO4A 4U9ZA 2H5MA 2B4DB 3PZJA 5CNPA 4JXQA 3ZJ0A 4OLLA 3R96A 4E8OA 4EVYA 2I79A 2DXQA 1YGHA 4AVBA 1KZFA 4CS0B 1I1DA 3DSBA 4JLYA 1NE9A 4XNHB 3TO7A 2FL4A 1RO5A 4PK2A 3JUWA 1YX0A 1QSTA 2REFA 4M3SA 2J8MA 1WWZA 4KZTA 3TCVA 1M44A 2CNMA 2ZW4A 1YR0A 2R8VA 1Z9UA 4F0YA 4OADA 3R9EA 3T90A 3GKRA 3C26A 4PV6A 1XEBA 2VZZA 5KTAA 3F0AA 2EVNA 1NMTA 2OB0A 2PQ8A 2EUIA 3R95A 1Z4RA 2Q7BA 3SXNA 2Z10A 4ONUA 3NE7A 2HUZA 4DNCA 2B5GA 2GANA 5JPHA 1P4NA 2B4DA 4JXRA 3W6SA 2JDDA 1P0HA 1L0CA 1XF8A 4J3GA 1V0CA 2D4PA 3ZZIA 4L8AA 1VHSA 3BLNA 2R7HA 2P6GA 3FXTA 1S7LA 3PP9A 5EC4A 4CAVA 4UWJA 3CXPA 2JEVA 2HQYA 4B5PA 1KUYA 2B3UA 4R87A 4HNXB 1YREA 1QSOA 1IYLA 3EXNA 4Y49B 2F5IA 1Q2YA 2J8RA 4MI4A 1QSRA 1S5KA 3I9SA 1SQHA 2R1IA 4FD6A 4KOVA 5HH1A 4QB9A 3S6KA 4XNHC 2PR8A 1S7FA 3K9UA 1RXTA 4KVME 5DWMA 2VZYA 1ON0A 2B5GB 2OZUA 1Q2DA 4KOXA 4CAWA 2PC1A 4IUSA 3T9YA 3D2PA 4L89A 1XMTA 4KOWA 4LX9A 3P2FA 3EC4A 2Q04A 3QB8A 4QUSA 3LD2A 4PK3A 1FY7A 5JQ4A 4KOSA 1YVKA 4KORA 2KCWA 3S6HA 3FIXA 3G3SA 2P0WA 2JLMA 2B58A 2OZHA 1IIDA 2BSWA 1NSLA 3TTHA 2VI7A 4ZBGA 4AB7A 5F46A 5H86A 4B5PB 4I49A 2I00A 1BO4A 5J8FA 1KUXA 4LUAA 4R9MA 4H6ZA 3JVNA 2WPXA 4UBRA 1N71A 3GY9A 5F49A 2X7BA 5IB0A 4NSQA 3N7ZA 3VWDA 4FD7A 1J4JA 2O28A 3SHPA 4GS4A 1M1DA 5HMNA 1M4GA 3FBUA 4KLWA 4XPLA 2J8NA 3FRMA 2Y0MA 2B4BA 2Q0YA 5C82A 4MY0A 3SXOA 5C88A 3EFAA 1QSMA 2ARHA 1MJBA 3MGDA 2FCKA 4AG7A 1Y9WA 4KVOE 3VWEA 3CXSA
chains in the Genus database with same CATH superfamily
4H2KA 4NGNA 2C6GA 2C6CA 5LYIA 3WC7A 3H5ZA 4P6YA 5IX3A 2WUUA 3NA6A 2YNCA 5AG7A 5AG5A 3H4QA 4P4FA 2Z3OA 1CP6A 3DR8A 4F8ZA 4H6UA 3D2MA 4II9A 2Q4VA 4AG9A 2ZEDA 4UEEA 4GM5A 4BBHA 4F9VA 4MHNA 2XEJA 5G21A 3PEIA 4YFJA 5KTDA 5FVJA 2B3VA 1LRZA 2Q51A 4P4JA 3WT4A 4UWIA 3P2HA 3PGPA 2CF4A 2PJ9A 2ZEFA 2AE6A 3NE8A 4R6TA 4AVCA 4OC5A 1XJOA 3EY5A 2Q43A 3R1KA 2QMLA 4E2AA 3IWGA 2XEFA 5IV0A 4JJXA 4B5OA 5E96A 4PSXA 4CYPA 5K8OA 3KKWA 4UA3A 2CIJA 5D8NA 1YLEA 2GIVA 3FEEA 4MFQA 4PXDA 2ZEGA 3FJUA 1IU8A 3K2KA 4MY3A 2GLFA 1PYTB 3BJ7A 4R3KA 2OZGA 4EMEA 2NSMA 2VBQA 2PCUA 2Q4ZA 3GYAA 3V38A 4OP4A 1TIQA 1ZG7A 1ZG9A 4NGMA 3FMCA 3IU1A 1ELMP 4KUAA 1VHOA 2HB6A 2XEIA 3DR6A 4MHZA 2R98A 4E0AA 4ONWA 3CXQA 3BJ8A 4NJRA 5H84A 3MRUA 1Q2CA 2NYQA 1Y7EA 1YK3A 1TKFA 2PJ2A 3LACA 1MJAA 1LCPA 3CDXA 4CYNA 1HEEA 2PJBA 4ZGYB 6CPAA 1ZO0A 2J9AA 2BEIA 4P45A 4UFVA 4F0XA 5A27A 1FNOA 5EBVA 3TX8A 4B12A 3E0KA 1IYKA 3KI9A 1S7NA 3B3WA 4U9YA 1HDUA 1VIXA 1F2OA 4JD6A 2QECA 3R9GA 1B87A 1UFHA 2WZNA 3GLJA 3D66A 3I1UA 2GLJA 4RI1A 2G3TA 4CRZB 3KR5A 4AXVA 1YSJA 4KSFA 3D3SA 5J8CA 2QIRA 1CM0A 4UEFA 3A9LA 4KVXA 2ODFA 3FB3A 4MHDA 3IWWA 1S7KA 2Z11A 7CPAA 2PJ7A 5CPAA 4F6AA 5LRGA 4XPKA 2CY2A 3GIUA 3QAHA 2PR1A 4JZ0A 1CPXA 2Z0ZA 1S3ZA 2Q44A 2QYVA 1JWQA 3QNVA 4IAVA 4PXEA 4A2ZA 4HNYB 5I0CA 1OZPA 2Z3KA 2PVVA 4PXCA 1R57A 3KASA 4ZX8A 1TF9A 4MXUA 2AFZA 3D68A 3B2YA 1Z5RA 4A94A 1ARLA 2O4HA 2Q4YA 4ZY0A 2FXFA 4XPDB 4A95A 4NCZA 3B7IA 2RC4A 4KOTA 2P6EA 3CPAA 4B6ZA 2EBJA 2D4OA 4U5YA 3OWCA 5LYDA 4F9UA 3TC8A 4CPAA 2C27A 3PRTA 3TOBA 1F2PA 2ANPA 2BL1A 1Y0YA 4OIWA 2BOAA 3G8WA 4IF5A 2FS5A 4R57A 2PRQA 1YLOA 5THWA 4MCRA 4PSWA 4NEXA 4K30A 5LRJA 2PJ4A 4FD4A 4OC2A 3S9NA 1Y9KA 1BLLE 3TO6A 4A37A 4YRHA 2REEA 4MCPA 2WPWA 1QSNA 8CPAA 1I21A 2CTCA 4QC6A 2Z3LA 3RAMA 3F8KA 1TKHA 3S6FA 3V7ZA 3S6GA 1B6BA 3TOAA 3IGRA 5HVGA 2OH1A 4CAXA 3IFEA 1GHEA 1PCAA 3IJ3A 4LQ6A 4Y49C 4C2ZA 1OBRA 4EFDA 4Q7AA 2CNSA 5ISVA 2A4NA 4A38A 3CPXA 4R3LA 4WWVA 3UY5A 1BOBA 3TE4A 3SI1A 3W6XA 3W91A 5F48A 2AFOA 1M4LA 4KOUA 4NF1A 2FIAA 2FIWA 4UIBA 1JQGA 4ZY1A 4KS9A 1LAPA 5K8MA 2AFUA 4B10A 4Z65A 2VXKA 5ELYA 4CRYB 2ZEPA 3R9FA 2V8VA 3D8PA 3RNZA 4BD9A 5LYLA 1QQ9A 2WYRA 4P4IA 3LODA 1XOVA 3H8GA 2PE3A 3FYNA 1MK4A 4MMOA 4PXBA 4HKFA 2HV2A 3FNCA 2K5TA 4DYOA 4TNUA 1F57A 1X12A 2NMTA 1X10A 2ABZA 1XRYA 4PPZA 4QVTA 4Q38A 3KR4A 2G3AA 4M85A 4CAEA 1Y0RA 