5I0CA

Crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
89
Chain Sequence
EIREGHNKFYINDQGKQIAEIVFVPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted acyltransferase YjdJ with acyl-CoA N-acyltransferase domain from Escherichia coli str. K-12
rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Uncharacterized protein YjdJ
total genus 25
structure length 89
sequence length 90
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5i0cA00
5IB0A 1R57A 1RO5A 4K30A 5FVJA 4HNWB 2OB0A 2FIWA 2PC1A 2OZGA 2B4DB 3CXQA 3IGRA 2X7BA 4XPKA 2REEA 2FL4A 2B3VA 2WPXA 3EY5A 4XPLA 3D2MA 4NF1A 4AVBA 1Y9WA 3TTHA 3LODA 3FNCA 3MGDA 2BL1A 1WWZA 5F47A 3W91A 4HKFA 5F46A 4B5PA 2PR1A 3PZJA 2J8MA 4AG7A 2GE3A 2K5TA 2Q4VA 4ZBGA 4E8OA 3I3GA 3R1KA 4XPDC 2ZXVA 2BSWA 1XE4A 4DNCA 1QSNA 1PU9A 4QBJA 3TO6A 3EFAA 4MY0A 4HNYB 4XNHB 2P6FA 4QUSA 5F48A 1YGHA 1Q2DA 4CAWA 3F5BA 4L8AA 3W6SA 4R87A 5GCNA 1QSTA 1BOBA 4NCZA 5EBVA 3SHPA 4CS0B 3R96A 4FD6A 4R57A 1M4DA 3SXOA 2ZW4A 4GS4A 1YK3A 2Q7BA 4M85A 2BUEA 1Y9KA 2VZYA 2HUZA 1ON0A 5H86A 1KUXA 2FXFA 1I12A 4NEXA 5KTAA 2FT0A 3VWEA 3DR8A 3GYAA 2QMLA 4IF5A 4NSQA 2GANA 2PSWA 2EUIA 1L0CA 4FD4A 2NMTA 3PGPA 2QIRA 3R95A 4BMHA 1CM0A 2Z11A 3S6KA 1Q2YA 1Z4EA 2G0BA 1YLEA 4PSXA 4UWIA 2R7HA 4R3KA 2HQYA 4XNHC 2Z10A 2J8RA 4KZTA 2JDDA 1YVOA 1V0CA 3B8GA 1MJ9A 3TO7A 4RI1A 2H5MA 5J8CA 3TT2A 1KZFA 1S5KA 1NE9A 1S7LA 2QECA 2VXKA 3W6XA 1NMTA 1WK4A 3FB3A 4JWPA 4LX9A 5HH1A 4QC6A 2Q04A 2CNTA 2R98A 4EVYA 3T90A 4OADA 5JPHA 1IICA 2PDOA 2JEVA 4UWJA 3EO4A 1YR0A 1M4GA 3S6FA 2FSRA 4KOVA 3P2FA 2G3AA 1S7KA 2B58A 4JJXA 4MJ8A 1FY7A 1M1DA 2CY2A 3RYOA 1LRZA 4F0YA 4I49A 4XPDB 2D4OA 4KVME 3EC4A 2B4BA 4QVTA 3NE7A 5EC4A 2I79A 4KVXA 4KOYA 4R9MA 1IIDA 3LD2A 4KLWA 3P2HA 2VBQA 4NXYA 1S7FA 4PK3A 2RC4A 4H6UA 4CAVA 2VZZA 2P6GA 3DNSA 2VQYA 4AVAA 4Y49C 2ZW5A 3GKRA 4II9A 2ZW6A 1Q2CA 3FBUA 1CJWA 1RXTA 3PP9A 2FIAA 2OZUA 3BLNA 2CNSA 3TFYA 2PR8A 3ZJ0A 3D3SA 5F49A 4KOXA 1QSRA 1UFHA 2OH1A 3QAHA 4RS2A 3TE4A 2F5IA 4PSWA 1Y7RA 1S60A 2GIVA 5DWNA 1NSLA 3H4QA 3TO9A 4JD6A 4H6ZA 5KTCA 2PQ8A 2JDCA 3OWCA 3F8KA 3I9SA 4PV6A 3DDDA 3FRMA 3VWDA 2REFA 1BO4A 4FD5A 2I00A 4IUSA 1S7NA 4R3LA 2A4NA 5KTDA 1VHSA 3SXNA 4E0AA 4UA3A 2Q44A 1J4JA 1VKCA 3FIXA 3T9YA 1XMTA 4PK2A 2P6EA 1MJAA 4KLVA 4CRYB 2Q4YA 5I0CA 3ZZIA 3FYNA 1XF8A 4Y49B 4KUBA 1B87A 2Y0MA 3R9FA 1N71A 2B3UA 3GY9A 4M3SA 5IX3A 2IL4A 1K4JA 1IYLA 1PUAA 3R9EA 4U9ZA 5HMNA 3CXPA 4MI4A 2HV2A 4KOWA 1M4IA 1OZPA 2BEIA 4HNXB 1I21A 4ONUA 4B5OA 4CRZB 4X5KA 2R1IA 5E96A 1TIQA 4FD7A 3KKWA 4KOTA 5C88A 3QB8A 1I1DA 1MK4A 5ISVA 1Z9UA 2VI7A 1GHEA 1P0HA 3R9GA 3G8WA 3CXSA 2EVNA 2VEZA 5J8FA 4AG9A 3EXNA 1MJBA 4CAXA 3TOBA 3E0KA 1XEBA 4F6AA 3IWGA 2ARHA 2P0WA 2ZPAA 2DXQA 2KCWA 2CNMA 4B5PB 3BJ8A 3K9UA 3DR6A 3N7ZA 4KORA 3JVNA 1SQHA 4MBUA 4J3GA 1QSOA 2ZW7A 4JLYA 3S6GA 1B6BA 4KOSA 1P4NA 3TOAA 1KUYA 4YRHA 4KVOE 2ATRA 3UY5A 5DWMA 2R8VA 2AJ6A 3TCVA 1M44A 3D2PA 3FXTA 4YGOA 3V8IA 3G3SA 4H89A 4JXRA 2B4DA 2OU2A 3WR7A 1YX0A 2C27A 5JQ4A 3D8PA 2Z0ZA 4ORFA 2FE7A 1IB1E 2FCKA 2B5GA 4JXQA 2PRBA 4KUAA 2WPWA 4QB9A 3C26A 1S3ZA 4LUAA 1QSMA 4U9YA 2O28A 2OZHA 2D4PA 3F0AA 1YVKA 4AB7A 1U6MA 4KOUA 5H84A 3BJ7A 2FS5A 3DSBA 5CNPA 4U5YA 1YREA 2G3TA 2Q0YA 2J8NA 1IYKA 4OLLA 3S6HA 4MHDA 4UBRA 4MY3A 5C82A 4YFJA 4OAEA 4E2AA 5IV0A 4AVCA 2JLMA 3JUWA 4L89A 2AE6A 1KUVA 2B5GB 1XIXA 1Z4RA
