5I0CA

Crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
89
Chain Sequence
EIREGHNKFYINDQGKQIAEIVFVPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YjdJ
publication title Crystal structure of predicted acyltransferase YjdJ with acyl-CoA N-acyltransferase domain from Escherichia coli str. K-12
rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 25
structure length 89
sequence length 90
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5i0cA00
2B4DB 3VWEA 5IB0A 4PK3A 3GY9A 3H4QA 5EC4A 3DNSA 3TT2A 4KOUA 2P6EA 1YLEA 4HKFA 4KZTA 1SQHA 1LRZA 3N7ZA 2ARHA 1FY7A 4OLLA 3T90A 1IIDA 1NE9A 4EVYA 2B4BA 5I0CA 4JXRA 2G3TA 5H86A 1UFHA 2C27A 2G0BA 1OZPA 1Q2DA 2B3VA 3FB3A 4CRZB 3DR6A 2R1IA 1BO4A 4KUBA 1WK4A 4R57A 1XE4A 1Q2CA 4JD6A 2JDCA 4J3GA 2R8VA 4IUSA 4R3KA 5KTDA 1RXTA 1GHEA 3P2FA 1R57A 1QSNA 2F5IA 2Z10A 1YVOA 4QVTA 3SXOA 3G3SA 1CJWA 2PR1A 1QSOA 4R3LA 5KTCA 3GYAA 2OZGA 4CAWA 3E0KA 4H6UA 2PDOA 4QUSA 1QSRA 2J8NA 3DR8A 3P2HA 2BSWA 3QB8A 2OH1A 2OU2A 4UBRA 2HQYA 1U6MA 3CXPA 2PQ8A 4QC6A 5E96A 3W6SA 5DWNA 3R9FA 2Q7BA 1YX0A 1B6BA 1Y9WA 5J8FA 2O28A 2FCKA 4LUAA 1KUYA 4PK2A 2ZXVA 4IF5A 2GANA 4KVME 4QBJA 3MGDA 4KUAA 1IB1E 1MJAA 3D2MA 2VBQA 2VZZA 2PRBA 3VWDA 2H5MA 2WPWA 5ISVA 3PGPA 3TCVA 2OB0A 1NSLA 2I79A 3EC4A 2ZW6A 3BJ7A 3RYOA 3JUWA 1YR0A 3S6GA 1VHSA 5EBVA 1M44A 4R87A 3W91A 1S60A 2EUIA 5F48A 4HNXB 2Z0ZA 4FD6A 2R98A 4AVAA 3R96A 1K4JA 4LX9A 4AVBA 3F5BA 1XEBA 5F47A 3R1KA 2FIWA 1PUAA 3BLNA 2RC4A 2PSWA 2BL1A 4B5OA 4XNHB 1S3ZA 4OAEA 2VZYA 4XNHC 1L0CA 2Q0YA 4KOTA 3QAHA 4KOXA 5CNPA 4NCZA 1YK3A 2B58A 2A4NA 5C82A 2PR8A 3R9GA 3I3GA 3EFAA 4FD5A 3S6HA 3W6XA 1IICA 4AB7A 1Z4RA 2CNTA 1I1DA 2D4PA 4U5YA 2CNSA 2FL4A 3F8KA 4U9ZA 3EO4A 4X5KA 3SHPA 1XF8A 4AG9A 4GS4A 2CNMA 3EXNA 4JWPA 4K30A 5IX3A 3FIXA 4KOVA 3FBUA 3TOAA 3G8WA 4NF1A 5J8CA 4U9YA 2VI7A 4KVXA 1S7KA 3JVNA 2HV2A 2ATRA 3CXSA 2BUEA 2FT0A 3WR7A 2KCWA 4H6ZA 4UWIA 1XMTA 2HUZA 4KLWA 1B87A 4F0YA 5C88A 2P6GA 4R9MA 4KOSA 2QMLA 2B5GA 4ORFA 3S6FA 3ZZIA 3I9SA 2DXQA 1I12A 4B5PA 2Q4VA 4RI1A 2FIAA 2FS5A 1KUXA 2JDDA 4NEXA 4FD7A 1I21A 1CM0A 1YGHA 2B5GB 3TO7A 4KOYA 2G3AA 4MBUA 3V8IA 4AG7A 2Q4YA 1S5KA 4B5PB 4KORA 4HNYB 3K9UA 4MJ8A 4L89A 4MI4A 2EVNA 3CXQA 2K5TA 1N71A 4Y49B 3FRMA 1M4GA 4Y49C 3GKRA 2CY2A 2OZUA 5F46A 4QB9A 3TE4A 4YGOA 4OADA 1NMTA 2AE6A 3OWCA 2IL4A 3B8GA 3SXNA 1Q2YA 3D3SA 1Y7RA 4XPKA 2GIVA 4II9A 1P4NA 4E0AA 2R7HA 1MJ9A 3TTHA 4PSWA 4F6AA 5HMNA 2PC1A 3TOBA 4E2AA 2REFA 2X7BA 2ZW4A 4PV6A 1S7FA 2REEA 1MJBA 1TIQA 4KVOE 4NSQA 4M3SA 3PP9A 5KTAA 1KZFA 1S7NA 2P6FA 4L8AA 3TO9A 3F0AA 3IGRA 1RO5A 1Y9KA 1M4IA 1V0CA 3D8PA 5IV0A 5H84A 3R9EA 2VEZA 1KUVA 1S7LA 3LD2A 3FYNA 3DDDA 1QSTA 2B3UA 3DSBA 1YREA 1ON0A 4NXYA 1IYKA 2J8MA 3FNCA 4ZBGA 4RS2A 1M4DA 1Z9UA 2OZHA 5DWMA 3C26A 3BJ8A 5HH1A 3KKWA 4AVCA 3NE7A 4H89A 4XPDB 3EY5A 4HNWB 4XPDC 2Y0MA 4M85A 1PU9A 1XIXA 2VXKA 2J8RA 4JJXA 5FVJA 2ZPAA 2WPXA 2QIRA 3UY5A 4KLVA 2QECA 5JQ4A 4E8OA 4CAXA 3S6KA 2FE7A 1IYLA 2FSRA 2D4OA 2JEVA 2P0WA 4YRHA 1BOBA 4UWJA 1WWZA 4MY3A 2Z11A 4I49A 2ZW5A 1Z4EA 2NMTA 3IWGA 5GCNA 1QSMA 4FD4A 3T9YA 4BMHA 3ZJ0A 1M1DA 5JPHA 2BEIA 4CRYB 4PSXA 2Q04A 4XPLA 1MK4A 1YVKA 2GE3A 3PZJA 4KOWA 3TO6A 4CS0B 3TFYA 1P0HA 2FXFA 4ONUA 2AJ6A 4JLYA 4MY0A 3LODA 2B4DA 2ZW7A 3D2PA 1VKCA 3FXTA 4JXQA 5F49A 4MHDA 2VQYA 3R95A 2Q44A 4UA3A 2JLMA 4YFJA 2I00A 1J4JA 4DNCA 4CAVA
chains in the Genus database with same CATH superfamily
2B4DB 4NJRA 1TXRA 4X8IA 3JRUA 3IIBA 3VWEA 5CPAA 4NGMA 5IB0A 4EMEA 4PK3A 3GY9A 1IOFA 3H4QA 5EC4A 5LRJA 2POKA 4OIWA 1ZG9A 2PE3A 2PJCA 4ZX8A 3DNSA 2PJ5A 2XEIA 3TT2A 4A2ZA 1TF9A 4KOUA 2P6EA 3FECA 4FBEA 3NH5A 2YNCA 1YLEA 5LYDA 4HKFA 4KZTA 1SQHA 1LRZA 2DPTA 1QMUA 2JBJA 1A2ZA 3N7ZA 2ARHA 2PJ6A 1FY7A 3CDXA 4OLLA 3LACA 3S9MA 3T90A 3CPXA 1IIDA 1DTDA 5LYFA 1NE9A 4EVYA 4CGPA 2B4BA 1CX8A 3FEDA 5I0CA 4UEZA 3GB0A 4JXRA 2G3TA 3D67A 2AFZA 5H86A 1UFHA 1F2PA 2C27A 2YNCC 8CPAA 2G0BA 2JEWA 4IK2A 2NSMA 2XEJA 2GFQA 1OZPA 5HVGA 1IU8A 2PJBA 1Q2DA 2B3VA 3B3WA 3FB3A 4CRZB 3B3TA 2BOAA 3DR6A 2R1IA 3A9LA 1FT7A 1BO4A 4KUBA 4LQ6A 4WWVA 3WT4A 