3F5BA 4P4EA 5GCNA 1Y7RA 2JBJA 2ZENA 4QBJA 1XE4A 2GU2A 2P6FA 3KQZA 4JWPA 4Q36A 3B8GA 2VQYA 4MHYA 2PIYA 4IHMA 5DS0A 3WABA 5CBMA 1IICA 1IB1E 3SI2A 3SJFA 3NH5A 3SJGA 2ZW6A 2BO9A 1S60A 2I3CA 1YMEA 4FBEA 2CNTA 4KOYA 5J1QA 3MN8A 2FSRA 4MBUA 2RB7A 3TT2A 2YNCC 1M4DA 4HNWB 4OC1A 4ORFA 1PUAA 4X5KA 3TO9A 4KUBA 1U6MA 5EMIA 4H89A 3KL9A 3LWUA 4NGRA 1MJ9A 5JGFA 2JDCA 4CYQA 2OU2A 2PRBA 1WK4A 2ZW5A 4BMHA 2IL4A 4P4BA 5DWNA 2FE7A 4MFZA 1AMPA 3PB9X 4XPDC 2FT0A 1VKCA 3RYOA 4KLVA 4UFWA 1PU9A 3DDDA 3DNSA 3K9TA 2EK9A 3JTKA 4OAEA 1LFWA 4RS2A 1Z8WA 2CXAA 1KUVA 4NXYA 2ZPAA 2PSWA 3B3CA 1XBUA 1M4IA 4MJ8A 1RTQA 4P10A 5AGEA 2ZEMA 5KTCA 5F47A 3B3VA 2VEZA 2ZW7A 3D4UA 3FVLA 2PJ1A 3H8FA 4YGOA 4CGMA 3TFYA 3BHXA 1YVOA 2ZXVA 2BUEA 4TWEA 2AJ6A 1CJWA 3V8IA 1K4JA 4UCPA 3B35A 3BI0A 3I3GA 3SI0A 1Z4EA 4FD5A 3WR7A 2ATRA 4O23A 2DPSA 2IQ6A 3BI1A 4G1PA 1A2ZA 4MCSA 1NSAA 4AVAA 2PDOA 2GE3A 2ZEHA 2G0BA 4P4DA 1I12A 1YW4A 1XIXA 1IOFA 2PJCA 4CYOA 4UCMA 3EO4A 3RBUA 2F8HA 3DGVA 4U9ZA 2H5MA 2B4DB 2ZOGA 4C2XA 3PZJA 5CNPA 4ZY2A 4JXQA 1IOIA 3ZJ0A 2C1CA 4OLLA 4MFLA 4DJLA 3R96A 3FEDA 3D7FA 4E8OA 4EWTA 4EVYA 4JYWA 2I79A 1UWYA 2DXQA 4W9YA 1YGHA 5HVFA 4ZX9A 3PB8X 3QAYA 3HLPA 4AVBA 5LYFA 1KZFA 4CS0B 4K3NA 4B13A 1ZLIA 4ZYQA 3ISZA 5BWAB 1I1DA 3DSBA 4JLYA 4YU9A 2YGWA 1CX8A 1NE9A 5G1ZA 3PBBA 1BPNA 4XNHB 3TO7A 2PJ3A 3S9LA 2FL4A 4RUHA 1RO5A 4PK2A 4NGPA 3JUWA 1YX0A 3IU2A 1QSTA 2REFA 1R3NA 1ZLHA 2V8GA 4M3SA 2J8MA 5HXDA 1WWZA 4KZTA 3TCVA 1M44A 2CNMA 3L2NA 2ZW4A 5A28A 1YR0A 2PJAA 2R8VA 1H8LA 2AFXA 1Z9UA 4F0YA 2ZELA 5I4MA 1TXRA 1LAMA 4OADA 4OC0A 3R9EA 1VGYA 3JRUA 2OOTA 3T90A 5IB9A 3GKRA 3C26A 4PV6A 1XEBA 3KZWA 2VZZA 5KTAA 1KWMA 3S9MA 3F0AA 2EVNA 1NMTA 2VL1A 2AFMA 3PB6X 2ZEOA 4IK2A 2OB0A 2ZEEA 2PQ8A 1ARMA 2EUIA 4GXHA 4NGSA 3R95A 1Z4RA 2Q7BA 3SXNA 2Z10A 3WC6A 3FF3A 3D7DA 5K8PA 3HUVA 1Z8TA 4ONUA 3NE7A 2AFWA 2HUZA 4OC3A 4CAFA 3IO1A 4DNCA 2B5GA 2BCOA 3GB0A 2Z3PA 2GANA 4A31A 5JPHA 1P4NA 4X2TA 3DLJA 2YNEA 1BPMA 1YW6A 2CTBA 2B4DA 4R76A 4JXRA 1CG2A 5JM6A 3W6SA 2JDDA 2JBKA 1P0HA 2EO8A 3SJEA 4UF4A 1L0CA 4B11A 1QMUA 5LRKA 3KGQA 4CGPA 1XF8A 3RO0A 4J3GA 1V0CA 2D4PA 3ZZIA 4CGOA 2PJ0A 4L8AA 1VHSA 3BLNA 3CT9A 5G22A 2R7HA 4NGQA 4FAIA 4PQAA 4MFJA 2P6GA 4P44A 2POKA 3FX6A 3FXTA 1S7LA 2V8HA 4MFKA 3PP9A 4MRIA 3NFZA 5EC4A 3H8EA 4CAVA 2C6PA 2PJ6A 3NH4A 4KSAA 4UFXA 4UWJA 3CXPA 4M6GA 2Z3NA 4A30A 1ELLP 2JEVA 4LQGA 1XMBA 1DE4C 2HQYA 4B5PA 2IMOA 1LOKA 2G9DA 2V77A 1KUYA 2B3UA 4R87A 2IJZA 4HNXB 3N5FA 1YREA 3VATA 1QSOA 1IYLA 2HC9A 3EXNA 4Y49B 5G20A 3ISXA 2F5IA 1Q7LA 1Q2YA 1AYEA 2J8RA 3IEHA 3KHZA 4MI4A 4NGTA 2Z3MA 5AG6A 3PB7X 1QSRA 1TF8A 4X8IA 1S5KA 3I9SA 2ZOFA 3GUXA 4OKOA 1SQHA 2R1IA 4FD6A 4KOVA 5HH1A 4A39A 4QB9A 3B3SA 4FUUA 4FWUA 4M6IA 3S6KA 3VARA 4C7IA 3FECA 2PR8A 4R7MA 4XNHC 1S7FA 3K9UA 3D7HA 3PFEA 1RXTA 2JEWA 4OC4A 4WJBA 4KVME 5DWMA 4DUKA 2VZYA 1ON0A 2B5GB 2XEGA 5HVHA 2OZUA 5JH9A 3D7GA 1Q2DA 2QVPA 4KOXA 4CAWA 3RZAA 2PC1A 4OIDA 4IUSA 3T9YA 2FVGA 3D2PA 1TKJA 4L89A 4UIAA 1XMTA 2WSAA 2DEAA 1Z8XA 4KOWA 2GREA 3P2FA 4LX9A 3EC4A 4RN7A 2AFSA 2YNDA 4UEZA 2Q04A 3QB8A 5AG4A 2O53A 1CPSA 4MCQA 4MHPA 4QUSA 3WC5A 4MFPA 1HDQA 3LD2A 4PK3A 1DTDA 1FY7A 5JQ4A 1IY7A 4ZI6A 3KHXA 1VHEA 4B14A 4KOSA 1YVKA 1ZG8A 4KORA 2KCWA 2V8DA 4UCNA 3S6HA 3FIXA 2P0WA 3G3SA 2JLMA 1R43A 1BAVA 2B58A 2OZHA 1IIDA 4R8FA 2BSWA 1IGBA 2QJ8A 4CGNA 3PB4X 1NSLA 3TTHA 2VI7A 4ZBGA 4AB7A 4A32A 3B3TA 5F46A 5D29A 4M6HA 5H86A 4B5PB 2DF5A 1GYTA 4I49A 5F09A 2OR4A 4X3RA 2I00A 1BO4A 2PVWA 5J8FA 1CP7A 3BXMA 3NH8A 1KUXA 3LMSA 3CZXA 2EK8A 4LUAA 2PJ8A 4R9MA 4H6ZA 3JVNA 2WPXA 4UBRA 1N71A 3GY9A 5K8NA 5F49A 2X7BA 5IB0A 2RFHA 2DPTA 4NSQA 1EE3P 4HPSA 3N7ZA 3VWDA 4FD7A 4CGLA 1J4JA 3IWEA 4BINA 2O28A 3SHPA 4GS4A 1M1DA 1YQEA 1Z2LA 2GFQA 3D67A 4OMEA 4C68A 3T8WA 5HMNA 1M4GA 3FBUA 3PBEA 4KLWA 4NJQA 4XPLA 2J8NA 2Q7SA 3FRMA 2Y0MA 2B4BA 2Q0YA 3KQXA 5C82A 4KSIA 4MY0A 3SJXA 3IIBA 3SXOA 4C7HA 1Z8LA 5C88A 3EFAA 4C2YA 1QSMA 1FT7A 1AUGA 4NFRA 3VH9A 1LANA 2ARHA 1MJBA 3IC1A 2F7VA 3MGDA 2EWBA 1XFOA 1CBXA 2FCKA 3PFOA 4AG7A 1Y9WA 2PJ5A 3FH4A 4KVOE 4A33A 3VWEA 4YWYA 3CXSA 2PIZA