chains in the Genus database with same CATH superfamily
4MCSA 5IB0A 1R57A 1RO5A 2AFXA 2YNCA 1Y0RA 2O53A 3FX6A 1F2PA 4K30A 5FVJA 4HNWB 2OB0A 2FIWA 2HC9A 1Z2LA 2PC1A 1IU8A 2OZGA 2B4DB 3CXQA 3IGRA 2X7BA 3D68A 3NH4A 4ZI6A 4XPKA 3K9TA 2REEA 2FL4A 2B3VA 2WPXA 3EY5A 4XPLA 3D2MA 4NF1A 4AVBA 3H5ZA 1TKHA 1Y9WA 3TTHA 3K2KA 4RUHA 3LODA 3FNCA 4NGQA 4P4DA 4A32A 1LOKA 5K8MA 3MGDA 2QYVA 4GXHA 2XEGA 2BL1A 5JGFA 1WWZA 2ANPA 2ZOGA 5F47A 3W91A 1LCPA 4KSAA 2YNEA 4HKFA 5F46A 4B5PA 2PR1A 5HVHA 5G1ZA 4UEEA 4O23A 3PZJA 2J8MA 1CG2A 4AG7A 4CYOA 1YQEA 2GE3A 1IOFA 2AFSA 2PIYA 2PJ0A 2Z3LA 1XBUA 2PJCA 3B3TA 2OR4A 2WSAA 1ELLP 2ZEMA 3PBEA 1XRYA 2K5TA 2ZEDA 3VH9A 1QQ9A 1R3NA 2Q4VA 3GLJA 4YWYA 4CGLA 4ZBGA 3B3WA 3I3GA 4E8OA 3D66A 3IWEA 3R1KA 4XPDC 2IMOA 3FJUA 4IAVA 4OC4A 2ZXVA 2CIJA 3CPXA 2Z3MA 4OIWA 2AFOA 2BSWA 1XE4A 4DNCA 1QSNA 1PU9A 1CPXA 4QBJA 3TO6A 3EFAA 3IU1A 4MY0A 1PYTB 5K8OA 4HNYB 4XNHB 4PXDA 2P6FA 4UIBA 4QUSA 5F48A 3PB8X 4UEFA 2PJ6A 3FEDA 4KSFA 2FVGA 2Q7SA 4UF4A 1YGHA 3PB4X 3BHXA 1Q2DA 1YMEA 4UFWA 4WWVA 3FEEA 4C7IA 4CAWA 3F5BA 4L8AA 3W6SA 3KHXA 3JRUA 4ZY0A 4R87A 1FNOA 5GCNA 1QSTA 1BOBA 4NCZA 4PQAA 5EBVA 3SHPA 2CTCA 4M6IA 3R96A 4CS0B 4FD6A 1VHOA 1M4DA 2F7VA 2AFZA 1XFOA 3QAYA 1YW6A 4R57A 3SXOA 2ZW4A 1LANA 4GS4A 3CZXA 3NA6A 2JBKA 4MCRA 1YK3A 2ZEGA 2PJ5A 3H8EA 2Q51A 4NGSA 2Q7BA 4EWTA 4A39A 4M85A 3T8WA 2BUEA 1Y9KA 2VZYA 4B10A 1LFWA 2HUZA 4MMOA 1VHEA 1ON0A 5H86A 4CAEA 2F8HA 1KUXA 1XJOA 2FXFA 1I12A 4NEXA 5AGEA 5KTAA 5JH9A 2FT0A 5G22A 5G20A 1R43A 3D67A 3DR8A 3VWEA 2EWBA 3MN8A 2PJ1A 2ZEFA 3GYAA 5AG5A 1BAVA 1ZG8A 4YU9A 4OC1A 3PB9X 1TKFA 4FBEA 1H8LA 2QMLA 2PJ2A 4IF5A 4NSQA 2GANA 4CYNA 3LACA 2PSWA 4DJLA 2EUIA 1L0CA 4FD4A 2NMTA 5LYFA 3GB0A 3PGPA 2QIRA 3R95A 4BMHA 1CM0A 4OC5A 2G9DA 2Z11A 3S6KA 1Q2YA 1Z4EA 2G0BA 1YLEA 1TXRA 4PSXA 5HVGA 1BLLE 2YNDA 4UWIA 2AFWA 1ELMP 2R7HA 4R3KA 3JTKA 2HQYA 4XNHC 4CYPA 2ZENA 2Z10A 2VL1A 4IHMA 4F8ZA 2J8RA 4P4JA 5LRJA 4KZTA 1ZLHA 3ISXA 2JDDA 1YVOA 1V0CA 2XEJA 3B8GA 1MJ9A 2PRQA 3IWWA 3TO7A 4R8FA 2QJ8A 6CPAA 1ZG9A 4RI1A 2H5MA 4R76A 3KR4A 3FH4A 5J8CA 3KL9A 4P44A 3IIBA 4OP4A 4F9VA 2RB7A 1F2OA 4ZYQA 1YLOA 4MHZA 1LAMA 2V8HA 3TT2A 1KZFA 1S5KA 1NE9A 1S7LA 2QECA 2VXKA 4PXCA 3IJ3A 3BI0A 2NYQA 3W6XA 4B13A 4OC3A 4MFQA 2BCOA 1NMTA 1TF9A 1WK4A 3FB3A 1A2ZA 4H2KA 4JWPA 4LX9A 1BPMA 2QVPA 3S9NA 5HH1A 4QC6A 2Q04A 3TC8A 2CNTA 2R98A 4EVYA 2V8DA 3T90A 4OADA 5JPHA 1IICA 2PDOA 2JEVA 3NH8A 4UWJA 3EO4A 1YR0A 1M4GA 3S6FA 2FSRA 1OBRA 4KOVA 4NJQA 4Z65A 1AYEA 3P2FA 2G3AA 1S7KA 1PCAA 2B58A 4JJXA 4MJ8A 1FY7A 1M1DA 2CY2A 3RYOA 4IK2A 1IGBA 2PJ7A 1LRZA 5LRGA 3QNVA 3MRUA 5JM6A 4NFRA 4UEZA 4W9YA 2XEIA 4F0YA 4GM5A 1Z8WA 4I49A 2Z3KA 4XPDB 5HXDA 4OKOA 2D4OA 4KVME 3EC4A 2B4BA 2PJ3A 1X10A 4QVTA 3NE7A 5EC4A 2I79A 2ZEEA 4KVXA 3S9MA 4KOYA 4R9MA 1IIDA 4A94A 3CT9A 3LD2A 3P2HA 4KLWA 2VBQA 4NXYA 5EMIA 1S7FA 4PK3A 3FMCA 4KS9A 2RC4A 4B12A 3HLPA 2PCUA 4H6UA 2VZZA 2P6GA 3DNSA 2VQYA 4AVAA 4CAVA 1CP6A 2NSMA 3L2NA 1YSJA 4Y49C 4P45A 1VGYA 2PE3A 2ZW5A 1CP7A 2IQ6A 3GKRA 1ZO0A 2ZW6A 1Q2CA 3FBUA 4MXUA 4II9A 1CJWA 4A37A 1RXTA 1Q7LA 4OIDA 2WYRA 3PP9A 4BBHA 5K8NA 2FIAA 8CPAA 2OZUA 4F0XA 3BLNA 2BOAA 4DYOA 5CPAA 