1PYTB 1WK4A 4RUHA 4JZ0A 4R57A 4CGMA 1XE4A 2IMOA 3BI1A 1Q2CA 4JD6A 3WC6A 2JDCA 2VL1A 4J3GA 2R8VA 5AGEA 3FVLA 4IUSA 4R3KA 1Y7EA 1RXTA 5KTDA 1GHEA 3P2FA 1R57A 1QSNA 2F5IA 2Z10A 3NH4A 1R43A 1Z8LA 2PJ9A 3T8WA 1YVOA 2ZEPA 4QVTA 3SXOA 3G3SA 1CJWA 5G21A 2OOTA 2WSAA 2ZELA 2AFXA 2PR1A 4MCRA 2AFSA 3KL9A 4GXHA 4CYPA 3PB4X 2PCUA 4C7HA 1QSOA 2BO9A 4NGTA 4R3LA 5G1ZA 4A37A 4TWEA 5KTCA 2AFMA 4CGOA 3GYAA 4PXCA 2OZGA 4CAWA 4P10A 3E0KA 3PB8X 1Z8WA 1CP6A 4KSFA 4H6UA 4P6YA 1LFWA 2PDOA 3IEHA 4QUSA 1QSRA 1PCAA 4CYNA 3V38A 2J8NA 4UIAA 3DR8A 3P2HA 2BSWA 3QB8A 5D29A 3BI0A 4ZGYB 4P4IA 4Q38A 3HLPA 2OH1A 2OU2A 2V8GA 1XRYA 4UBRA 1IGBA 5LYIA 2HQYA 1JWQA 3B7IA 1U6MA 3CXPA 5IB9A 2PQ8A 4QC6A 4UFXA 5E96A 2CIJA 3W6SA 4Z65A 5DWNA 1XJOA 4FUUA 4NGNA 4H2KA 1QQ9A 3R9FA 4MFPA 1HDQA 3B3VA 1AMPA 3KR5A 4B10A 2Q7BA 4X2TA 1YX0A 1B6BA 1Y9WA 5G22A 2O28A 3PFOA 5J8FA 3HUVA 2FCKA 3GIUA 4LUAA 1KUYA 3D66A 2ZEOA 3KGQA 2PVWA 1BPMA 4PK2A 4X3RA 2ZXVA 3PFEA 4MCPA 2Q7SA 4IF5A 2GANA 4KVME 4QBJA 3KQXA 2ZOGA 3MGDA 4GM5A 4KUAA 1OBRA 5LRKA 1IB1E 3H5ZA 1MJAA 3D2MA 3LWUA 2VBQA 1VHOA 2ODFA 3D7GA 2VZZA 2PRBA 3VWDA 2H5MA 1LAPA 2WPWA 5ISVA 3PGPA 4MFJA 3TCVA 4O23A 2OB0A 3KI9A 5A27A 2PJAA 1NSLA 2I79A 3EC4A 2ZW6A 4TNUA 4A31A 3BJ7A 3RYOA 3JUWA 1YR0A 3IFEA 3S6GA 4MFLA 1CP7A 1VHSA 5EBVA 4ZY1A 1M44A 4R87A 3W91A 1S60A 2NYQA 2EUIA 5F48A 4HNXB 4NJQA 3B35A 2Z0ZA 3D7FA 4B12A 1X12A 4FD6A 2R98A 2Q4ZA 2Z3MA 4ZI6A 4P4FA 4AVAA 4UEFA 3K9TA 4UFVA 2ZEEA 3R96A 3IJ3A 1K4JA 5D8NA 4LX9A 1XMBA 2ZOFA 4AVBA 5DS0A 5J1QA 3F5BA 1Z8TA 5ELYA 3WABA 1F2OA 4KS9A 2AFWA 4KSIA 1XEBA 3GUXA 2CXAA 5F47A 3R1KA 4P45A 2Z3LA 4C2XA 4R8FA 1ZLHA 2FIWA 1PUAA 4OIDA 3FH4A 3PB9X 3BLNA 2RC4A 2PSWA 2BL1A 4UF4A 4A39A 4B5OA 1AUGA 2O53A 2RFHA 4XNHB 1YQEA 1S3ZA 3NFZA 2ZEHA 3PEIA 2VZYA 4OAEA 3SI2A 4XNHC 3MN8A 1L0CA 4C7IA 1KWMA 2Q0YA 3D7DA 4KOTA 3QAHA 4A95A 4KOXA 4MFQA 1IY7A 3CT9A 3IWWA 4G1PA 4NGRA 4OC2A 4NCZA 5CNPA 1YK3A 3B3CA 1LANA 2PJ2A 2CTCA 1YMEA 1ZO0A 2B58A 2A4NA 4HPSA 5C82A 1LOKA 2PR8A 3FX6A 2Q51A 3R9GA 3H8FA 4CYQA 3I3GA 3EFAA 3VARA 4FD5A 3S6HA 3W6XA 5HVFA 1IICA 4AB7A 3FF3A 1Z4RA 2CNTA 4PXEA 4A32A 5K8OA 1I1DA 4MHYA 2D4PA 3NA6A 2CNSA 1EE3P 4U5YA 2FL4A 3F8KA 2IQ6A 4U9ZA 3EO4A 4X5KA 3SHPA 1XF8A 2CTBA 2ABZA 3H8GA 1CPXA 4AG9A 4GS4A 2CNMA 4PPZA 3EXNA 3IWEA 4JWPA 4K30A 5IX3A 3FIXA 4KOVA 3FBUA 3TOAA 3G8WA 4NF1A 5J8CA 4Q36A 3IO1A 1UWYA 4U9YA 5AG5A 2ZEDA 2DPSA 2VI7A 2V8HA 4KVXA 2Z3NA 1S7KA 5HXDA 2O4HA 3JVNA 2HV2A 2ATRA 1HDUA 4B11A 2HB6A 3CXSA 3RZAA 2BUEA 2C6CA 4OC1A 2FT0A 3D68A 3WR7A 2KCWA 5CBMA 4H6ZA 4UIBA 4BINA 3ISXA 4UWIA 4A30A 1XMTA 3LMSA 2HUZA 3WC7A 3RO0A 4CAEA 2PJ0A 4KLWA 1X10A 1B87A 4A38A 4R7MA 1YW4A 2PJ7A 4F0YA 5C88A 2P6GA 4R9MA 3KZWA 4KOSA 4R6TA 2EBJA 3KQZA 4OMEA 2QMLA 4OC5A 5EMIA 2B5GA 4ORFA 2EK8A 1RTQA 4PXDA 3S6FA 1XFOA 3ZZIA 3I9SA 2DXQA 1I12A 4B5PA 3PRTA 2Q4VA 4RI1A 2PJ3A 4YU9A 2FIAA 1HEEA 4ZYQA 2FS5A 1KUXA 4R76A 2JDDA 7CPAA 4NEXA 1AYEA 4FD7A 1I21A 3ISZA 3IU1A 1CM0A 1YGHA 2GLJA 3PBBA 2B5GB 4NGPA 3TO7A 4KOYA 2G3AA 4MBUA 3V8IA 1VGYA 1Y0YA 1Z8XA 4AG7A 4NFRA 2Q4YA 3S9LA 1S5KA 4B5PB 4KORA 3H8EA 4HNYB 2RB7A 2WUUA 3K9UA 4MJ8A 4L89A 1F57A 4MI4A 2EVNA 2Z3KA 2K5TA 2ZENA 1N71A 3CXQA 3RAMA 2YNEA 4Y49B 2Q43A 3FRMA 1M4GA 4OC0A 3TC8A 4Y49C 3GKRA 4C2ZA 4DJLA 2CY2A 2OZUA 2BCOA 4BD9A 5F46A 4UCPA 4BBHA 3N5FA 4QB9A 3TE4A 4LQGA 6CPAA 4OC3A 4KSAA 1ZLIA 2V8VA 4YGOA 4CAFA 4OADA 1NMTA 2AE6A 3OWCA 2IL4A 3B8GA 3FEEA 4UCNA 1Q2YA 3D3SA 3SXNA 1Y7RA 4XPKA 2GIVA 4II9A 1P4NA 4E0AA 2R7HA 4PQAA 1ELMP 1MJ9A 5G20A 3TTHA 3DGVA 2PJ1A 2G9DA 4PSWA 3PB6X 4F6AA 5HMNA 2DEAA 2HC9A 2PC1A 3PBEA 5BWAB 3KHXA 3TOBA 4E2AA 2QVPA 2EO8A 2ZEFA 3D7HA 5LYLA 2REFA 1VHEA 2CF4A 2PJ4A 2EK9A 2X7BA 3RBUA 2ZW4A 4CGLA 4PV6A 1S7FA 2REEA 1MJBA 1TIQA 4KVOE 4NSQA 4OC4A 4M3SA 3PP9A 4AXVA 5KTAA 1KZFA 2QJ8A 1S7NA 2P6FA 4L8AA 3TO9A 3F0AA 3B3SA 3IGRA 4ZX9A 2C6GA 1RO5A 1Y9KA 1M4IA 1V0CA 3D8PA 4P4BA 2C6PA 5IV0A 1H8LA 2Z3PA 3SJEA 5H84A 4JYWA 3R9EA 2C1CA 5A28A 2VEZA 1KUVA 1S7LA 4EWTA 3LD2A 3FYNA 3DDDA 2PIZA 4MCSA 1ARMA 1QSTA 2B3UA 3DSBA 4MHPA 1YREA 2GLFA 2PRQA 4MFZA 2QYVA 