chains in the Genus database with same CATH topology
5IX3A 3H5ZA 2WUUA 5AG7A 2YNCA 5AG5A 3H4QA 2Z3OA 3DR8A 4H6UA 3D2MA 4II9A 2Q4VA 4AG9A 4BBHA 5G21A 4YFJA 5KTDA 5FVJA 2B3VA 1LRZA 4UWIA 3P2HA 3PGPA 2AE6A 4AVCA 3EY5A 3R1KA 2QMLA 4E2AA 3IWGA 5IV0A 4JJXA 4B5OA 5E96A 4PSXA 4CYPA 3KKWA 4UA3A 1YLEA 2GIVA 4MFQA 4MY3A 3BJ7A 4R3KA 2OZGA 2VBQA 3GYAA 1TIQA 3IU1A 4KUAA 4E0AA 3DR6A 2R98A 3CXQA 3BJ8A 5H84A 1Q2CA 1YK3A 1MJAA 4CYNA 4ZGYB 1ZO0A 4UFVA 2BEIA 5A27A 4F0XA 5EBVA 4B12A 3E0KA 1IYKA 1S7NA 4U9YA 4JD6A 2QECA 3R9GA 1B87A 1UFHA 4RI1A 2G3TA 4CRZB 4KSFA 3D3SA 5J8CA 2QIRA 1CM0A 3A9LA 4KVXA 3FB3A 4MHDA 1S7KA 2Z11A 4F6AA 4XPKA 2CY2A 3QAHA 2PR1A 2Z0ZA 1S3ZA 2Q44A 4A2ZA 4HNYB 5I0CA 1OZPA 2Z3KA 1R57A 2Q4YA 2FXFA 4XPDB 4A95A 4NCZA 4KOTA 2RC4A 2P6EA 2D4OA 4U5YA 3OWCA 2C27A 3TOBA 2BL1A 3G8WA 4IF5A 2FS5A 4R57A 4PSWA 4NEXA 4K30A 4FD4A 1Y9KA 3TO6A 4YRHA 2REEA 2WPWA 1QSNA 1I21A 4QC6A 2Z3LA 3F8KA 3S6FA 3S6GA 1B6BA 3TOAA 3IGRA 2OH1A 4CAXA 1GHEA 4Y49C 4C2ZA 2CNSA 5ISVA 2A4NA 4R3LA 3UY5A 1BOBA 3TE4A 3W6XA 3W91A 5F48A 4KOUA 4NF1A 2FIAA 2FIWA 4KS9A 4B10A 2VXKA 4CRYB 3R9FA 3D8PA 3LODA 3FYNA 1MK4A 4HKFA 2HV2A 3FNCA 2K5TA 2NMTA 4QVTA 4Q38A 2G3AA 4M85A 4CAEA 3F5BA 5GCNA 1Y7RA 4QBJA 1XE4A 2P6FA 4JWPA 4Q36A 3B8GA 2VQYA 1IICA 1IB1E 2ZW6A 1S60A 2CNTA 4KOYA 4MBUA 2FSRA 3TT2A 2YNCC 1M4DA 4HNWB 4X5KA 4ORFA 1PUAA 3TO9A 4KUBA 1U6MA 4H89A 1MJ9A 2JDCA 4CYQA 2OU2A 2PRBA 1WK4A 2ZW5A 4BMHA 2IL4A 5DWNA 2FE7A 4MFZA 4XPDC 2FT0A 1VKCA 3RYOA 4KLVA 4UFWA 1PU9A 3DDDA 3DNSA 3JTKA 4OAEA 4RS2A 2CXAA 1KUVA 4NXYA 2ZPAA 2PSWA 1M4IA 4MJ8A 5AGEA 5KTCA 5F47A 4CGMA 2VEZA 2ZW7A 4YGOA 3TFYA 1YVOA 2ZXVA 2BUEA 2AJ6A 1CJWA 3V8IA 1K4JA 4UCPA 3I3GA 1Z4EA 4FD5A 3WR7A 2ATRA 2DPSA 4AVAA 2PDOA 2GE3A 2G0BA 1I12A 1XIXA 4CYOA 4UCMA 3EO4A 4U9ZA 2H5MA 2B4DB 4C2XA 3PZJA 5CNPA 4JXQA 3ZJ0A 4OLLA 4MFLA 3R96A 4E8OA 4EVYA 2I79A 2DXQA 1YGHA 4AVBA 1KZFA 4CS0B 4B13A 5BWAB 1I1DA 3DSBA 4JLYA 2YGWA 5G1ZA 1NE9A 4XNHB 3TO7A 2FL4A 1RO5A 4PK2A 3JUWA 1YX0A 3IU2A 1QSTA 2REFA 4M3SA 2J8MA 1WWZA 4KZTA 3TCVA 1M44A 2CNMA 2ZW4A 5A28A 1YR0A 2R8VA 1Z9UA 4F0YA 4OADA 3R9EA 3T90A 3GKRA 3C26A 4PV6A 1XEBA 2VZZA 5KTAA 3F0AA 2EVNA 1NMTA 2OB0A 2PQ8A 2EUIA 3R95A 1Z4RA 2Q7BA 3SXNA 2Z10A 4ONUA 3NE7A 4CAFA 2HUZA 4DNCA 2B5GA 2Z3PA 2GANA 4A31A 5JPHA 1P4NA 2YNEA 2B4DA 4JXRA 3W6SA 2JDDA 1P0HA 1L0CA 4B11A 4CGPA 1XF8A 4J3GA 1V0CA 2D4PA 3ZZIA 4CGOA 4L8AA 1VHSA 3BLNA 5G22A 2R7HA 4MFJA 2P6GA 3FXTA 1S7LA 4MFKA 3PP9A 5EC4A 4CAVA 4KSAA 4UFXA 4UWJA 3CXPA 2Z3NA 4A30A 2JEVA 2HQYA 4B5PA 1KUYA 2B3UA 4R87A 4HNXB 1YREA 1QSOA 1IYLA 3EXNA 4Y49B 5G20A 2F5IA 1Q2YA 2J8RA 4MI4A 2Z3MA 5AG6A 1QSRA 1S5KA 3I9SA 1SQHA 2R1IA 4FD6A 4KOVA 5HH1A 4QB9A 3S6KA 4C7IA 4XNHC 2PR8A 1S7FA 3K9UA 1RXTA 4KVME 5DWMA 2VZYA 1ON0A 2B5GB 2OZUA 1Q2DA 4KOXA 4CAWA 2PC1A 4IUSA 3T9YA 3D2PA 4L89A 1XMTA 2WSAA 4KOWA 4LX9A 3P2FA 3EC4A 2YNDA 2Q04A 3QB8A 5AG4A 4QUSA 4MFPA 3LD2A 4PK3A 1FY7A 5JQ4A 4B14A 4KOSA 1YVKA 4KORA 2KCWA 4UCNA 3S6HA 3FIXA 3G3SA 2P0WA 2JLMA 2B58A 2OZHA 1IIDA 2BSWA 4CGNA 1NSLA 3TTHA 2VI7A 4ZBGA 4AB7A 4A32A 5F46A 5H86A 4B5PB 4I49A 2I00A 1BO4A 5J8FA 1KUXA 4LUAA 4R9MA 4H6ZA 3JVNA 2WPXA 4UBRA 1N71A 3GY9A 5F49A 2X7BA 5IB0A 2DPTA 4NSQA 3N7ZA 3VWDA 4FD7A 4CGLA 1J4JA 3IWEA 2O28A 3SHPA 4GS4A 1M1DA 4C68A 5HMNA 1M4GA 3FBUA 4KLWA 4XPLA 2J8NA 3FRMA 2Y0MA 2B4BA 2Q0YA 5C82A 4MY0A 3SXOA 4C7HA 5C88A 3EFAA 4C2YA 1QSMA 2ARHA 1MJBA 3MGDA 2FCKA 4AG7A 1Y9WA 4A33A 4KVOE 3VWEA 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IX3 A;  3H4Q A;  3DR8 A;  4H6U A;  3D2M A;  4II9 A;  2Q4V A;  4AG9 A;  