3S9LA 2PJ9A 1CBXA 2WUUA 5LYLA 3PB7X 5D29A 1IY7A 1Z5RA 4CGPA 3B3CA 2CNSA 3TFYA 2PR8A 2Q43A 3ZJ0A 5ELYA 3D3SA 1BPNA 3KQZA 3RZAA 5F49A 1CPSA 4KOXA 3TX8A 1QSRA 1UFHA 2OH1A 3QAHA 4HPSA 2WZNA 4RS2A 3TE4A 5BWAB 4Q38A 5CBMA 2F5IA 4R7MA 4PSWA 3KZWA 1Y7RA 2CTBA 2PIZA 1S60A 2GIVA 1XOVA 3VARA 4FAIA 5DWNA 1NSLA 3H4QA 3TO9A 5D8NA 4JD6A 3IFEA 3ISZA 4M6HA 4H6ZA 3I1UA 3A9LA 5KTCA 3PB6X 2RFHA 2PQ8A 4MFLA 4PXBA 2JDCA 1Y7EA 3OWCA 3F8KA 3I9SA 4UCPA 1ZLIA 2DPSA 4PV6A 4ZY1A 4AXVA 3DDDA 4LQ6A 3CPAA 3FRMA 4P4IA 4Q7AA 3VWDA 2REFA 3KGQA 4NJRA 1BO4A 3D7FA 4FD5A 4MHNA 2Z3PA 5J1QA 2I00A 4MFJA 4IUSA 1S7NA 4R3LA 2A4NA 5AG7A 5LYIA 1VHSA 3SXNA 2ZOFA 5KTDA 4E0AA 3N5FA 4UA3A 4X8IA 2Q44A 2V8VA 4PPZA 1J4JA 4MHPA 3V38A 1AUGA 1VKCA 3FIXA 3KQXA 3T9YA 4C2ZA 5A28A 1XMTA 4PK2A 2P6EA 1MJAA 2CXAA 3GIUA 4KLVA 4CRYB 3CDXA 2Q4YA 5I0CA 3IC1A 1ARLA 2ABZA 4P6YA 3ZZIA 2PJ8A 1X12A 4OC2A 4UCMA 3FYNA 1EE3P 1XF8A 4B11A 5LYDA 5K8PA 4Y49B 3KHZA 4EMEA 4KUBA 1B87A 4M6GA 2YNCC 2Y0MA 4LQGA 2C6CA 1QMUA 5DS0A 4ZX9A 3PBBA 4UCNA 3R9FA 7CPAA 1N71A 2Z3NA 3DLJA 4B14A 2B3UA 3GY9A 4M3SA 4TWEA 4ZGYB 5IX3A 2IL4A 1K4JA 1IYLA 1PUAA 3R9EA 3SI2A 2AFUA 3WC5A 2C6GA 3D7GA 4FWUA 1Z8XA 3NH5A 2CF4A 4ZX8A 2I3CA 4U9ZA 4X3RA 4F9UA 5HMNA 3B2YA 3CXPA 4MI4A 2HV2A 4KOWA 1Y0YA 1M4IA 1OZPA 1ZG7A 2BEIA 5I4MA 4HNXB 3LWUA 2JBJA 4RN7A 2DEAA 1I21A 4KSIA 4ONUA 4NGPA 4B5OA 3WC6A 4P4FA 4A31A 4CRZB 2POKA 4MCPA 4X5KA 2J9AA 2R1IA 1Z8TA 4MRIA 5E96A 1TIQA 1HDQA 2ODFA 4FD7A 3KKWA 4KOTA 4B6ZA 2EBJA 5C88A 4MFZA 3QB8A 1UWYA 4BINA 1I1DA 1MK4A 4C68A 2PJBA 5ISVA 5IB9A 1Z9UA 2VI7A 2ZEPA 2ZEHA 1GHEA 1P0HA 3R9GA 2IJZA 4A38A 2DF5A 4OMEA 3RAMA 3G8WA 4CYQA 3CXSA 2EVNA 1GYTA 2BO9A 2GREA 2VEZA 4P4BA 5J8FA 4CGNA 4NGRA 1YW4A 4WJBA 4AG9A 3B7IA 3EXNA 1NSAA 4MFPA 1MJBA 5G21A 1HEEA 2JEWA 4NGTA 4C2XA 4CAXA 2Z3OA 3TOBA 2HB6A 3H8GA 3E0KA 1XEBA 4F6AA 3B3VA 3IWGA 2ARHA 2PVVA 3D7HA 2P0WA 2ZPAA 2DXQA 2PJAA 2KCWA 2CNMA 2GFQA 2YGWA 4B5PB 2V8GA 3BJ8A 4EFDA 3K9UA 4A33A 3SJXA 2AFMA 3DR6A 3SI1A 1TF8A 2GLJA 3N7ZA 4KORA 3JVNA 3KI9A 1M4LA 1SQHA 4MBUA 4J3GA 3WABA 1QSOA 2GU2A 2EO8A 2ZW7A 4JLYA 1JWQA 1B6BA 4KOSA 3S6GA 1P4NA 3WC7A 3TOAA 2PVWA 1KUYA 4YRHA 4G1PA 4KVOE 5THWA 4X2TA 3SJGA 3V7ZA 2ATRA 2PJ4A 3B3SA 2OOTA 4ONWA 3UY5A 1AMPA 5DWMA 2R8VA 4MFKA 3DGVA 3RO0A 1TKJA 2AJ6A 4CAFA 4K3NA 3TCVA 1M44A 3D2PA 3FXTA 1Z8LA 2V77A 4NGMA 4P10A 4TNUA 4YGOA 3V8IA 1XMBA 1KWMA 3G3SA 4H89A 4JXRA 4A30A 2C1CA 4CGOA 2B4DA 4NGNA 2OU2A 3H8FA 3WR7A 1YX0A 1DTDA 3LMSA 2C27A 3HUVA 5JQ4A 3D8PA 5F09A 2Z0ZA 2O4HA 4ORFA 2FE7A 1IB1E 4UIAA 4C7HA 2FCKA 3PEIA 5HVFA 2B5GA 4CGMA 4UFVA 4UFXA 3IEHA 4JXQA 1ARMA 2PRBA 2WPWA 3FF3A 3FECA 2Q4ZA 4KUAA 4QB9A 3VATA 3C26A 3BI1A 1S3ZA 3PFOA 4LUAA 4CPAA 1QSMA 4U9YA 2O28A 2OZHA 3BXMA 1JQGA 3RBUA 4Q36A 1VIXA 3KASA 2D4PA 3F0AA 4FUUA 5AG4A 4JYWA 1HDUA 1YVKA 2EK9A 4AB7A 1U6MA 2EK8A 3NFZA 3GUXA 4KOUA 4OC0A 2DPTA 5H84A 1FT7A 2GLFA 2ZEOA 2ZELA 4BD9A 5LRKA 1F57A 4R6TA 2C6PA 3BJ7A 2FS5A 3DSBA 3PFEA 5CNPA 3WT4A 1IOIA 2XEFA 3FVLA 4U5YA 5AG6A 1YREA 1DE4C 1RTQA 2G3TA 2Q0YA 3PRTA 4MCQA 4C2YA 3RNZA 4A2ZA 3SI0A 3IO1A 2J8NA 1IYKA 1CX8A 3B35A 4PXEA 4DUKA 4OLLA 3IU2A 4JZ0A 1LAPA 4MHYA 4MHDA 3S6HA 5A27A 4ZY2A 4UBRA 4MY3A 5C82A 4P4EA 3D4UA 3D7DA 4YFJA 4OAEA 4E2AA 5IV0A 4AVCA 4A95A 2JLMA 3JUWA 3KR5A 4L89A 3SJFA 2AE6A 1KUVA 2B5GB 1XIXA 1Z4RA 3NE8A 3SJEA