3TX8A 3BXMA 4MCQA 4MMOA 1ON0A 1LCPA 1XBUA 4NGQA 3S9NA 4NXYA 3SJFA 2JBKA 1IYKA 2J8MA 3FNCA 4ZBGA 4RS2A 1M4DA 1Z9UA 2OZHA 5DWMA 2ZEMA 3BJ8A 3C26A 2PIYA 3SJGA 3NE8A 4RN7A 5HH1A 3KKWA 4CGNA 2AFUA 3SI1A 1TKHA 3VATA 4UFWA 4AVCA 3NE7A 4H89A 4CPAA 3D4UA 4MRIA 1TKJA 1YW6A 3QAYA 3EY5A 4XPDB 4P4DA 4B14A 4C68A 1R3NA 5I4MA 4HNWB 4P4JA 1TF8A 2IJZA 2Y0MA 4M85A 4XPDC 1PU9A 1XIXA 5K8MA 1YLOA 3QNVA 5AG7A 2VXKA 2J8RA 4JJXA 5LRGA 2V77A 5FVJA 2WZNA 2ZPAA 4YWYA 1GYTA 2WPXA 2QIRA 3WC5A 3SI0A 5AG4A 1Y0RA 4WJBA 3UY5A 4MFKA 4W9YA 4KLVA 5JH9A 2QECA 5F09A 2PJ8A 4MXUA 5JGFA 5JQ4A 4E8OA 3DLJA 4CYOA 1CG2A 3CPAA 3FJUA 3B2YA 4ONWA 1CPSA 4PXBA 3S6KA 4CAXA 1CBXA 2FE7A 1IYLA 4IAVA 2XEFA 2Z3OA 2OR4A 2FSRA 3KHZA 5JM6A 4OKOA 5HVHA 2D4OA 5THWA 2JEVA 3SJXA 4M6HA 1DE4C 2P0WA 1BOBA 4YRHA 4F9UA 1XOVA 2I3CA 5AG6A 3L2NA 3GLJA 1ELLP 4NGSA 3BHXA 4UWJA 2WYRA 2AFOA 1WWZA 2EWBA 4MY3A 2Z11A 4I49A 4P4EA 2V8DA 2ZW5A 3CZXA 4EFDA 5K8NA 1Z4EA 1ZG7A 1VIXA 4UCMA 4F8ZA 2ZEGA 1Z2LA 2NMTA 1ARLA 1NSAA 3IWGA 1Q7LA 4IHMA 4MHZA 5GCNA 3KASA 1QSMA 2J9AA 4F9VA 1BPNA 1IOIA 1YSJA 4FD4A 3T9YA 3VH9A 5K8PA 3PB7X 4BMHA 3ZJ0A 1M1DA 5JPHA 2BEIA 2YNDA 4PSXA 4ZY2A 4CRYB 1LAMA 2F7VA 3MRUA 4DYOA 2Q04A 4ZY0A 4XPLA 4B13A 3V7ZA 2ANPA 4B6ZA 1MK4A 4OP4A 2XEGA 4FWUA 4K3NA 1ZG8A 1YVKA 4P44A 4M6IA 3K2KA 2GE3A 2YGWA 3KR4A 4A33A 3PZJA 2F8HA 1M4LA 4KOWA 3TO6A 1TKFA 4C2YA 4CS0B 3TFYA 1BLLE 3RNZA 2DF5A 1P0HA 2FXFA 2PVVA 1Z5RA 2AJ6A 3FMCA 4ONUA 4Q7AA 4F0XA 4FAIA 4JLYA 2FVGA 3IU2A 4MY0A 1BAVA 3LODA 2B4DA 2ZW7A 3D2PA 1VKCA 3FXTA 4JXQA 4UEEA 5F49A 2GU2A 4MHDA 3JTKA 2VQYA 3R95A 1JQGA 4MHNA 2Q44A 4M6GA 4UA3A 3IC1A 2JLMA 1FNOA 4A94A 3NH8A 4DUKA 2GREA 4YFJA 2I00A 1J4JA 4DNCA 3I1UA 4CAVA
chains in the Genus database with same CATH topology
2B4DB 3VWEA 5IB0A 4PK3A 3GY9A 3H4QA 5EC4A 3DNSA 3TT2A 4A2ZA 4KOUA 2P6EA 2YNCA 1YLEA 4HKFA 4KZTA 1SQHA 1LRZA 2DPTA 3N7ZA 2ARHA 1FY7A 4OLLA 3T90A 1IIDA 1NE9A 4EVYA 4CGPA 2B4BA 5I0CA 4JXRA 2G3TA 5H86A 1UFHA 2C27A 2YNCC 2G0BA 1OZPA 1Q2DA 2B3VA 3FB3A 4CRZB 3DR6A 2R1IA 3A9LA 1BO4A 4KUBA 1WK4A 4R57A 4CGMA 1XE4A 1Q2CA 4JD6A 2JDCA 4J3GA 2R8VA 5AGEA 4IUSA 4R3KA 5KTDA 1RXTA 1GHEA 3P2FA 1R57A 1QSNA 2F5IA 2Z10A 1YVOA 4QVTA 3SXOA 3G3SA 1CJWA 5G21A 2WSAA 2PR1A 4CYPA 4C7HA 1QSOA 4R3LA 5G1ZA 5KTCA 4CGOA 3GYAA 2OZGA 4CAWA 3E0KA 4KSFA 4H6UA 2PDOA 4QUSA 1QSRA 4CYNA 2J8NA 3DR8A 3P2HA 2BSWA 3QB8A 4ZGYB 4Q38A 2OH1A 2OU2A 4UBRA 2HQYA 1U6MA 3CXPA 2PQ8A 4QC6A 4UFXA 5E96A 3W6SA 5DWNA 3R9FA 4MFPA 4B10A 2Q7BA 1YX0A 1B6BA 1Y9WA 5G22A 2O28A 5J8FA 2FCKA 4LUAA 1KUYA 4PK2A 2ZXVA 4IF5A 2GANA 4KVME 4QBJA 3MGDA 4KUAA 1IB1E 3H5ZA 1MJAA 3D2MA 2VBQA 2VZZA 2PRBA 3VWDA 2H5MA 2WPWA 5ISVA 3PGPA 4MFJA 3TCVA 2OB0A 5A27A 1NSLA 2I79A 3EC4A 2ZW6A 4A31A 3BJ7A 3RYOA 3JUWA 1YR0A 3S6GA 4MFLA 1VHSA 5EBVA 1M44A 4R87A 3W91A 1S60A 2EUIA 5F48A 4HNXB 4B12A 2Z0ZA 4FD6A 2R98A 2Z3MA 4AVAA 4UFVA 3R96A 1K4JA 4LX9A 4AVBA 3F5BA 4KS9A 1XEBA 5F47A 2CXAA 3R1KA 2Z3LA 4C2XA 2FIWA 1PUAA 3BLNA 2RC4A 2PSWA 2BL1A 4B5OA 4XNHB 1S3ZA 4OAEA 2VZYA 4XNHC 1L0CA 4C7IA 2Q0YA 4A95A 4KOTA 3QAHA 4KOXA 4MFQA 5CNPA 4NCZA 1YK3A 1ZO0A 2B58A 2A4NA 5C82A 2PR8A 3R9GA 4CYQA 3I3GA 3EFAA 4FD5A 3S6HA 3W6XA 1IICA 4AB7A 1Z4RA 2CNTA 4A32A 1I1DA 2D4PA 4U5YA 2CNSA 2FL4A 3F8KA 4U9ZA 3EO4A 4X5KA 3SHPA 1XF8A 4AG9A 4GS4A 2CNMA 3EXNA 3IWEA 4JWPA 4K30A 5IX3A 3FIXA 4KOVA 3FBUA 3TOAA 3G8WA 4NF1A 5J8CA 4Q36A 4U9YA 5AG5A 2DPSA 2VI7A 4KVXA 2Z3NA 1S7KA 3JVNA 2HV2A 2ATRA 4B11A 3CXSA 2BUEA 2FT0A 3WR7A 2KCWA 4H6ZA 4UWIA 4A30A 1XMTA 2HUZA 4CAEA 4KLWA 1B87A 4F0YA 5C88A 2P6GA 4R9MA 4KOSA 2QMLA 2B5GA 4ORFA 3S6FA 3ZZIA 3I9SA 2DXQA 1I12A 4B5PA 2Q4VA 4RI1A 2FIAA 2FS5A 1KUXA 2JDDA 4NEXA 4FD7A 1I21A 3IU1A 1CM0A 1YGHA 2B5GB 3TO7A 4KOYA 2G3AA 4MBUA 3V8IA 4AG7A 2Q4YA 1S5KA 4B5PB 4KORA 4HNYB 2WUUA 3K9UA 4MJ8A 4L89A 4MI4A 2EVNA 2Z3KA 2K5TA 3CXQA 1N71A 2YNEA 4Y49B 3FRMA 1M4GA 4Y49C 3GKRA 4C2ZA 2CY2A 2OZUA 5F46A 4UCPA 4BBHA 4QB9A 3TE4A 4YGOA 4KSAA 4CAFA 4OADA 1NMTA 2AE6A 3OWCA 2IL4A 3B8GA 4UCNA 3SXNA 1Q2YA 3D3SA 1Y7RA 4XPKA 2GIVA 4II9A 1P4NA 4E0AA 2R7HA 1MJ9A 5G20A 3TTHA 