4YFJ A;  5KTD A;  5FVJ A;  2B3V A;  1LRZ A;  4UWI A;  3P2H A;  3PGP A;  2AE6 A;  4AVC A;  3EY5 A;  3R1K A;  2QML A;  4E2A A;  3IWG A;  5IV0 A;  4JJX A;  4B5O A;  5E96 A;  4PSX A;  3KKW A;  4UA3 A;  1YLE A;  2GIV A;  4MY3 A;  3BJ7 A;  4R3K A;  2OZG A;  2VBQ A;  3GYA A;  1TIQ A;  4KUA A;  4E0A A;  3DR6 A;  2R98 A;  3CXQ A;  3BJ8 A;  5H84 A;  1Q2C A;  1YK3 A;  1MJA A;  2BEI A;  5EBV A;  3E0K A;  1IYK A;  1S7N A;  4U9Y A;  4JD6 A;  2QEC A;  3R9G A;  1B87 A;  1UFH A;  4RI1 A;  2G3T A;  4CRZ B;  3D3S A;  5J8C A;  2QIR A;  1CM0 A;  4KVX A;  3FB3 A;  4MHD A;  1S7K A;  2Z11 A;  4F6A A;  4XPK A;  2CY2 A;  3QAH A;  2PR1 A;  2Z0Z A;  1S3Z A;  2Q44 A;  4HNY B;  5I0C A;  1OZP A;  1R57 A;  2Q4Y A;  2FXF A;  4XPD B;  4NCZ A;  4KOT A;  2RC4 A;  2P6E A;  2D4O A;  4U5Y A;  3OWC A;  2C27 A;  3TOB A;  2BL1 A;  3G8W A;  4IF5 A;  2FS5 A;  4R57 A;  4PSW A;  4NEX A;  4K30 A;  4FD4 A;  1Y9K A;  3TO6 A;  4YRH A;  2REE A;  2WPW A;  1QSN A;  1I21 A;  4QC6 A;  3F8K A;  3S6F A;  3S6G A;  1B6B A;  3TOA A;  3IGR A;  2OH1 A;  4CAX A;  1GHE A;  4Y49 C;  2CNS A;  5ISV A;  2A4N A;  4R3L A;  3UY5 A;  1BOB A;  3TE4 A;  3W6X A;  3W91 A;  5F48 A;  4KOU A;  4NF1 A;  2FIA A;  2FIW A;  2VXK A;  4CRY B;  3R9F A;  3D8P A;  3LOD A;  3FYN A;  1MK4 A;  4HKF A;  2HV2 A;  3FNC A;  2K5T A;  2NMT A;  4QVT A;  2G3A A;  4M85 A;  3F5B A;  5GCN A;  1Y7R A;  4QBJ A;  1XE4 A;  2P6F A;  4JWP A;  3B8G A;  2VQY A;  1IIC A;  1IB1 E;  2ZW6 A;  1S60 A;  2CNT A;  4KOY A;  4MBU A;  2FSR A;  3TT2 A;  1M4D A;  4HNW B;  4X5K A;  4ORF A;  1PUA A;  3TO9 A;  4KUB A;  1U6M A;  4H89 A;  1MJ9 A;  2JDC A;  2OU2 A;  2PRB A;  1WK4 A;  2ZW5 A;  4BMH A;  2IL4 A;  5DWN A;  2FE7 A;  4XPD C;  2FT0 A;  1VKC A;  3RYO A;  4KLV A;  1PU9 A;  3DDD A;  3DNS A;  4RS2 A;  4OAE A;  1KUV A;  4NXY A;  2ZPA A;  2PSW A;  1M4I A;  4MJ8 A;  5KTC A;  5F47 A;  2VEZ A;  2ZW7 A;  4YGO A;  3TFY A;  1YVO A;  2ZXV A;  2BUE A;  2AJ6 A;  1CJW A;  3V8I A;  1K4J A;  3I3G A;  1Z4E A;  4FD5 A;  3WR7 A;  2ATR A;  4AVA A;  2PDO A;  2GE3 A;  2G0B A;  1I12 A;  1XIX A;  3EO4 A;  4U9Z A;  2H5M A;  2B4D B;  3PZJ A;  5CNP A;  4JXQ A;  3ZJ0 A;  4OLL A;  3R96 A;  4E8O A;  4EVY A;  2I79 A;  2DXQ A;  1YGH A;  4AVB A;  1KZF A;  4CS0 B;  1I1D A;  3DSB A;  4JLY A;  1NE9 A;  4XNH B;  3TO7 A;  2FL4 A;  1RO5 A;  4PK2 A;  3JUW A;  1YX0 A;  1QST A;  2REF A;  4M3S A;  2J8M A;  1WWZ A;  4KZT A;  3TCV A;  1M44 A;  2CNM A;  2ZW4 A;  1YR0 A;  2R8V A;  1Z9U A;  4F0Y A;  4OAD A;  3R9E A;  3T90 A;  3GKR A;  3C26 A;  4PV6 A;  1XEB A;  2VZZ A;  5KTA A;  3F0A A;  2EVN A;  1NMT A;  2OB0 A;  2PQ8 A;  2EUI A;  3R95 A;  1Z4R A;  2Q7B A;  3SXN A;  2Z10 A;  4ONU A;  3NE7 A;  2HUZ A;  4DNC A;  2B5G A;  2GAN A;  5JPH A;  1P4N A;  2B4D A;  4JXR A;  3W6S A;  2JDD A;  1P0H A;  1L0C A;  1XF8 A;  4J3G A;  1V0C A;  2D4P A;  3ZZI A;  4L8A A;  1VHS A;  3BLN A;  2R7H A;  2P6G A;  3FXT A;  1S7L A;  3PP9 A;  5EC4 A;  4CAV A;  4UWJ A;  3CXP A;  2JEV A;  2HQY A;  4B5P A;  1KUY A;  2B3U A;  4R87 A;  4HNX B;  1YRE A;  1QSO A;  1IYL A;  3EXN A;  4Y49 B;  2F5I A;  1Q2Y A;  2J8R A;  4MI4 A;  1QSR A;  1S5K A;  3I9S A;  1SQH A;  2R1I A;  4FD6 A;  4KOV A;  5HH1 A;  4QB9 A;  3S6K A;  4XNH C;  2PR8 A;  1S7F A;  3K9U A;  1RXT A;  4KVM E;  5DWM A;  2VZY A;  1ON0 A;  2B5G B;  2OZU A;  1Q2D A;  4KOX A;  4CAW A;  2PC1 A;  4IUS A;  3T9Y A;  3D2P A;  4L89 A;  1XMT A;  4KOW A;  4LX9 A;  3P2F A;  3EC4 A;  2Q04 A;  3QB8 A;  4QUS A;  3LD2 A;  4PK3 A;  1FY7 A;  5JQ4 A;  4KOS A;  1YVK A;  4KOR A;  2KCW A;  3S6H A;  3FIX A;  3G3S A;  2P0W A;  2JLM A;  2B58 A;  2OZH A;  1IID A;  2BSW A;  1NSL A;  3TTH A;  2VI7 A;  4ZBG A;  4AB7 A;  5F46 A;  5H86 A;  4B5P B;  4I49 A;  2I00 A;  1BO4 A;  5J8F A;  1KUX A;  4LUA A;  4R9M A;  4H6Z A;  3JVN A;  2WPX A;  4UBR A;  1N71 A;  3GY9 A;  5F49 A;  2X7B A;  5IB0 A;  4NSQ A;  3N7Z A;  3VWD A;  4FD7 A;  1J4J A;  2O28 A;  3SHP A;  4GS4 A;  1M1D A;  5HMN A;  1M4G A;  3FBU A;  4KLW A;  4XPL A;  2J8N A;  3FRM A;  2Y0M A;  2B4B A;  2Q0Y A;  5C82 A;  4MY0 A;  3SXO A;  5C88 A;  3EFA A;  1QSM A;  2ARH A;  1MJB A;  3MGD A;  2FCK A;  4AG7 A;  1Y9W A;  4KVO E;  3VWE A;  3CXS A; 