chains in the Genus database with same CATH topology
5IB0A 1R57A 1RO5A 2YNCA 4K30A 5FVJA 4HNWB 2OB0A 2FIWA 2PC1A 2OZGA 2B4DB 3CXQA 3IGRA 2X7BA 4XPKA 2REEA 2FL4A 2B3VA 2WPXA 3EY5A 4XPLA 3D2MA 4NF1A 4AVBA 3H5ZA 1Y9WA 3TTHA 3LODA 3FNCA 4A32A 3MGDA 2BL1A 1WWZA 5F47A 3W91A 4KSAA 2YNEA 4HKFA 5F46A 4B5PA 2PR1A 5G1ZA 3PZJA 2J8MA 4AG7A 4CYOA 2GE3A 2Z3LA 2WSAA 2K5TA 4CGLA 2Q4VA 4ZBGA 4E8OA 3I3GA 3IWEA 3R1KA 4XPDC 2ZXVA 2Z3MA 2BSWA 1XE4A 4DNCA 1QSNA 1PU9A 4QBJA 3TO6A 3EFAA 3IU1A 4MY0A 4HNYB 4XNHB 2P6FA 4QUSA 5F48A 4KSFA 1YGHA 1Q2DA 4UFWA 4C7IA 4CAWA 3F5BA 4L8AA 3W6SA 4R87A 5GCNA 1QSTA 1BOBA 4NCZA 5EBVA 3SHPA 4CS0B 3R96A 4FD6A 1M4DA 4R57A 3SXOA 2ZW4A 4GS4A 1YK3A 2Q7BA 4M85A 2BUEA 1Y9KA 2VZYA 4B10A 2HUZA 1ON0A 5H86A 4CAEA 1KUXA 2FXFA 1I12A 4NEXA 5AGEA 5KTAA 2FT0A 5G22A 5G20A 3VWEA 3DR8A 5AG5A 3GYAA 2QMLA 4IF5A 4NSQA 2GANA 4CYNA 2PSWA 2EUIA 1L0CA 4FD4A 2NMTA 3PGPA 2QIRA 3R95A 4BMHA 1CM0A 2Z11A 3S6KA 1Q2YA 1Z4EA 2G0BA 1YLEA 4PSXA 2YNDA 4UWIA 2R7HA 4R3KA 3JTKA 2HQYA 4XNHC 4CYPA 2Z10A 2J8RA 4KZTA 2JDDA 1YVOA 1V0CA 3B8GA 1MJ9A 3TO7A 4RI1A 2H5MA 5J8CA 3TT2A 1KZFA 1S5KA 1NE9A 1S7LA 2QECA 2VXKA 3W6XA 4B13A 4MFQA 1NMTA 1WK4A 3FB3A 4JWPA 4LX9A 5HH1A 4QC6A 2Q04A 2CNTA 2R98A 4EVYA 3T90A 4OADA 5JPHA 1IICA 2PDOA 2JEVA 4UWJA 3EO4A 1YR0A 1M4GA 3S6FA 2FSRA 4KOVA 3P2FA 2G3AA 1S7KA 2B58A 4JJXA 4MJ8A 1FY7A 1M1DA 2CY2A 3RYOA 1LRZA 4F0YA 4I49A 2Z3KA 4XPDB 2D4OA 4KVME 3EC4A 2B4BA 4QVTA 3NE7A 5EC4A 2I79A 4KVXA 4KOYA 4R9MA 1IIDA 3LD2A 4KLWA 3P2HA 2VBQA 4NXYA 1S7FA 4PK3A 4KS9A 2RC4A 4B12A 4H6UA 4CAVA 2VZZA 2P6GA 3DNSA 2VQYA 4AVAA 4Y49C 2ZW5A 3GKRA 1ZO0A 2ZW6A 1Q2CA 3FBUA 4II9A 1CJWA 1RXTA 3PP9A 4BBHA 2FIAA 2OZUA 4F0XA 3BLNA 2WUUA 4CGPA 2CNSA 3TFYA 2PR8A 3ZJ0A 3D3SA 5F49A 4KOXA 1QSRA 1UFHA 2OH1A 3QAHA 4RS2A 3TE4A 5BWAB 4Q38A 2F5IA 4PSWA 1Y7RA 1S60A 2GIVA 5DWNA 1NSLA 3H4QA 3TO9A 4JD6A 4H6ZA 3A9LA 5KTCA 2PQ8A 4MFLA 2JDCA 3OWCA 3F8KA 3I9SA 4UCPA 2DPSA 4PV6A 3DDDA 3FRMA 3VWDA 2REFA 1BO4A 4FD5A 2Z3PA 2I00A 4MFJA 4IUSA 1S7NA 4R3LA 2A4NA 5AG7A 5KTDA 1VHSA 3SXNA 4E0AA 4UA3A 2Q44A 1J4JA 1VKCA 3FIXA 3T9YA 4C2ZA 5A28A 1XMTA 4PK2A 2P6EA 1MJAA 2CXAA 4KLVA 4CRYB 2Q4YA 5I0CA 3ZZIA 4UCMA 3FYNA 4B11A 1XF8A 4Y49B 4KUBA 1B87A 2YNCC 2Y0MA 4UCNA 3R9FA 1N71A 2Z3NA 4B14A 2B3UA 3GY9A 4M3SA 4ZGYB 5IX3A 2IL4A 1K4JA 1IYLA 1PUAA 3R9EA 4U9ZA 5HMNA 3CXPA 4MI4A 2HV2A 4KOWA 1M4IA 1OZPA 2BEIA 4HNXB 1I21A 4ONUA 4B5OA 4A31A 4CRZB 4X5KA 2R1IA 5E96A 1TIQA 4FD7A 3KKWA 4KOTA 5C88A 4MFZA 3QB8A 1I1DA 1MK4A 4C68A 5ISVA 1Z9UA 2VI7A 1GHEA 1P0HA 3R9GA 3G8WA 4CYQA 3CXSA 2EVNA 2VEZA 5J8FA 4CGNA 4AG9A 3EXNA 4MFPA 1MJBA 5G21A 4C2XA 4CAXA 2Z3OA 3TOBA 3E0KA 1XEBA 4F6AA 3IWGA 2ARHA 2P0WA 2ZPAA 2DXQA 2KCWA 2CNMA 2YGWA 4B5PB 3BJ8A 3K9UA 4A33A 3DR6A 3N7ZA 4KORA 3JVNA 1SQHA 4MBUA 4J3GA 1QSOA 2ZW7A 4JLYA 3S6GA 1B6BA 4KOSA 1P4NA 3TOAA 1KUYA 4YRHA 4KVOE 2ATRA 3UY5A 5DWMA 2R8VA 4MFKA 2AJ6A 4CAFA 3TCVA 1M44A 3D2PA 3FXTA 4YGOA 3V8IA 3G3SA 4H89A 4JXRA 4A30A 4CGOA 2B4DA 2OU2A 3WR7A 1YX0A 2C27A 5JQ4A 3D8PA 2Z0ZA 4ORFA 2FE7A 1IB1E 4C7HA 2FCKA 2B5GA 4CGMA 4UFVA 4UFXA 4JXQA 2PRBA 4KUAA 2WPWA 4QB9A 3C26A 1S3ZA 4LUAA 1QSMA 4U9YA 2O28A 2OZHA 4Q36A 2D4PA 3F0AA 5AG4A 1YVKA 4AB7A 1U6MA 4KOUA 2DPTA 5H84A 3BJ7A 2FS5A 3DSBA 5CNPA 5AG6A 4U5YA 1YREA 2G3TA 2Q0YA 4C2YA 4A2ZA 2J8NA 1IYKA 4OLLA 3IU2A 3S6HA 4MHDA 5A27A 4UBRA 4MY3A 5C82A 4YFJA 4OAEA 4E2AA 5IV0A 4AVCA 4A95A 2JLMA 3JUWA 4L89A 2AE6A 1KUVA 2B5GB 1XIXA 1Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IB0 A;  1R57 A;  1RO5 A;  4K30 A;  5FVJ A;  4HNW B;  2OB0 A;  2FIW A;  2PC1 A;  2OZG A;  2B4D B;  3CXQ A;  3IGR A;  2X7B A;  4XPK A;  2REE A;  2FL4 A;  2B3V A;  2WPX A;  3EY5 A;  4XPL A;  3D2M A;  4NF1 A;  4AVB A;  1Y9W A;  3TTH A;  3LOD A;  3FNC A;  3MGD A;  2BL1 A;  1WWZ A;  5F47 A;  3W91 A;  4HKF A;  5F46 A;  4B5P A;  2PR1 A;  3PZJ A;  2J8M A;  4AG7 A;  2GE3 A;  2K5T A;  2Q4V A;  4ZBG A;  4E8O A;  3I3G A;  3R1K A;  4XPD C;  2ZXV A;  2BSW A;  1XE4 A;  4DNC A;  1QSN A;  1PU9 A;  4QBJ A;  3TO6 A;  3EFA A;  4MY0 A;  4HNY B;  4XNH B;  2P6F A;  4QUS A;  5F48 A;  1YGH A;  1Q2D A;  4CAW A;  3F5B A;  4L8A A;  3W6S A;  4R87 A;  5GCN A;  1QST A;  1BOB A;  4NCZ A;  5EBV A;  3SHP A;  4CS0 B;  3R96 A;  4FD6 A;  4R57 A;  1M4D A;  3SXO A;  2ZW4 A;  4GS4 A;  1YK3 A;  2Q7B A;  4M85 A;  2BUE A;  1Y9K A;  2VZY A;  2HUZ A;  1ON0 A;  5H86 A;  1KUX A;  2FXF A;  1I12 A;  4NEX A;  5KTA A;  2FT0 A;  3VWE A;  3DR8 A;  3GYA A;  2QML A;  4IF5 A;  4NSQ A;  2GAN A;  2PSW A;  2EUI A;  1L0C A;  4FD4 A;  2NMT A;  3PGP A;  2QIR A;  3R95 A;  4BMH A;  1CM0 A;  2Z11 A;  3S6K A;  1Q2Y A;  1Z4E A;  2G0B A;  1YLE A;  4PSX A;  4UWI A;  2R7H A;  4R3K A;  2HQY A;  4XNH C;  2Z10 A;  2J8R A;  4KZT A;  2JDD A;  1YVO A;  1V0C A;  3B8G A;  1MJ9 A;  3TO7 A;  4RI1 A;  2H5M A;  5J8C A;  3TT2 A;  1KZF A;  1S5K A;  1NE9 A;  1S7L A;  2QEC A;  2VXK A;  3W6X A;  1NMT A;  1WK4 A;  3FB3 A;  4JWP A;  4LX9 A;  5HH1 A;  4QC6 A;  2Q04 A;  2CNT A;  2R98 A;  4EVY A;  3T90 A;  4OAD A;  5JPH A;  1IIC A;  2PDO A;  2JEV A;  4UWJ A;  3EO4 A;  1YR0 A;  1M4G A;  3S6F A;  2FSR A;  4KOV A;  3P2F A;  2G3A A;  1S7K A;  2B58 A;  4JJX A;  4MJ8 A;  1FY7 A;  1M1D A;  2CY2 A;  3RYO A;  1LRZ A;  4F0Y A;  4I49 A;  4XPD B;  2D4O A;  4KVM E;  3EC4 A;  2B4B A;  4QVT A;  3NE7 A;  5EC4 A;  2I79 A;  4KVX A;  4KOY A;  4R9M A;  1IID A;  3LD2 A;  4KLW A;  3P2H A;  2VBQ A;  4NXY A;  1S7F A;  4PK3 A;  2RC4 A;  4H6U A;  4CAV A;  2VZZ A;  2P6G A;  3DNS A;  2VQY A;  4AVA A;  4Y49 C;  2ZW5 A;  3GKR A;  4II9 A;  2ZW6 A;  1Q2C A;  3FBU A;  1CJW A;  1RXT A;  3PP9 A;  2FIA A;  2OZU A;  3BLN A;  2CNS A;  3TFY A;  2PR8 A;  3ZJ0 A;  3D3S A;  5F49 A;  4KOX A;  1QSR A;  1UFH A;  2OH1 A;  3QAH A;  4RS2 A;  3TE4 A;  2F5I A;  4PSW A;  1Y7R A;  1S60 A;  2GIV A;  5DWN A;  1NSL A;  3H4Q A;  3TO9 A;  4JD6 A;  4H6Z A;  5KTC A;  2PQ8 A;  2JDC A;  3OWC A;  3F8K A;  3I9S A;  4PV6 A;  3DDD A;  3FRM A;  3VWD A;  2REF A;  1BO4 A;  4FD5 A;  2I00 A;  4IUS A;  1S7N A;  4R3L A;  2A4N A;  5KTD A;  1VHS A;  3SXN A;  4E0A A;  4UA3 A;  2Q44 A;  1J4J A;  1VKC A;  3FIX A;  3T9Y A;  1XMT A;  4PK2 A;  2P6E A;  1MJA A;  4KLV A;  4CRY B;  2Q4Y A;  5I0C A;  3ZZI A;  3FYN A;  1XF8 A;  4Y49 B;  4KUB A;  1B87 A;  2Y0M A;  3R9F A;  1N71 A;  2B3U A;  3GY9 A;  4M3S A;  5IX3 A;  2IL4 A;  1K4J A;  1IYL A;  1PUA A;  3R9E A;  4U9Z A;  5HMN A;  3CXP A;  4MI4 A;  