4PSWA 4F6AA 5HMNA 5BWAB 2PC1A 3TOBA 4E2AA 2REFA 2X7BA 4CGLA 2ZW4A 4PV6A 1S7FA 2REEA 1MJBA 1TIQA 4KVOE 4NSQA 4M3SA 3PP9A 5KTAA 1KZFA 1S7NA 2P6FA 4L8AA 3TO9A 3F0AA 3IGRA 1RO5A 1Y9KA 1M4IA 1V0CA 3D8PA 5IV0A 2Z3PA 5H84A 3R9EA 5A28A 2VEZA 1KUVA 1S7LA 3LD2A 3FYNA 3DDDA 1QSTA 2B3UA 3DSBA 1YREA 4MFZA 1ON0A 4NXYA 1IYKA 2J8MA 3FNCA 4ZBGA 4RS2A 1M4DA 1Z9UA 2OZHA 5DWMA 3C26A 3BJ8A 5HH1A 3KKWA 4CGNA 4AVCA 4UFWA 3NE7A 4H89A 4XPDB 4B14A 3EY5A 4C68A 4HNWB 4XPDC 2Y0MA 4M85A 1PU9A 1XIXA 5AG7A 2VXKA 2J8RA 4JJXA 5FVJA 2ZPAA 2WPXA 2QIRA 5AG4A 3UY5A 4MFKA 4KLVA 2QECA 5JQ4A 4E8OA 4CYOA 4CAXA 3S6KA 2FE7A 1IYLA 2Z3OA 2FSRA 2D4OA 2JEVA 2P0WA 4YRHA 1BOBA 5AG6A 4UWJA 1WWZA 4MY3A 2Z11A 4I49A 2ZW5A 1Z4EA 4UCMA 2NMTA 3IWGA 5GCNA 1QSMA 4FD4A 3T9YA 4BMHA 3ZJ0A 1M1DA 5JPHA 2BEIA 2YNDA 4PSXA 4CRYB 2Q04A 4XPLA 4B13A 1MK4A 1YVKA 2GE3A 2YGWA 4A33A 3PZJA 4KOWA 3TO6A 4C2YA 4CS0B 3TFYA 1P0HA 2FXFA 4ONUA 2AJ6A 4F0XA 4JLYA 3IU2A 4MY0A 3LODA 2B4DA 2ZW7A 3D2PA 1VKCA 3FXTA 4JXQA 5F49A 4MHDA 3JTKA 2VQYA 3R95A 2Q44A 4UA3A 2JLMA 4YFJA 2I00A 1J4JA 4DNCA 4CAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4D B;  3VWE A;  5IB0 A;  4PK3 A;  3GY9 A;  3H4Q A;  5EC4 A;  3DNS A;  3TT2 A;  4KOU A;  2P6E A;  1YLE A;  4HKF A;  4KZT A;  1SQH A;  1LRZ A;  3N7Z A;  2ARH A;  1FY7 A;  4OLL A;  3T90 A;  1IID A;  1NE9 A;  4EVY A;  2B4B A;  5I0C A;  4JXR A;  2G3T A;  5H86 A;  1UFH A;  2C27 A;  2G0B A;  1OZP A;  1Q2D A;  2B3V A;  3FB3 A;  4CRZ B;  3DR6 A;  2R1I A;  1BO4 A;  4KUB A;  1WK4 A;  4R57 A;  1XE4 A;  1Q2C A;  4JD6 A;  2JDC A;  4J3G A;  2R8V A;  4IUS A;  4R3K A;  5KTD A;  1RXT A;  1GHE A;  3P2F A;  1R57 A;  1QSN A;  2F5I A;  2Z10 A;  1YVO A;  4QVT A;  3SXO A;  3G3S A;  1CJW A;  2PR1 A;  1QSO A;  4R3L A;  5KTC A;  3GYA A;  2OZG A;  4CAW A;  3E0K A;  4H6U A;  2PDO A;  4QUS A;  1QSR A;  2J8N A;  3DR8 A;  3P2H A;  2BSW A;  3QB8 A;  2OH1 A;  2OU2 A;  4UBR A;  2HQY A;  1U6M A;  3CXP A;  2PQ8 A;  4QC6 A;  5E96 A;  3W6S A;  5DWN A;  3R9F A;  2Q7B A;  1YX0 A;  1B6B A;  1Y9W A;  5J8F A;  2O28 A;  2FCK A;  4LUA A;  1KUY A;  4PK2 A;  2ZXV A;  4IF5 A;  2GAN A;  4KVM E;  4QBJ A;  3MGD A;  4KUA A;  1IB1 E;  1MJA A;  3D2M A;  2VBQ A;  2VZZ A;  2PRB A;  3VWD A;  2H5M A;  2WPW A;  5ISV A;  3PGP A;  3TCV A;  2OB0 A;  1NSL A;  2I79 A;  3EC4 A;  2ZW6 A;  3BJ7 A;  3RYO A;  3JUW A;  1YR0 A;  3S6G A;  1VHS A;  5EBV A;  1M44 A;  4R87 A;  3W91 A;  1S60 A;  2EUI A;  5F48 A;  4HNX B;  2Z0Z A;  4FD6 A;  2R98 A;  4AVA A;  3R96 A;  1K4J A;  4LX9 A;  4AVB A;  3F5B A;  1XEB A;  5F47 A;  3R1K A;  2FIW A;  1PUA A;  3BLN A;  2RC4 A;  2PSW A;  2BL1 A;  4B5O A;  4XNH B;  1S3Z A;  4OAE A;  2VZY A;  4XNH C;  1L0C A;  2Q0Y A;  4KOT A;  3QAH A;  4KOX A;  5CNP A;  4NCZ A;  1YK3 A;  2B58 A;  2A4N A;  5C82 A;  2PR8 A;  3R9G A;  3I3G A;  3EFA A;  4FD5 A;  3S6H A;  3W6X A;  1IIC A;  4AB7 A;  1Z4R A;  2CNT A;  1I1D A;  2D4P A;  4U5Y A;  2CNS A;  2FL4 A;  3F8K A;  4U9Z A;  3EO4 A;  4X5K A;  3SHP A;  1XF8 A;  4AG9 A;  4GS4 A;  2CNM A;  3EXN A;  4JWP A;  4K30 A;  5IX3 A;  3FIX A;  4KOV A;  3FBU A;  3TOA A;  3G8W A;  4NF1 A;  5J8C A;  4U9Y A;  2VI7 A;  4KVX A;  1S7K A;  3JVN A;  2HV2 A;  2ATR A;  3CXS A;  2BUE A;  2FT0 A;  3WR7 A;  2KCW A;  4H6Z A;  4UWI A;  1XMT A;  2HUZ A;  4KLW A;  1B87 A;  4F0Y A;  5C88 A;  2P6G A;  4R9M A;  4KOS A;  2QML A;  2B5G A;  4ORF A;  3S6F A;  3ZZI A;  3I9S A;  2DXQ A;  1I12 A;  4B5P A;  2Q4V A;  4RI1 A;  2FIA A;  2FS5 A;  1KUX A;  2JDD A;  4NEX A;  4FD7 A;  1I21 A;  1CM0 A;  1YGH A;  2B5G B;  3TO7 A;  4KOY A;  2G3A A;  4MBU A;  3V8I A;  4AG7 A;  2Q4Y A;  1S5K A;  4B5P B;  4KOR A;  4HNY B;  3K9U A;  4MJ8 A;  4L89 A;  4MI4 A;  2EVN A;  3CXQ A;  2K5T A;  1N71 A;  4Y49 B;  3FRM A;  1M4G A;  4Y49 C;  3GKR A;  2CY2 A;  2OZU A;  5F46 A;  4QB9 A;  3TE4 A;  4YGO A;  4OAD A;  1NMT A;  2AE6 A;  3OWC A;  2IL4 A;  3B8G A;  3SXN A;  1Q2Y A;  3D3S A;  1Y7R A;  4XPK A;  2GIV A;  4II9 A;  1P4N A;  4E0A A;  2R7H A;  1MJ9 A;  3TTH A;  4PSW A;  4F6A A;  5HMN A;  2PC1 