#chains in the Genus database with same CATH topology
 4H2K A;  4NGN A;  2C6G A;  2C6C A;  5LYI A;  3WC7 A;  3H5Z A;  4P6Y A;  5IX3 A;  2WUU A;  3NA6 A;  2YNC A;  5AG7 A;  5AG5 A;  3H4Q A;  4P4F A;  2Z3O A;  1CP6 A;  3DR8 A;  4F8Z A;  4H6U A;  3D2M A;  4II9 A;  2Q4V A;  4AG9 A;  2ZED A;  4UEE A;  4GM5 A;  4BBH A;  4F9V A;  4MHN A;  2XEJ A;  5G21 A;  3PEI A;  4YFJ A;  5KTD A;  5FVJ A;  2B3V A;  1LRZ A;  2Q51 A;  4P4J A;  3WT4 A;  4UWI A;  3P2H A;  3PGP A;  2CF4 A;  2PJ9 A;  2ZEF A;  2AE6 A;  3NE8 A;  4R6T A;  4AVC A;  4OC5 A;  1XJO A;  3EY5 A;  2Q43 A;  3R1K A;  2QML A;  4E2A A;  3IWG A;  2XEF A;  5IV0 A;  4JJX A;  4B5O A;  5E96 A;  4PSX A;  4CYP A;  5K8O A;  3KKW A;  4UA3 A;  2CIJ A;  5D8N A;  1YLE A;  2GIV A;  3FEE A;  4MFQ A;  4PXD A;  2ZEG A;  3FJU A;  1IU8 A;  3K2K A;  4MY3 A;  2GLF A;  1PYT B;  3BJ7 A;  4R3K A;  2OZG A;  4EME A;  2NSM A;  2VBQ A;  2PCU A;  2Q4Z A;  3GYA A;  3V38 A;  4OP4 A;  1TIQ A;  1ZG7 A;  1ZG9 A;  4NGM A;  3FMC A;  3IU1 A;  1ELM P;  4KUA A;  1VHO A;  2HB6 A;  2XEI A;  3DR6 A;  4MHZ A;  2R98 A;  4E0A A;  4ONW A;  3CXQ A;  3BJ8 A;  4NJR A;  5H84 A;  3MRU A;  1Q2C A;  2NYQ A;  1Y7E A;  1YK3 A;  1TKF A;  2PJ2 A;  3LAC A;  1MJA A;  1LCP A;  3CDX A;  4CYN A;  1HEE A;  2PJB A;  4ZGY B;  6CPA A;  1ZO0 A;  2J9A A;  2BEI A;  4P45 A;  4UFV A;  4F0X A;  5A27 A;  1FNO A;  5EBV A;  3TX8 A;  4B12 A;  3E0K A;  1IYK A;  3KI9 A;  1S7N A;  3B3W A;  4U9Y A;  1HDU A;  1VIX A;  1F2O A;  4JD6 A;  2QEC A;  3R9G A;  1B87 A;  1UFH A;  2WZN A;  3GLJ A;  3D66 A;  3I1U A;  2GLJ A;  4RI1 A;  2G3T A;  4CRZ B;  3KR5 A;  4AXV A;  1YSJ A;  4KSF A;  3D3S A;  5J8C A;  2QIR A;  1CM0 A;  4UEF A;  3A9L A;  4KVX A;  2ODF A;  3FB3 A;  4MHD A;  3IWW A;  1S7K A;  2Z11 A;  7CPA A;  2PJ7 A;  5CPA A;  4F6A A;  5LRG A;  4XPK A;  2CY2 A;  3GIU A;  3QAH A;  2PR1 A;  4JZ0 A;  1CPX A;  2Z0Z A;  1S3Z A;  2Q44 A;  2QYV A;  1JWQ A;  3QNV A;  4IAV A;  4PXE A;  4A2Z A;  4HNY B;  5I0C A;  1OZP A;  2Z3K A;  2PVV A;  4PXC A;  1R57 A;  3KAS A;  4ZX8 A;  1TF9 A;  4MXU A;  2AFZ A;  3D68 A;  3B2Y A;  1Z5R A;  4A94 A;  1ARL A;  2O4H A;  2Q4Y A;  4ZY0 A;  2FXF A;  4XPD B;  4A95 A;  4NCZ A;  3B7I A;  2RC4 A;  4KOT A;  2P6E A;  3CPA A;  4B6Z A;  2EBJ A;  2D4O A;  4U5Y A;  3OWC A;  5LYD A;  4F9U A;  3TC8 A;  4CPA A;  2C27 A;  3PRT A;  3TOB A;  1F2P A;  2ANP A;  2BL1 A;  1Y0Y A;  4OIW A;  2BOA A;  3G8W A;  4IF5 A;  2FS5 A;  4R57 A;  2PRQ A;  1YLO A;  5THW A;  4MCR A;  4PSW A;  4NEX A;  4K30 A;  5LRJ A;  2PJ4 A;  4FD4 A;  4OC2 A;  3S9N A;  1Y9K A;  1BLL E;  3TO6 A;  4A37 A;  4YRH A;  2REE A;  4MCP A;  2WPW A;  1QSN A;  8CPA A;  1I21 A;  2CTC A;  4QC6 A;  2Z3L A;  3RAM A;  3F8K A;  1TKH A;  3S6F A;  3V7Z A;  3S6G A;  1B6B A;  3TOA A;  3IGR A;  5HVG A;  2OH1 A;  4CAX A;  3IFE A;  1GHE A;  1PCA A;  3IJ3 A;  4LQ6 A;  4Y49 C;  4C2Z A;  1OBR A;  4EFD A;  4Q7A A;  2CNS A;  5ISV A;  2A4N A;  4A38 A;  3CPX A;  4R3L A;  4WWV A;  3UY5 A;  1BOB A;  3TE4 A;  3SI1 A;  3W6X A;  3W91 A;  5F48 A;  2AFO A;  1M4L A;  4KOU A;  4NF1 A;  2FIA A;  2FIW A;  4UIB A;  1JQG A;  4ZY1 A;  4KS9 A;  1LAP A;  5K8M A;  2AFU A;  4B10 A;  4Z65 A;  2VXK A;  5ELY A;  4CRY B;  2ZEP A;  3R9F A;  2V8V A;  3D8P A;  3RNZ A;  4BD9 A;  5LYL A;  1QQ9 A;  2WYR A;  4P4I A;  3LOD A;  1XOV A;  3H8G A;  2PE3 A;  3FYN A;  1MK4 A;  4MMO A;  4PXB A;  4HKF A;  2HV2 A;  3FNC