2HV2 A;  4KOW A;  1M4I A;  1OZP A;  2BEI A;  4HNX B;  1I21 A;  4ONU A;  4B5O A;  4CRZ B;  4X5K A;  2R1I A;  5E96 A;  1TIQ A;  4FD7 A;  3KKW A;  4KOT A;  5C88 A;  3QB8 A;  1I1D A;  1MK4 A;  5ISV A;  1Z9U A;  2VI7 A;  1GHE A;  1P0H A;  3R9G A;  3G8W A;  3CXS A;  2EVN A;  2VEZ A;  5J8F A;  4AG9 A;  3EXN A;  1MJB A;  4CAX A;  3TOB A;  3E0K A;  1XEB A;  4F6A A;  3IWG A;  2ARH A;  2P0W A;  2ZPA A;  2DXQ A;  2KCW A;  2CNM A;  4B5P B;  3BJ8 A;  3K9U A;  3DR6 A;  3N7Z A;  4KOR A;  3JVN A;  1SQH A;  4MBU A;  4J3G A;  1QSO A;  2ZW7 A;  4JLY A;  3S6G A;  1B6B A;  4KOS A;  1P4N A;  3TOA A;  1KUY A;  4YRH A;  4KVO E;  2ATR A;  3UY5 A;  5DWM A;  2R8V A;  2AJ6 A;  3TCV A;  1M44 A;  3D2P A;  3FXT A;  4YGO A;  3V8I A;  3G3S A;  4H89 A;  4JXR A;  2B4D A;  2OU2 A;  3WR7 A;  1YX0 A;  2C27 A;  5JQ4 A;  3D8P A;  2Z0Z A;  4ORF A;  2FE7 A;  1IB1 E;  2FCK A;  2B5G A;  4JXQ A;  2PRB A;  4KUA A;  2WPW A;  4QB9 A;  3C26 A;  1S3Z A;  4LUA A;  1QSM A;  4U9Y A;  2O28 A;  2OZH A;  2D4P A;  3F0A A;  1YVK A;  4AB7 A;  1U6M A;  4KOU A;  5H84 A;  3BJ7 A;  2FS5 A;  3DSB A;  5CNP A;  4U5Y A;  1YRE A;  2G3T A;  2Q0Y A;  2J8N A;  1IYK A;  4OLL A;  3S6H A;  4MHD A;  4UBR A;  4MY3 A;  5C82 A;  4YFJ A;  4OAE A;  4E2A A;  5IV0 A;  4AVC A;  2JLM A;  3JUW A;  4L89 A;  2AE6 A;  1KUV A;  2B5G B;  1XIX A;  1Z4R A; 
#chains in the Genus database with same CATH topology
 4MCS A;  5IB0 A;  1R57 A;  1RO5 A;  2AFX A;  2YNC A;  1Y0R A;  2O53 A;  3FX6 A;  1F2P A;  4K30 A;  5FVJ A;  4HNW B;  2OB0 A;  2FIW A;  2HC9 A;  1Z2L A;  2PC1 A;  1IU8 A;  2OZG A;  2B4D B;  3CXQ A;  3IGR A;  2X7B A;  3D68 A;  3NH4 A;  4ZI6 A;  4XPK A;  3K9T A;  2REE A;  2FL4 A;  2B3V A;  2WPX A;  3EY5 A;  4XPL A;  3D2M A;  4NF1 A;  4AVB A;  3H5Z A;  1TKH A;  1Y9W A;  3TTH A;  3K2K A;  4RUH A;  3LOD A;  3FNC A;  4NGQ A;  4P4D A;  4A32 A;  1LOK A;  5K8M A;  3MGD A;  2QYV A;  4GXH A;  2XEG A;  2BL1 A;  5JGF A;  1WWZ A;  2ANP A;  2ZOG A;  5F47 A;  3W91 A;  1LCP A;  4KSA A;  2YNE A;  4HKF A;  5F46 A;  4B5P A;  2PR1 A;  5HVH A;  5G1Z A;  4UEE A;  4O23 A;  3PZJ A;  2J8M A;  1CG2 A;  4AG7 A;  4CYO A;  1YQE A;  2GE3 A;  1IOF A;  2AFS A;  2PIY A;  2PJ0 A;  2Z3L A;  1XBU A;  2PJC A;  3B3T A;  2OR4 A;  2WSA A;  1ELL P;  2ZEM A;  3PBE A;  1XRY A;  2K5T A;  2ZED A;  3VH9 A;  1QQ9 A;  1R3N A;  2Q4V A;  3GLJ A;  4YWY A;  4CGL A;  4ZBG A;  3B3W A;  3I3G A;  4E8O A;  3D66 A;  3IWE A;  3R1K A;  4XPD C;  2IMO A;  3FJU A;  4IAV A;  4OC4 A;  2ZXV A;  2CIJ A;  3CPX A;  2Z3M A;  4OIW A;  2AFO A;  2BSW A;  1XE4 A;  4DNC A;  1QSN A;  1PU9 A;  1CPX A;  4QBJ A;  3TO6 A;  3EFA A;  3IU1 A;  4MY0 A;  1PYT B;  5K8O A;  4HNY B;  4XNH B;  4PXD A;  2P6F A;  4UIB A;  4QUS A;  5F48 A;  3PB8 X;  4UEF A;  2PJ6 A;  3FED A;  4KSF A;  2FVG A;  2Q7S A;  4UF4 A;  1YGH A;  3PB4 X;  3BHX A;  1Q2D A;  1YME A;  4UFW A;  4WWV A;  3FEE A;  4C7I A;  4CAW A;  3F5B A;  4L8A A;  3W6S A;  3KHX A;  3JRU A;  4ZY0 A;  4R87 A;  1FNO A;  5GCN A;  1QST A;  1BOB A;  4NCZ A;  4PQA A;  5EBV A;  3SHP A;  2CTC A;  4M6I A;  3R96 A;  4CS0 B;  4FD6 A;  1VHO A;  1M4D A;  2F7V A;  2AFZ A;  1XFO A;  3QAY A;  1YW6 A;  4R57 A;  3SXO A;  2ZW4 A;  1LAN A;  4GS4 A;  3CZX A;  3NA6 