A;  3TOB A;  4E2A A;  2REF A;  2X7B A;  2ZW4 A;  4PV6 A;  1S7F A;  2REE A;  1MJB A;  1TIQ A;  4KVO E;  4NSQ A;  4M3S A;  3PP9 A;  5KTA A;  1KZF A;  1S7N A;  2P6F A;  4L8A A;  3TO9 A;  3F0A A;  3IGR A;  1RO5 A;  1Y9K A;  1M4I A;  1V0C A;  3D8P A;  5IV0 A;  5H84 A;  3R9E A;  2VEZ A;  1KUV A;  1S7L A;  3LD2 A;  3FYN A;  3DDD A;  1QST A;  2B3U A;  3DSB A;  1YRE A;  1ON0 A;  4NXY A;  1IYK A;  2J8M A;  3FNC A;  4ZBG A;  4RS2 A;  1M4D A;  1Z9U A;  2OZH A;  5DWM A;  3C26 A;  3BJ8 A;  5HH1 A;  3KKW A;  4AVC A;  3NE7 A;  4H89 A;  4XPD B;  3EY5 A;  4HNW B;  4XPD C;  2Y0M A;  4M85 A;  1PU9 A;  1XIX A;  2VXK A;  2J8R A;  4JJX A;  5FVJ A;  2ZPA A;  2WPX A;  2QIR A;  3UY5 A;  4KLV A;  2QEC A;  5JQ4 A;  4E8O A;  4CAX A;  3S6K A;  2FE7 A;  1IYL A;  2FSR A;  2D4O A;  2JEV A;  2P0W A;  4YRH A;  1BOB A;  4UWJ A;  1WWZ A;  4MY3 A;  2Z11 A;  4I49 A;  2ZW5 A;  1Z4E A;  2NMT A;  3IWG A;  5GCN A;  1QSM A;  4FD4 A;  3T9Y A;  4BMH A;  3ZJ0 A;  1M1D A;  5JPH A;  2BEI A;  4CRY B;  4PSX A;  2Q04 A;  4XPL A;  1MK4 A;  1YVK A;  2GE3 A;  3PZJ A;  4KOW A;  3TO6 A;  4CS0 B;  3TFY A;  1P0H A;  2FXF A;  4ONU A;  2AJ6 A;  4JLY A;  4MY0 A;  3LOD A;  2B4D A;  2ZW7 A;  3D2P A;  1VKC A;  3FXT A;  4JXQ A;  5F49 A;  4MHD A;  2VQY A;  3R95 A;  2Q44 A;  4UA3 A;  2JLM A;  4YFJ A;  2I00 A;  1J4J A;  4DNC A;  4CAV A; 
#chains in the Genus database with same CATH topology
 2B4D B;  4NJR A;  1TXR A;  4X8I A;  3JRU A;  3IIB A;  3VWE A;  5CPA A;  4NGM A;  5IB0 A;  4EME A;  4PK3 A;  3GY9 A;  1IOF A;  3H4Q A;  5EC4 A;  5LRJ A;  2POK A;  4OIW A;  1ZG9 A;  2PE3 A;  2PJC A;  4ZX8 A;  3DNS A;  2PJ5 A;  2XEI A;  3TT2 A;  4A2Z A;  1TF9 A;  4KOU A;  2P6E A;  3FEC A;  4FBE A;  3NH5 A;  2YNC A;  1YLE A;  5LYD A;  4HKF A;  4KZT A;  1SQH A;  1LRZ A;  2DPT A;  1QMU A;  2JBJ A;  1A2Z A;  3N7Z A;  2ARH A;  2PJ6 A;  1FY7 A;  3CDX A;  4OLL A;  3LAC A;  3S9M A;  3T90 A;  3CPX A;  1IID A;  1DTD A;  5LYF A;  1NE9 A;  4EVY A;  4CGP A;  2B4B A;  1CX8 A;  3FED A;  5I0C A;  4UEZ A;  3GB0 A;  4JXR A;  2G3T A;  3D67 A;  2AFZ A;  5H86 A;  1UFH A;  1F2P A;  2C27 A;  2YNC C;  8CPA A;  2G0B A;  2JEW A;  4IK2 A;  2NSM A;  2XEJ A;  2GFQ A;  1OZP A;  5HVG A;  1IU8 A;  2PJB A;  1Q2D A;  2B3V A;  3B3W A;  3FB3 A;  4CRZ B;  3B3T A;  2BOA A;  3DR6 A;  2R1I A;  3A9L A;  1FT7 A;  1BO4 A;  4KUB A;  4LQ6 A;  4WWV A;  3WT4 A;  1PYT B;  1WK4 A;  4RUH A;  4JZ0 A;  4R57 A;  4CGM A;  1XE4 A;  2IMO A;  3BI1 A;  1Q2C A;  4JD6 A;  3WC6 A;  2JDC A;  2VL1 A;  4J3G A;  2R8V A;  5AGE A;  3FVL A;  4IUS A;  4R3K A;  1Y7E A;  1RXT A;  5KTD A;  1GHE A;  3P2F A;  1R57 A;  1QSN A;  2F5I A;  2Z10 A;  3NH4 A;  1R43 A;  1Z8L A;  2PJ9 A;  3T8W A;  1YVO A;  2ZEP A;  4QVT A;  3SXO A;  3G3S A;  1CJW A;  5G21 A;  2OOT A;  2WSA A;  2ZEL A;  2AFX A;  2PR1 A;  4MCR A;  2AFS A;  3KL9 A;  4GXH A;  4CYP A;  3PB4 X;  2PCU A;  4C7H A;  1QSO A;  2BO9 A;  4NGT A;  4R3L A;  5G1Z A;  4A37 A;  4TWE A;  5KTC A;  2AFM A;  4CGO A;  3GYA A;  4PXC A;  2OZG A;  4CAW A;  4P10 A;  3E0K A;  3PB8 X;  1Z8W A;  1CP6 A;  4KSF A;  4H6U A;  4P6Y A;  1LFW A;  2PDO A;  3IEH A;  4QUS A;  1QSR A;  1PCA A;  4CYN A;  3V38 A;  2J8N A;  4UIA A;  3DR8 A;  3P2H A;  2BSW A;  3QB8 A;  5D29 A;  3BI0 A;  4ZGY B;  4P4I A;  4Q38 A;  3HLP A;  2OH1 A;  2OU2 A;  2V8G A;  1XRY A;  4UBR A;  1IGB A;  5LYI A;  2HQY A;  1JWQ A;  3B7I A;  1U6M A;  3CXP A;  5IB9 A;  2PQ8 A;  4QC6 A;  4UFX A;  5E96 A;  2CIJ A;  3W6S A;  4Z65 A;  5DWN A;  1XJO A;  4FUU A;  4NGN A;  4H2K A;  1QQ9 A;  3R9F A;  4MFP A;  1HDQ A;  3B3V A;  1AMP A;  3KR5 A;  4B10 A;  2Q7B A;  4X2T A;  1YX0 A;  1B6B A;  1Y9W A;  5G22 A;  2O28 A;  3PFO A;  5J8F A;  3HUV A;  2FCK A;  3GIU A;  4LUA A;  1KUY A;  3D66 A;  2ZEO A;  3KGQ A;  2PVW A;  1BPM A;  4PK2 A;  4X3R A;  2ZXV A;  3PFE A;  4MCP A;  2Q7S A;  4IF5 A;  2GAN A;  4KVM E;  4QBJ A;  3KQX A;  2ZOG A;  3MGD A;  4GM5 A;  4KUA A;  1OBR A;  5LRK A;  1IB1 E;  3H5Z A;  1MJA A;  3D2M A;  3LWU A;  2VBQ A;  1VHO A;  2ODF A;  3D7G A;  2VZZ A;  2PRB A;  3VWD A;  2H5M A;  1LAP A;  2WPW A;  5ISV A;  3PGP A;  4MFJ A;  3TCV A;  4O23 A;  2OB0 A;  3KI9 A;  5A27 A;  2PJA A;  1NSL A;  2I79 A;  3EC4 A;  2ZW6 A;  4TNU A;  4A31 A;  3BJ7 A;  3RYO A;  3JUW A;  1YR0 A;  3IFE A;  3S6G A;  4MFL A;  1CP7 A;  1VHS A;  5EBV A;  4ZY1 A;  1M44 A;  4R87 A;  3W91 A;  1S60 A;  2NYQ A;  2EUI A;  5F48 A;  4HNX B;  4NJQ A;  3B35 A;  2Z0Z A;  3D7F A;  4B12 A;  1X12 A;  4FD6 A;  2R98 A;  2Q4Z A;  2Z3M A;  4ZI6 A;  4P4F A;  4AVA A;  4UEF A;  3K9T A;  4UFV A;  2ZEE A;  3R96 A;  3IJ3 A;  1K4J A;  5D8N A;  4LX9 A;  1XMB A;  2ZOF A;  4AVB A;  5DS0 A;  5J1Q A;  3F5B A;  1Z8T A;  5ELY A;  3WAB A;  1F2O A;  4KS9 A;  2AFW A;  4KSI A;  1XEB A;  3GUX A;  2CXA A;  5F47 A;  3R1K A;  4P45 A;  2Z3L A;  4C2X A;  4R8F A;  1ZLH A;  2FIW A;  1PUA A;  4OID A;  3FH4 A;  3PB9 X;  3BLN A;  2RC4 A;  2PSW A;  2BL1 A;  4UF4 A;  4A39 A;  4B5O A;  1AUG A;  2O53 A;  2RFH A;  4XNH B;  1YQE A;  1S3Z A;  3NFZ A;  2ZEH A;  3PEI A;  2VZY A;  4OAE A;  3SI2 A;  4XNH C;  3MN8 A;  1L0C A;  4C7I A;  1KWM A;  2Q0Y A;  3D7D A;  4KOT A;  3QAH A;  4A95 A;  4KOX A;  4MFQ A;  1IY7 A;  3CT9 A;  3IWW A;  4G1P A;  4NGR A;  4OC2 A;  4NCZ A;  5CNP A;  1YK3 A;  3B3C A;  1LAN A;  2PJ2 A;  2CTC A;  1YME A;  1ZO0 A;  2B58 A;  2A4N A;  4HPS A;  5C82 A;  1LOK A;  2PR8 A;  3FX6 A;  2Q51 A;  3R9G A;  3H8F A;  4CYQ A;  3I3G A;  3EFA A;  3VAR A;  4FD5 A;  3S6H A;  3W6X A;  5HVF A;  1IIC A;  4AB7 A;  3FF3 A;  1Z4R A;  2CNT A;  4PXE A;  4A32 A;  5K8O A;  1I1D A;  4MHY A;  2D4P A;  3NA6 A;  2CNS A;  1EE3 P;  4U5Y A;  2FL4 A;  3F8K A;  2IQ6 A;  4U9Z A;  3EO4 A;  4X5K A;  3SHP A;  1XF8 A;  2CTB A;  2ABZ A;  3H8G A;  1CPX A;  4AG9 A;  4GS4 A;  2CNM A;  4PPZ A;  3EXN A;  3IWE A;  4JWP A;  4K30 A;  5IX3 A;  3FIX A;  4KOV A;  3FBU A;  3TOA A;  3G8W A;  4NF1 A;  5J8C A;  4Q36 A;  3IO1 A;  1UWY A;  4U9Y A;  5AG5 A;  2ZED A;  2DPS A;  2VI7 A;  2V8H A;  4KVX A;  2Z3N A;  1S7K A;  5HXD A;  2O4H A;  3JVN A;  2HV2 A;  2ATR A;  1HDU A;  4B11 A;  2HB6 A;  3CXS A;  3RZA A;  2BUE A;  2C6C A;  4OC1 A;  2FT0 A;  3D68 A;  3WR7 A;  2KCW A;  5CBM A;  4H6Z A;  4UIB A;  4BIN A;  3ISX A;  4UWI A;  4A30 A;  1XMT A;  3LMS A;  2HUZ A;  3WC7 A;  3RO0 A;  4CAE A;  2PJ0 A;  4KLW A;  1X10 A;  1B87 A;  4A38 A;  4R7M A;  1YW4 A;  2PJ7 A;  4F0Y A;  5C88 A;  2P6G A;  4R9M A;  3KZW A;  4KOS A;  4R6T A;  2EBJ A;  3KQZ A;  4OME A;  2QML A;  4OC5 A;  5EMI A;  2B5G A;  4ORF A;  2EK8 A;  1RTQ A;  4PXD A;  3S6F A;  1XFO A;  3ZZI A;  3I9S A;  2DXQ A;  1I12 A;  4B5P A;  3PRT A;  2Q4V A;  4RI1 A;  2PJ3 A;  4YU9 A;  2FIA A;  1HEE A;  4ZYQ A;  2FS5 A;  1KUX A;  4R76 A;  2JDD A;  7CPA A;  4NEX A;  1AYE A;  4FD7 A;  1I21 A;  3ISZ A;  3IU1 A;  1CM0 A;  1YGH A;  2GLJ A;  3PBB A;  2B5G B;  4NGP A;  3TO7 A;  4KOY A;  2G3A A;  4MBU A;  3V8I A;  1VGY A;  1Y0Y A;  1Z8X A;  4AG7 A;  4NFR A;  2Q4Y A;  3S9L A;  1S5K A;  4B5P B;  4KOR A;  3H8E A;  4HNY B;  2RB7 A;  2WUU A;  3K9U A;  4MJ8 A;  4L89 A;  1F57 A;  4MI4 A;  2EVN A;  2Z3K A;  2K5T A;  2ZEN A;  1N71 A;  3CXQ A;  3RAM A;  2YNE A;  4Y49 B;  2Q43 A;  3FRM A;  1M4G A;  4OC0 A;  3TC8 A;  4Y49 C;  3GKR A;  4C2Z A;  4DJL A;  2CY2 A;  2OZU A;  2BCO A;  4BD9 A;  5F46 A;  4UCP A;  4BBH A;  3N5F A;  4QB9 A;  3TE4 A;  4LQG A;  6CPA A;  4OC3 A;  4KSA A;  1ZLI A;  2V8V A;  4YGO A;  4CAF A;  4OAD A;  1NMT A;  2AE6 A;  3OWC A;  2IL4 A;  3B8G A;  3FEE A;  4UCN A;  1Q2Y A;  3D3S A;  3SXN A;  1Y7R A;  4XPK A;  2GIV A;  4II9 A;  1P4N A;  4E0A A;  2R7H A;  4PQA A;  1ELM P;  1MJ9 A;  5G20 A;  3TTH A;  3DGV A;  2PJ1 A;  2G9D A;  4PSW A;  3PB6 X;  4F6A A;  5HMN A;  2DEA A;  2HC9 A;  2PC1 A;  3PBE A;  5BWA B;  3KHX A;  3TOB A;  4E2A A;  2QVP A;  2EO8 A;  2ZEF A;  3D7H A;  5LYL A;  2REF A;  1VHE A;  2CF4 A;  2PJ4 A;  2EK9 A;  2X7B A;  3RBU A;  2ZW4 A;  4CGL A;  4PV6 A;  1S7F A;  2REE A;  1MJB A;  1TIQ A;  4KVO E;  4NSQ A;  4OC4 A;  4M3S A;  3PP9 A;  4AXV A;  5KTA A;  1KZF A;  2QJ8 A;  1S7N A;  2P6F A;  4L8A A;  3TO9 A;  3F0A