A;  2K5T A;  4DYO A;  4TNU A;  1F57 A;  1X12 A;  2NMT A;  1X10 A;  2ABZ A;  1XRY A;  4PPZ A;  4QVT A;  4Q38 A;  3KR4 A;  2G3A A;  4M85 A;  4CAE A;  1Y0R A;  3F5B A;  4P4E A;  5GCN A;  1Y7R A;  2JBJ A;  2ZEN A;  4QBJ A;  1XE4 A;  2GU2 A;  2P6F A;  3KQZ A;  4JWP A;  4Q36 A;  3B8G A;  2VQY A;  4MHY A;  2PIY A;  4IHM A;  5DS0 A;  3WAB A;  5CBM A;  1IIC A;  1IB1 E;  3SI2 A;  3SJF A;  3NH5 A;  3SJG A;  2ZW6 A;  2BO9 A;  1S60 A;  2I3C A;  1YME A;  4FBE A;  2CNT A;  4KOY A;  5J1Q A;  3MN8 A;  2FSR A;  4MBU A;  2RB7 A;  3TT2 A;  2YNC C;  1M4D A;  4HNW B;  4OC1 A;  4ORF A;  1PUA A;  4X5K A;  3TO9 A;  4KUB A;  1U6M A;  5EMI A;  4H89 A;  3KL9 A;  3LWU A;  4NGR A;  1MJ9 A;  5JGF A;  2JDC A;  4CYQ A;  2OU2 A;  2PRB A;  1WK4 A;  2ZW5 A;  4BMH A;  2IL4 A;  4P4B A;  5DWN A;  2FE7 A;  4MFZ A;  1AMP A;  3PB9 X;  4XPD C;  2FT0 A;  1VKC A;  3RYO A;  4KLV A;  4UFW A;  1PU9 A;  3DDD A;  3DNS A;  3K9T A;  2EK9 A;  3JTK A;  4OAE A;  1LFW A;  4RS2 A;  1Z8W A;  2CXA A;  1KUV A;  4NXY A;  2ZPA A;  2PSW A;  3B3C A;  1XBU A;  1M4I A;  4MJ8 A;  1RTQ A;  4P10 A;  5AGE A;  2ZEM A;  5KTC A;  5F47 A;  3B3V A;  2VEZ A;  2ZW7 A;  3D4U A;  3FVL A;  2PJ1 A;  3H8F A;  4YGO A;  4CGM A;  3TFY A;  3BHX A;  1YVO A;  2ZXV A;  2BUE A;  4TWE A;  2AJ6 A;  1CJW A;  3V8I A;  1K4J A;  4UCP A;  3B35 A;  3BI0 A;  3I3G A;  3SI0 A;  1Z4E A;  4FD5 A;  3WR7 A;  2ATR A;  4O23 A;  2DPS A;  2IQ6 A;  3BI1 A;  4G1P A;  1A2Z A;  4MCS A;  1NSA A;  4AVA A;  2PDO A;  2GE3 A;  2ZEH A;  2G0B A;  4P4D A;  1I12 A;  1YW4 A;  1XIX A;  1IOF A;  2PJC A;  4CYO A;  4UCM A;  3EO4 A;  3RBU A;  2F8H A;  3DGV A;  4U9Z A;  2H5M A;  2B4D B;  2ZOG A;  4C2X A;  3PZJ A;  5CNP A;  4ZY2 A;  4JXQ A;  1IOI A;  3ZJ0 A;  2C1C A;  4OLL A;  4MFL A;  4DJL A;  3R96 A;  3FED A;  3D7F A;  4E8O A;  4EWT A;  4EVY A;  4JYW A;  2I79 A;  1UWY A;  2DXQ A;  4W9Y A;  1YGH A;  5HVF A;  4ZX9 A;  3PB8 X;  3QAY A;  3HLP A;  4AVB A;  5LYF A;  1KZF A;  4CS0 B;  4K3N A;  4B13 A;  1ZLI A;  4ZYQ A;  3ISZ A;  5BWA B;  1I1D A;  3DSB A;  4JLY A;  4YU9 A;  2YGW A;  1CX8 A;  1NE9 A;  5G1Z A;  3PBB A;  1BPN A;  4XNH B;  3TO7 A;  2PJ3 A;  3S9L A;  2FL4 A;  4RUH A;  1RO5 A;  4PK2 A;  4NGP A;  3JUW A;  1YX0 A;  3IU2 A;  1QST A;  2REF A;  1R3N A;  1ZLH A;  2V8G A;  4M3S A;  2J8M A;  5HXD A;  1WWZ A;  4KZT A;  3TCV A;  1M44 A;  2CNM A;  3L2N A;  2ZW4 A;  5A28 A;  1YR0 A;  2PJA A;  2R8V A;  1H8L A;  2AFX A;  1Z9U A;  4F0Y A;  2ZEL A;  5I4M A;  1TXR A;  1LAM A;  4OAD A;  4OC0 A;  3R9E A;  1VGY A;  3JRU A;  2OOT A;  3T90 A;  5IB9 A;  3GKR A;  3C26 A;  4PV6 A;  1XEB A;  3KZW A;  2VZZ A;  5KTA A;  1KWM A;  3S9M A;  3F0A A;  2EVN A;  1NMT A;  2VL1 A;  2AFM A;  3PB6 X;  2ZEO A;  4IK2 A;  2OB0 A;  2ZEE A;  2PQ8 A;  1ARM A;  2EUI A;  4GXH A;  4NGS A;  3R95 A;  1Z4R A;  2Q7B A;  3SXN A;  2Z10 A;  3WC6 A;  3FF3 A;  3D7D A;  5K8P A;  3HUV A;  1Z8T A;  4ONU A;  3NE7 A;  2AFW A;  2HUZ A;  4OC3 A;  4CAF A;  3IO1 A;  4DNC A;  2B5G A;  2BCO A;  3GB0 A;  2Z3P A;  2GAN A;  4A31 A;  5JPH A;  1P4N A;  4X2T A;  3DLJ A;  2YNE A;  1BPM A;  1YW6 A;  2CTB A;  2B4D A;  4R76 A;  4JXR A;  1CG2 A;  5JM6 A;  3W6S A;  2JDD A;  2JBK A;  1P0H A;  2EO8 A;  3SJE A;  4UF4 A;  1L0C A;  4B11 A;  1QMU A;  5LRK A;  3KGQ A;  4CGP A;  1XF8 A;  3RO0 A;  4J3G A;  1V0C A;  2D4P A;  3ZZI A;  4CGO A;  2PJ0 A;  4L8A A;  1VHS A;  3BLN A;  3CT9 A;  5G22 A;  2R7H A;  4NGQ A;  4FAI A;  4PQA A;  4MFJ A;  2P6G A;  4P44 A;  2POK A;  3FX6 A;  3FXT A;  1S7L A;  2V8H A;  4MFK A;  3PP9 A;  4MRI A;  3NFZ A;  5EC4 A;  3H8E A;  4CAV A;  2C6P A;  2PJ6 A;  3NH4 A;  4KSA A;  4UFX A;  4UWJ A;  3CXP A;  4M6G A;  2Z3N A;  4A30 A;  1ELL P;  2JEV A;  4LQG A;  1XMB A;  1DE4 C;  2HQY A;  4B5P A;  2IMO A;  1LOK A;  2G9D A;  2V77 A;  1KUY A;  