A;  2JBK A;  4MCR A;  1YK3 A;  2ZEG A;  2PJ5 A;  3H8E A;  2Q51 A;  4NGS A;  2Q7B A;  4EWT A;  4A39 A;  4M85 A;  3T8W A;  2BUE A;  1Y9K A;  2VZY A;  4B10 A;  1LFW A;  2HUZ A;  4MMO A;  1VHE A;  1ON0 A;  5H86 A;  4CAE A;  2F8H A;  1KUX A;  1XJO A;  2FXF A;  1I12 A;  4NEX A;  5AGE A;  5KTA A;  5JH9 A;  2FT0 A;  5G22 A;  5G20 A;  1R43 A;  3D67 A;  3DR8 A;  3VWE A;  2EWB A;  3MN8 A;  2PJ1 A;  2ZEF A;  3GYA A;  5AG5 A;  1BAV A;  1ZG8 A;  4YU9 A;  4OC1 A;  3PB9 X;  1TKF A;  4FBE A;  1H8L A;  2QML A;  2PJ2 A;  4IF5 A;  4NSQ A;  2GAN A;  4CYN A;  3LAC A;  2PSW A;  4DJL A;  2EUI A;  1L0C A;  4FD4 A;  2NMT A;  5LYF A;  3GB0 A;  3PGP A;  2QIR A;  3R95 A;  4BMH A;  1CM0 A;  4OC5 A;  2G9D A;  2Z11 A;  3S6K A;  1Q2Y A;  1Z4E A;  2G0B A;  1YLE A;  1TXR A;  4PSX A;  5HVG A;  1BLL E;  2YND A;  4UWI A;  2AFW A;  1ELM P;  2R7H A;  4R3K A;  3JTK A;  2HQY A;  4XNH C;  4CYP A;  2ZEN A;  2Z10 A;  2VL1 A;  4IHM A;  4F8Z A;  2J8R A;  4P4J A;  5LRJ A;  4KZT A;  1ZLH A;  3ISX A;  2JDD A;  1YVO A;  1V0C A;  2XEJ A;  3B8G A;  1MJ9 A;  2PRQ A;  3IWW A;  3TO7 A;  4R8F A;  2QJ8 A;  6CPA A;  1ZG9 A;  4RI1 A;  2H5M A;  4R76 A;  3KR4 A;  3FH4 A;  5J8C A;  3KL9 A;  4P44 A;  3IIB A;  4OP4 A;  4F9V A;  2RB7 A;  1F2O A;  4ZYQ A;  1YLO A;  4MHZ A;  1LAM A;  2V8H A;  3TT2 A;  1KZF A;  1S5K A;  1NE9 A;  1S7L A;  2QEC A;  2VXK A;  4PXC A;  3IJ3 A;  3BI0 A;  2NYQ A;  3W6X A;  4B13 A;  4OC3 A;  4MFQ A;  2BCO A;  1NMT A;  1TF9 A;  1WK4 A;  3FB3 A;  1A2Z A;  4H2K A;  4JWP A;  4LX9 A;  1BPM A;  2QVP A;  3S9N A;  5HH1 A;  4QC6 A;  2Q04 A;  3TC8 A;  2CNT A;  2R98 A;  4EVY A;  2V8D A;  3T90 A;  4OAD A;  5JPH A;  1IIC A;  2PDO A;  2JEV A;  3NH8 A;  4UWJ A;  3EO4 A;  1YR0 A;  1M4G A;  3S6F A;  2FSR A;  1OBR A;  4KOV A;  4NJQ A;  4Z65 A;  1AYE A;  3P2F A;  2G3A A;  1S7K A;  1PCA A;  2B58 A;  4JJX A;  4MJ8 A;  1FY7 A;  1M1D A;  2CY2 A;  3RYO A;  4IK2 A;  1IGB A;  2PJ7 A;  1LRZ A;  5LRG A;  3QNV A;  3MRU A;  5JM6 A;  4NFR A;  4UEZ A;  4W9Y A;  2XEI A;  4F0Y A;  4GM5 A;  1Z8W A;  4I49 A;  2Z3K A;  4XPD B;  5HXD A;  4OKO A;  2D4O A;  4KVM E;  3EC4 A;  2B4B A;  2PJ3 A;  1X10 A;  4QVT A;  3NE7 A;  5EC4 A;  2I79 A;  2ZEE A;  4KVX A;  3S9M A;  4KOY A;  4R9M A;  1IID A;  4A94 A;  3CT9 A;  3LD2 A;  3P2H A;  4KLW A;  2VBQ A;  4NXY A;  5EMI A;  1S7F A;  4PK3 A;  3FMC A;  4KS9 A;  2RC4 A;  4B12 A;  3HLP A;  2PCU A;  4H6U A;  2VZZ A;  2P6G A;  3DNS A;  2VQY A;  4AVA A;  4CAV A;  1CP6 A;  2NSM A;  3L2N A;  1YSJ A;  4Y49 C;  4P45 A;  1VGY A;  2PE3 A;  2ZW5 A;  1CP7 A;  2IQ6 A;  3GKR A;  1ZO0 A;  2ZW6 A;  1Q2C A;  3FBU A;  4MXU A;  4II9 A;  1CJW A;  4A37 A;  1RXT A;  1Q7L A;  4OID A;  2WYR A;  3PP9 A;  4BBH A;  5K8N A;  2FIA A;  8CPA A;  2OZU A;  4F0X A;  3BLN A;  2BOA A;  4DYO A;  5CPA A;  3S9L A;  2PJ9 A;  1CBX A;  2WUU A;  5LYL A;  3PB7 X;  5D29 A;  1IY7 A;  1Z5R A;  4CGP A;  3B3C A;  2CNS A;  3TFY A;  2PR8 A;  2Q43 A;  3ZJ0 A;  5ELY A;  3D3S A;  1BPN A;  3KQZ A;  3RZA A;  5F49 A;  1CPS A;  4KOX A;  3TX8 A;  1QSR A;  1UFH A;  2OH1 A;  3QAH A;  4HPS A;  2WZN A;  4RS2 A;  3TE4 A;  5BWA B;  4Q38 A;  5CBM A;  2F5I A;  4R7M A;  4PSW A;  3KZW A;  1Y7R A;  2CTB A;  2PIZ A;  1S60 A;  2GIV A;  