A;  3B3S A;  3IGR A;  4ZX9 A;  2C6G A;  1RO5 A;  1Y9K A;  1M4I A;  1V0C A;  3D8P A;  4P4B A;  2C6P A;  5IV0 A;  1H8L A;  2Z3P A;  3SJE A;  5H84 A;  4JYW A;  3R9E A;  2C1C A;  5A28 A;  2VEZ A;  1KUV A;  1S7L A;  4EWT A;  3LD2 A;  3FYN A;  3DDD A;  2PIZ A;  4MCS A;  1ARM A;  1QST A;  2B3U A;  3DSB A;  4MHP A;  1YRE A;  2GLF A;  2PRQ A;  4MFZ A;  2QYV A;  3TX8 A;  3BXM A;  4MCQ A;  4MMO A;  1ON0 A;  1LCP A;  1XBU A;  4NGQ A;  3S9N A;  4NXY A;  3SJF A;  2JBK A;  1IYK A;  2J8M A;  3FNC A;  4ZBG A;  4RS2 A;  1M4D A;  1Z9U A;  2OZH A;  5DWM A;  2ZEM A;  3BJ8 A;  3C26 A;  2PIY A;  3SJG A;  3NE8 A;  4RN7 A;  5HH1 A;  3KKW A;  4CGN A;  2AFU A;  3SI1 A;  1TKH A;  3VAT A;  4UFW A;  4AVC A;  3NE7 A;  4H89 A;  4CPA A;  3D4U A;  4MRI A;  1TKJ A;  1YW6 A;  3QAY A;  3EY5 A;  4XPD B;  4P4D A;  4B14 A;  4C68 A;  1R3N A;  5I4M A;  4HNW B;  4P4J A;  1TF8 A;  2IJZ A;  2Y0M A;  4M85 A;  4XPD C;  1PU9 A;  1XIX A;  5K8M A;  1YLO A;  3QNV A;  5AG7 A;  2VXK A;  2J8R A;  4JJX A;  5LRG A;  2V77 A;  5FVJ A;  2WZN A;  2ZPA A;  4YWY A;  1GYT A;  2WPX A;  2QIR A;  3WC5 A;  3SI0 A;  5AG4 A;  1Y0R A;  4WJB A;  3UY5 A;  4MFK A;  4W9Y A;  4KLV A;  5JH9 A;  2QEC A;  5F09 A;  2PJ8 A;  4MXU A;  5JGF A;  5JQ4 A;  4E8O A;  3DLJ A;  4CYO A;  1CG2 A;  3CPA A;  3FJU A;  3B2Y A;  4ONW A;  1CPS A;  4PXB A;  3S6K A;  4CAX A;  1CBX A;  2FE7 A;  1IYL A;  4IAV A;  2XEF A;  2Z3O A;  2OR4 A;  2FSR A;  3KHZ A;  5JM6 A;  4OKO A;  5HVH A;  2D4O A;  5THW A;  2JEV A;  3SJX A;  4M6H A;  1DE4 C;  2P0W A;  1BOB A;  4YRH A;  4F9U A;  1XOV A;  2I3C A;  5AG6 A;  3L2N A;  3GLJ A;  1ELL P;  4NGS A;  3BHX A;  4UWJ A;  2WYR A;  2AFO A;  1WWZ A;  2EWB A;  4MY3 A;  2Z11 A;  4I49 A;  4P4E A;  2V8D A;  2ZW5 A;  3CZX A;  4EFD A;  5K8N A;  1Z4E A;  1ZG7 A;  1VIX A;  4UCM A;  4F8Z A;  2ZEG A;  1Z2L A;  2NMT A;  1ARL A;  1NSA A;  3IWG A;  1Q7L A;  4IHM A;  4MHZ A;  5GCN A;  3KAS A;  1QSM A;  2J9A A;  4F9V A;  1BPN A;  1IOI A;  1YSJ A;  4FD4 A;  3T9Y A;  3VH9 A;  5K8P A;  3PB7 X;  4BMH A;  3ZJ0 A;  1M1D A;  5JPH A;  2BEI A;  2YND A;  4PSX A;  4ZY2 A;  4CRY B;  1LAM A;  2F7V A;  3MRU A;  4DYO A;  2Q04 A;  4ZY0 A;  4XPL A;  4B13 A;  3V7Z A;  2ANP A;  4B6Z A;  1MK4 A;  4OP4 A;  2XEG A;  4FWU A;  4K3N A;  1ZG8 A;  1YVK A;  4P44 A;  4M6I A;  3K2K A;  2GE3 A;  2YGW A;  3KR4 A;  4A33 A;  3PZJ A;  2F8H A;  1M4L A;  4KOW A;  3TO6 A;  1TKF A;  4C2Y A;  4CS0 B;  3TFY A;  1BLL E;  3RNZ A;  2DF5 A;  1P0H A;  2FXF A;  2PVV A;  1Z5R A;  2AJ6 A;  3FMC A;  4ONU A;  4Q7A A;  4F0X A;  4FAI A;  4JLY A;  2FVG A;  3IU2 A;  4MY0 A;  1BAV A;  3LOD A;  2B4D A;  2ZW7 A;  3D2P A;  1VKC A;  3FXT A;  4JXQ A;  4UEE A;  5F49 A;  2GU2 A;  4MHD A;  3JTK A;  2VQY A;  3R95 A;  1JQG A;  4MHN A;  2Q44 A;  4M6G A;  4UA3 A;  3IC1 A;  2JLM A;  1FNO A;  4A94 A;  3NH8 A;  4DUK A;  2GRE A;  4YFJ A;  2I00 A;  1J4J A;  4DNC A;  3I1U A;  4CAV A; 
#chains in the Genus database with same CATH homology
 2B4D B;  3VWE A;  5IB0 A;  4PK3 A;  3GY9 A;  3H4Q A;  5EC4 A;  3DNS A;  3TT2 A;  4A2Z A;  4KOU A;  2P6E A;  2YNC A;  1YLE A;  4HKF A;  4KZT A;  1SQH A;  1LRZ A;  2DPT A;  3N7Z A;  2ARH A;  1FY7 A;  4OLL A;  3T90 A;  1IID A;  1NE9 A;  4EVY A;  4CGP A;  2B4B A;  5I0C A;  4JXR A;  2G3T A;  5H86 A;  1UFH A;  2C27 A;  2YNC C;  2G0B A;  1OZP A;  1Q2D A;  2B3V A;  3FB3 A;  4CRZ B;  3DR6 A;  2R1I A;  3A9L A;  1BO4 A;  4KUB A;  1WK4 A;  4R57 A;  4CGM A;  1XE4 A;  1Q2C A;  4JD6 A;  2JDC A;  4J3G A;  2R8V A;  5AGE A;  4IUS A;  4R3K A;  5KTD A;  1RXT A;  1GHE A;  3P2F A;  1R57 A;  1QSN A;  2F5I A;  2Z10 A;  1YVO A;  4QVT A;  3SXO A;  3G3S A;  1CJW A;  5G21 A;  2WSA A;  2PR1 A;  4CYP A;  4C7H A;  1QSO A;  4R3L A;  5G1Z A;  5KTC A;  4CGO A;  3GYA A;  2OZG A;  4CAW A;  3E0K A;  4KSF A;  4H6U A;  2PDO A;  4QUS A;  1QSR A;  4CYN A;  2J8N A;  3DR8 A;  3P2H A;  2BSW A;  3QB8 A;  4ZGY B;  4Q38 A;  2OH1 A;  2OU2 A;  4UBR A;  2HQY A;  1U6M A;  3CXP A;  2PQ8 A;  4QC6 A;  4UFX A;  5E96 A;  3W6S A;  5DWN A;  3R9F A;  4MFP