2B3U A;  4R87 A;  2IJZ A;  4HNX B;  3N5F A;  1YRE A;  3VAT A;  1QSO A;  1IYL A;  2HC9 A;  3EXN A;  4Y49 B;  5G20 A;  3ISX A;  2F5I A;  1Q7L A;  1Q2Y A;  1AYE A;  2J8R A;  3IEH A;  3KHZ A;  4MI4 A;  4NGT A;  2Z3M A;  5AG6 A;  3PB7 X;  1QSR A;  1TF8 A;  4X8I A;  1S5K A;  3I9S A;  2ZOF A;  3GUX A;  4OKO A;  1SQH A;  2R1I A;  4FD6 A;  4KOV A;  5HH1 A;  4A39 A;  4QB9 A;  3B3S A;  4FUU A;  4FWU A;  4M6I A;  3S6K A;  3VAR A;  4C7I A;  3FEC A;  2PR8 A;  4R7M A;  4XNH C;  1S7F A;  3K9U A;  3D7H A;  3PFE A;  1RXT A;  2JEW A;  4OC4 A;  4WJB A;  4KVM E;  5DWM A;  4DUK A;  2VZY A;  1ON0 A;  2B5G B;  2XEG A;  5HVH A;  2OZU A;  5JH9 A;  3D7G A;  1Q2D A;  2QVP A;  4KOX A;  4CAW A;  3RZA A;  2PC1 A;  4OID A;  4IUS A;  3T9Y A;  2FVG A;  3D2P A;  1TKJ A;  4L89 A;  4UIA A;  1XMT A;  2WSA A;  2DEA A;  1Z8X A;  4KOW A;  2GRE A;  3P2F A;  4LX9 A;  3EC4 A;  4RN7 A;  2AFS A;  2YND A;  4UEZ A;  2Q04 A;  3QB8 A;  5AG4 A;  2O53 A;  1CPS A;  4MCQ A;  4MHP A;  4QUS A;  3WC5 A;  4MFP A;  1HDQ A;  3LD2 A;  4PK3 A;  1DTD A;  1FY7 A;  5JQ4 A;  1IY7 A;  4ZI6 A;  3KHX A;  1VHE A;  4B14 A;  4KOS A;  1YVK A;  1ZG8 A;  4KOR A;  2KCW A;  2V8D A;  4UCN A;  3S6H A;  3FIX A;  2P0W A;  3G3S A;  2JLM A;  1R43 A;  1BAV A;  2B58 A;  2OZH A;  1IID A;  4R8F A;  2BSW A;  1IGB A;  2QJ8 A;  4CGN A;  3PB4 X;  1NSL A;  3TTH A;  2VI7 A;  4ZBG A;  4AB7 A;  4A32 A;  3B3T A;  5F46 A;  5D29 A;  4M6H A;  5H86 A;  4B5P B;  2DF5 A;  1GYT A;  4I49 A;  5F09 A;  2OR4 A;  4X3R A;  2I00 A;  1BO4 A;  2PVW A;  5J8F A;  1CP7 A;  3BXM A;  3NH8 A;  1KUX A;  3LMS A;  3CZX A;  2EK8 A;  4LUA A;  2PJ8 A;  4R9M A;  4H6Z A;  3JVN A;  2WPX A;  4UBR A;  1N71 A;  3GY9 A;  5K8N A;  5F49 A;  2X7B A;  5IB0 A;  2RFH A;  2DPT A;  4NSQ A;  1EE3 P;  4HPS A;  3N7Z A;  3VWD A;  4FD7 A;  4CGL A;  1J4J A;  3IWE A;  4BIN A;  2O28 A;  3SHP A;  4GS4 A;  1M1D A;  1YQE A;  1Z2L A;  2GFQ A;  3D67 A;  4OME A;  4C68 A;  3T8W A;  5HMN A;  1M4G A;  3FBU A;  3PBE A;  4KLW A;  4NJQ A;  4XPL A;  2J8N A;  2Q7S A;  3FRM A;  2Y0M A;  2B4B A;  2Q0Y A;  3KQX A;  5C82 A;  4KSI A;  4MY0 A;  3SJX A;  3IIB A;  3SXO A;  4C7H A;  1Z8L A;  5C88 A;  3EFA A;  4C2Y A;  1QSM A;  1FT7 A;  1AUG A;  4NFR A;  3VH9 A;  1LAN A;  2ARH A;  1MJB A;  3IC1 A;  2F7V A;  3MGD A;  2EWB A;  1XFO A;  1CBX A;  2FCK A;  3PFO A;  4AG7 A;  1Y9W A;  2PJ5 A;  3FH4 A;  4KVO E;  4A33 A;  3VWE A;  4YWY A;  3CXS A;  2PIZ A; 
#chains in the Genus database with same CATH homology
 5IX3 A;  3H5Z A;  2WUU A;  5AG7 A;  2YNC A;  5AG5 A;  3H4Q A;  2Z3O A;  3DR8 A;  4H6U A;  3D2M A;  4II9 A;  2Q4V A;  4AG9 A;  4BBH A;  5G21 A;  4YFJ A;  5KTD A;  5FVJ A;  2B3V A;  1LRZ A;  4UWI A;  3P2H A;  3PGP A;  2AE6 A;  4AVC A;  3EY5 A;  3R1K A;  2QML A;  4E2A A;  3IWG A;  5IV0 A;  4JJX A;  4B5O A;  5E96 A;  4PSX A;  4CYP A;  3KKW A;  4UA3 A;  1YLE A;  2GIV A;  4MFQ A;  4MY3 A;  3BJ7 A;  4R3K A;  2OZG A;  2VBQ A;  3GYA A;  1TIQ A;  3IU1 A;  4KUA A;  4E0A A;  3DR6 A;  2R98 A;  3CXQ A;  3BJ8 A;  5H84 A;  1Q2C A;  1YK3 A;  1MJA A;  4CYN A;  4ZGY B;  1ZO0 A;  4UFV A;  2BEI A;  5A27 A;  4F0X A;  5EBV A;  4B12 A;  3E0K A;  1IYK A;  1S7N A;  4U9Y A;  4JD6 A;  2QEC A;  3R9G A;  1B87 A;  1UFH A;  4RI1 A;  2G3T A;  4CRZ B;  4KSF A;  3D3S A;  5J8C A;  2QIR A;  1CM0 A;  3A9L A;  4KVX A;  3FB3 A;  4MHD A;  1S7K A;  2Z11 A;  4F6A A;  4XPK A;  2CY2 A;  3QAH A;  2PR1 A;  2Z0Z A;  1S3Z A;  2Q44 A;  4A2Z A;  4HNY B;  5I0C A;  1OZP A;  2Z3K A;  1R57 A;  2Q4Y A;  2FXF A;  4XPD B;  4A95 A;  4NCZ A;  4KOT A;  2RC4 A;  2P6E A;  2D4O A;  4U5Y A;  3OWC A;  2C27 A;  3TOB A;  2BL1 A;  3G8W A;  4IF5 A;  2FS5 A;  4R57 A;  4PSW A;  4NEX A;  4K30 A;  4FD4 A;  1Y9K A;  3TO6 A;  4YRH A;  2REE A;  2WPW A;  1QSN A;  1I21 A;  4QC6 A;  2Z3L A;  3F8K A;  3S6F A;  3S6G A;  1B6B A;  3TOA A;  3IGR A;  2OH1 A;  4CAX A;  1GHE A;  4Y49 C;  4C2Z A;  2CNS A;  5ISV A;  2A4N A;  4R3L A;  3UY5 A;  1BOB A;  3TE4 A;  3W6X A;  3W91 A;  5F48 A;  4KOU A;  4NF1 A;  2FIA A;  2FIW A;  4KS9 A;  4B10 A;  2VXK A;  4CRY B;  3R9F A;  3D8P A;  3LOD A;  3FYN A;  1MK4 A;  4HKF A;  2HV2 A;  3FNC A;  2K5T A;  2NMT A;  4QVT A;  4Q38 A;  2G3A A;  4M85 A;  4CAE A;  3F5B A;  5GCN A;  1Y7R A;  4QBJ A;  1XE4 A;  2P6F A;  4JWP A;  4Q36 A;  3B8G A;  2VQY A;  1IIC A;  1IB1 E;  2ZW6 A;  1S60 A;  2CNT A;  4KOY A;  4MBU A;  2FSR A;  3TT2 A;  2YNC C;  1M4D A;  4HNW B;  4X5K A;  4ORF A;  1PUA A;  3TO9 A;  4KUB A;  1U6M A;  4H89 A;  1MJ9 A;  2JDC A;  4CYQ A;  2OU2 A;  2PRB A;  1WK4 A;  2ZW5 A;  4BMH A;  2IL4 A;  5DWN A;  2FE7 A;  4MFZ A;  4XPD C;  2FT0 A;  1VKC A;  3RYO A;  4KLV A;  4UFW A;  1PU9 A;  3DDD A;  3DNS A;  3JTK A;  4OAE A;  4RS2 A;  2CXA A;  1KUV A;  4NXY A;  2ZPA A;  2PSW A;  1M4I A;  4MJ8 A;  5AGE A;  5KTC A;  5F47 A;  4CGM A;  2VEZ A;  2ZW7 A;  4YGO A;  3TFY A;  1YVO A;  2ZXV A;  2BUE A;  2AJ6 A;  1CJW A;  3V8I A;  1K4J A;  4UCP A;  3I3G A;  1Z4E A;  4FD5 A;  3WR7 A;  2ATR A;  2DPS A;  4AVA A;  2PDO A;  2GE3 A;  2G0B A;  1I12 A;  1XIX A;  4CYO A;  4UCM A;  3EO4 A;  4U9Z A;  2H5M A;  2B4D B;  4C2X A;  3PZJ A;  5CNP A;  4JXQ A;  3ZJ0 A;  4OLL A;  4MFL A;  3R96 A;  4E8O A;  4EVY A;  2I79 A;  2DXQ A;  1YGH A;  4AVB A;  1KZF A;  4CS0 B;  4B13 A;  5BWA B;  1I1D A;  3DSB A;  4JLY A;  2YGW A;  5G1Z A;  1NE9 A;  4XNH B;  3TO7 A;  2FL4 A;  1RO5 A;  4PK2 A;  3JUW A;  1YX0 A;  3IU2 A;  1QST A;  2REF A;  4M3S A;  2J8M A;  1WWZ A;  4KZT A;  3TCV A;  1M44 A;  2CNM A;  2ZW4 A;  5A28 A;  1YR0 A;  2R8V A;  1Z9U A;  4F0Y A;  4OAD A;  3R9E A;  3T90 A;  3GKR A;  3C26 A;  4PV6 A;  1XEB A;  2VZZ A;  5KTA A;  3F0A A;  2EVN A;  1NMT A;  2OB0 A;  2PQ8 A;  2EUI A;  3R95 A;  1Z4R A;  2Q7B A;  3SXN A;  2Z10 A;  4ONU A;  3NE7 A;  4CAF A;  2HUZ A;  4DNC A;  2B5G A;  2Z3P A;  2GAN A;  4A31 A;  5JPH A;  1P4N A;  2YNE A;  2B4D A;  4JXR A;  3W6S A;  2JDD A;  1P0H A;  1L0C A;  4B11 A;  4CGP A;  1XF8 A;  4J3G A;  1V0C A;  2D4P A;  3ZZI A;  4CGO A;  4L8A A;  1VHS A;  3BLN A;  5G22 A;  2R7H A;  4MFJ A;  2P6G A;  3FXT A;  1S7L A;  4MFK A;  3PP9 A;  5EC4 A;  4CAV A;  4KSA A;  4UFX A;  4UWJ A;  3CXP A;  2Z3N A;  4A30 A;  2JEV A;  2HQY A;  4B5P A;  1KUY A;  2B3U A;  4R87 A;  4HNX B;  1YRE A;  1QSO A;  1IYL A;  3EXN A;  4Y49 B;  5G20 A;  2F5I A;  1Q2Y A;  2J8R A;  4MI4 A;  2Z3M A;  5AG6 A;  1QSR A;  1S5K A;  3I9S A;  1SQH A;  2R1I A;  4FD6 A;  4KOV A;  5HH1 A;  4QB9 A;  3S6K A;  4C7I A;  4XNH C;  2PR8 A;  1S7F A;  3K9U A;  1RXT A;  4KVM E;  5DWM A;  2VZY A;  1ON0 A;  2B5G B;  2OZU A;  1Q2D A;  4KOX A;  4CAW A;  2PC1 A;  4IUS A;  3T9Y A;  3D2P A;  4L89 A;  1XMT A;  2WSA A;  4KOW A;  4LX9 A;  3P2F A;  3EC4 A;  2YND A;  2Q04 A;  3QB8 A;  5AG4 A;  4QUS A;  4MFP A;  3LD2 A;  4PK3 A;  1FY7 A;  5JQ4 A;  4B14 A;  4KOS A;  1YVK A;  4KOR A;  2KCW A;  4UCN A;  3S6H A;  3FIX A;  3G3S A;  2P0W A;  2JLM A;  2B58 A;  2OZH A;  1IID A;  2BSW A;  4CGN A;  1NSL A;  3TTH A;  2VI7 A;  4ZBG A;  4AB7 A;  4A32 A;  5F46 A;  5H86 A;  4B5P B;  4I49 A;  2I00 A;  1BO4 A;  5J8F A;  1KUX A;  4LUA A;  4R9M A;  4H6Z A;  3JVN A;  2WPX A;  4UBR A;  1N71 A;  3GY9 A;  5F49 A;  2X7B A;  5IB0 A;  2DPT A;  4NSQ A;  3N7Z A;  3VWD A;  4FD7 A;  4CGL A;  1J4J A;  3IWE A;  2O28 A;  3SHP A;  4GS4 A;  1M1D A;  4C68 A;  5HMN A;  1M4G A;  3FBU A;  4KLW A;  4XPL A;  2J8N A;  3FRM A;  2Y0M A;  2B4B A;  2Q0Y A;  5C82 A;  4MY0 A;  3SXO A;  4C7H A;  5C88 A;  3EFA A;  4C2Y A;  1QSM A;  2ARH A;  1MJB A;  3MGD A;  2FCK A;  4AG7 A;  1Y9W A;  4A33 A;  4KVO E;  3VWE A;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...