A;  4B10 A;  2Q7B A;  1YX0 A;  1B6B A;  1Y9W A;  5G22 A;  2O28 A;  5J8F A;  2FCK A;  4LUA A;  1KUY A;  4PK2 A;  2ZXV A;  4IF5 A;  2GAN A;  4KVM E;  4QBJ A;  3MGD A;  4KUA A;  1IB1 E;  3H5Z A;  1MJA A;  3D2M A;  2VBQ A;  2VZZ A;  2PRB A;  3VWD A;  2H5M A;  2WPW A;  5ISV A;  3PGP A;  4MFJ A;  3TCV A;  2OB0 A;  5A27 A;  1NSL A;  2I79 A;  3EC4 A;  2ZW6 A;  4A31 A;  3BJ7 A;  3RYO A;  3JUW A;  1YR0 A;  3S6G A;  4MFL A;  1VHS A;  5EBV A;  1M44 A;  4R87 A;  3W91 A;  1S60 A;  2EUI A;  5F48 A;  4HNX B;  4B12 A;  2Z0Z A;  4FD6 A;  2R98 A;  2Z3M A;  4AVA A;  4UFV A;  3R96 A;  1K4J A;  4LX9 A;  4AVB A;  3F5B A;  4KS9 A;  1XEB A;  5F47 A;  2CXA A;  3R1K A;  2Z3L A;  4C2X A;  2FIW A;  1PUA A;  3BLN A;  2RC4 A;  2PSW A;  2BL1 A;  4B5O A;  4XNH B;  1S3Z A;  4OAE A;  2VZY A;  4XNH C;  1L0C A;  4C7I A;  2Q0Y A;  4A95 A;  4KOT A;  3QAH A;  4KOX A;  4MFQ A;  5CNP A;  4NCZ A;  1YK3 A;  1ZO0 A;  2B58 A;  2A4N A;  5C82 A;  2PR8 A;  3R9G A;  4CYQ A;  3I3G A;  3EFA A;  4FD5 A;  3S6H A;  3W6X A;  1IIC A;  4AB7 A;  1Z4R A;  2CNT A;  4A32 A;  1I1D A;  2D4P A;  4U5Y A;  2CNS A;  2FL4 A;  3F8K A;  4U9Z A;  3EO4 A;  4X5K A;  3SHP A;  1XF8 A;  4AG9 A;  4GS4 A;  2CNM A;  3EXN A;  3IWE A;  4JWP A;  4K30 A;  5IX3 A;  3FIX A;  4KOV A;  3FBU A;  3TOA A;  3G8W A;  4NF1 A;  5J8C A;  4Q36 A;  4U9Y A;  5AG5 A;  2DPS A;  2VI7 A;  4KVX A;  2Z3N A;  1S7K A;  3JVN A;  2HV2 A;  2ATR A;  4B11 A;  3CXS A;  2BUE A;  2FT0 A;  3WR7 A;  2KCW A;  4H6Z A;  4UWI A;  4A30 A;  1XMT A;  2HUZ A;  4CAE A;  4KLW A;  1B87 A;  4F0Y A;  5C88 A;  2P6G A;  4R9M A;  4KOS A;  2QML A;  2B5G A;  4ORF A;  3S6F A;  3ZZI A;  3I9S A;  2DXQ A;  1I12 A;  4B5P A;  2Q4V A;  4RI1 A;  2FIA A;  2FS5 A;  1KUX A;  2JDD A;  4NEX A;  4FD7 A;  1I21 A;  3IU1 A;  1CM0 A;  1YGH A;  2B5G B;  3TO7 A;  4KOY A;  2G3A A;  4MBU A;  3V8I A;  4AG7 A;  2Q4Y A;  1S5K A;  4B5P B;  4KOR A;  4HNY B;  2WUU A;  3K9U A;  4MJ8 A;  4L89 A;  4MI4 A;  2EVN A;  2Z3K A;  2K5T A;  3CXQ A;  1N71 A;  2YNE A;  4Y49 B;  3FRM A;  1M4G A;  4Y49 C;  3GKR A;  4C2Z A;  2CY2 A;  2OZU A;  5F46 A;  4UCP A;  4BBH A;  4QB9 A;  3TE4 A;  4YGO A;  4KSA A;  4CAF A;  4OAD A;  1NMT A;  2AE6 A;  3OWC A;  2IL4 A;  3B8G A;  4UCN A;  3SXN A;  1Q2Y A;  3D3S A;  1Y7R A;  4XPK A;  2GIV A;  4II9 A;  1P4N A;  4E0A A;  2R7H A;  1MJ9 A;  5G20 A;  3TTH A;  4PSW A;  4F6A A;  5HMN A;  5BWA B;  2PC1 A;  3TOB A;  4E2A A;  2REF A;  2X7B A;  4CGL A;  2ZW4 A;  4PV6 A;  1S7F A;  2REE A;  1MJB A;  1TIQ A;  4KVO E;  4NSQ A;  4M3S A;  3PP9 A;  5KTA A;  1KZF A;  1S7N A;  2P6F A;  4L8A A;  3TO9 A;  3F0A A;  3IGR A;  1RO5 A;  1Y9K A;  1M4I A;  1V0C A;  3D8P A;  5IV0 A;  2Z3P A;  5H84 A;  3R9E A;  5A28 A;  2VEZ A;  1KUV A;  1S7L A;  3LD2 A;  3FYN A;  3DDD A;  1QST A;  2B3U A;  3DSB A;  1YRE A;  4MFZ A;  1ON0 A;  4NXY A;  1IYK A;  2J8M A;  3FNC A;  4ZBG A;  4RS2 A;  1M4D A;  1Z9U A;  2OZH A;  5DWM A;  3C26 A;  3BJ8 A;  5HH1 A;  3KKW A;  4CGN A;  4AVC A;  4UFW A;  3NE7 A;  4H89 A;  4XPD B;  4B14 A;  3EY5 A;  4C68 A;  4HNW B;  4XPD C;  2Y0M A;  4M85 A;  1PU9 A;  1XIX A;  5AG7 A;  2VXK A;  2J8R A;  4JJX A;  5FVJ A;  2ZPA A;  2WPX A;  2QIR A;  5AG4 A;  3UY5 A;  4MFK A;  4KLV A;  2QEC A;  5JQ4 A;  4E8O A;  4CYO A;  4CAX A;  3S6K A;  2FE7 A;  1IYL A;  2Z3O A;  2FSR A;  2D4O A;  2JEV A;  2P0W A;  4YRH A;  1BOB A;  5AG6 A;  4UWJ A;  1WWZ A;  4MY3 A;  2Z11 A;  4I49 A;  2ZW5 A;  1Z4E A;  4UCM A;  2NMT A;  3IWG A;  5GCN A;  1QSM A;  4FD4 A;  3T9Y A;  4BMH A;  3ZJ0 A;  1M1D A;  5JPH A;  2BEI A;  2YND A;  4PSX A;  4CRY B;  2Q04 A;  4XPL A;  4B13 A;  1MK4 A;  1YVK A;  2GE3 A;  2YGW A;  4A33 A;  3PZJ A;  4KOW A;  3TO6 A;  4C2Y A;  4CS0 B;  3TFY A;  1P0H A;  2FXF A;  4ONU A;  2AJ6 A;  4F0X A;  4JLY A;  3IU2 A;  4MY0 A;  3LOD A;  2B4D A;  2ZW7 A;  3D2P A;  1VKC A;  3FXT A;  4JXQ A;  5F49 A;  4MHD A;  3JTK A;  2VQY A;  3R95 A;  2Q44 A;  4UA3 A;  2JLM A;  4YFJ A;  2I00 A;  1J4J A;  4DNC A;  4CAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...