1XOV A;  3VAR A;  4FAI A;  5DWN A;  1NSL A;  3H4Q A;  3TO9 A;  5D8N A;  4JD6 A;  3IFE A;  3ISZ A;  4M6H A;  4H6Z A;  3I1U A;  3A9L A;  5KTC A;  3PB6 X;  2RFH A;  2PQ8 A;  4MFL A;  4PXB A;  2JDC A;  1Y7E A;  3OWC A;  3F8K A;  3I9S A;  4UCP A;  1ZLI A;  2DPS A;  4PV6 A;  4ZY1 A;  4AXV A;  3DDD A;  4LQ6 A;  3CPA A;  3FRM A;  4P4I A;  4Q7A A;  3VWD A;  2REF A;  3KGQ A;  4NJR A;  1BO4 A;  3D7F A;  4FD5 A;  4MHN A;  2Z3P A;  5J1Q A;  2I00 A;  4MFJ A;  4IUS A;  1S7N A;  4R3L A;  2A4N A;  5AG7 A;  5LYI A;  1VHS A;  3SXN A;  2ZOF A;  5KTD A;  4E0A A;  3N5F A;  4UA3 A;  4X8I A;  2Q44 A;  2V8V A;  4PPZ A;  1J4J A;  4MHP A;  3V38 A;  1AUG A;  1VKC A;  3FIX A;  3KQX A;  3T9Y A;  4C2Z A;  5A28 A;  1XMT A;  4PK2 A;  2P6E A;  1MJA A;  2CXA A;  3GIU A;  4KLV A;  4CRY B;  3CDX A;  2Q4Y A;  5I0C A;  3IC1 A;  1ARL A;  2ABZ A;  4P6Y A;  3ZZI A;  2PJ8 A;  1X12 A;  4OC2 A;  4UCM A;  3FYN A;  1EE3 P;  1XF8 A;  4B11 A;  5LYD A;  5K8P A;  4Y49 B;  3KHZ A;  4EME A;  4KUB A;  1B87 A;  4M6G A;  2YNC C;  2Y0M A;  4LQG A;  2C6C A;  1QMU A;  5DS0 A;  4ZX9 A;  3PBB A;  4UCN A;  3R9F A;  7CPA A;  1N71 A;  2Z3N A;  3DLJ A;  4B14 A;  2B3U A;  3GY9 A;  4M3S A;  4TWE A;  4ZGY B;  5IX3 A;  2IL4 A;  1K4J A;  1IYL A;  1PUA A;  3R9E A;  3SI2 A;  2AFU A;  3WC5 A;  2C6G A;  3D7G A;  4FWU A;  1Z8X A;  3NH5 A;  2CF4 A;  4ZX8 A;  2I3C A;  4U9Z A;  4X3R A;  4F9U A;  5HMN A;  3B2Y A;  3CXP A;  4MI4 A;  2HV2 A;  4KOW A;  1Y0Y A;  1M4I A;  1OZP A;  1ZG7 A;  2BEI A;  5I4M A;  4HNX B;  3LWU A;  2JBJ A;  4RN7 A;  2DEA A;  1I21 A;  4KSI A;  4ONU A;  4NGP A;  4B5O A;  3WC6 A;  4P4F A;  4A31 A;  4CRZ B;  2POK A;  4MCP A;  4X5K A;  2J9A A;  2R1I A;  1Z8T A;  4MRI A;  5E96 A;  1TIQ A;  1HDQ A;  2ODF A;  4FD7 A;  3KKW A;  4KOT A;  4B6Z A;  2EBJ A;  5C88 A;  4MFZ A;  3QB8 A;  1UWY A;  4BIN A;  1I1D A;  1MK4 A;  4C68 A;  2PJB A;  5ISV A;  5IB9 A;  1Z9U A;  2VI7 A;  2ZEP A;  2ZEH A;  1GHE A;  1P0H A;  3R9G A;  2IJZ A;  4A38 A;  2DF5 A;  4OME A;  3RAM A;  3G8W A;  4CYQ A;  3CXS A;  2EVN A;  1GYT A;  2BO9 A;  2GRE A;  2VEZ A;  4P4B A;  5J8F A;  4CGN A;  4NGR A;  1YW4 A;  4WJB A;  4AG9 A;  3B7I A;  3EXN A;  1NSA A;  4MFP A;  1MJB A;  5G21 A;  1HEE A;  2JEW A;  4NGT A;  4C2X A;  4CAX A;  2Z3O A;  3TOB A;  2HB6 A;  3H8G A;  3E0K A;  1XEB A;  4F6A A;  3B3V A;  3IWG A;  2ARH A;  2PVV A;  3D7H A;  2P0W A;  2ZPA A;  2DXQ A;  2PJA A;  2KCW A;  2CNM A;  2GFQ A;  2YGW A;  4B5P B;  2V8G A;  3BJ8 A;  4EFD A;  3K9U A;  4A33 A;  3SJX A;  2AFM A;  3DR6 A;  3SI1 A;  1TF8 A;  2GLJ A;  3N7Z A;  4KOR A;  3JVN A;  3KI9 A;  1M4L A;  1SQH A;  4MBU A;  4J3G A;  3WAB A;  1QSO A;  2GU2 A;  2EO8 A;  2ZW7 A;  4JLY A;  1JWQ A;  1B6B A;  4KOS A;  3S6G A;  1P4N A;  3WC7 A;  3TOA A;  2PVW A;  1KUY A;  4YRH A;  4G1P A;  4KVO E;  5THW A;  4X2T A;  3SJG A;  3V7Z A;  2ATR A;  2PJ4 A;  3B3S A;  2OOT A;  4ONW A;  3UY5 A;  1AMP A;  5DWM A;  2R8V A;  4MFK A;  3DGV A;  3RO0 A;  1TKJ A;  2AJ6 A;  4CAF A;  4K3N A;  3TCV A;  1M44 A;  3D2P A;  3FXT A;  1Z8L A;  2V77 A;  4NGM A;  4P10 A;  4TNU A;  4YGO A;  3V8I A;  1XMB A;  1KWM A;  3G3S A;  4H89 A;  4JXR A;  4A30 A;  2C1C A;  4CGO A;  2B4D A;  4NGN A;  2OU2 A;  3H8F A;  3WR7 A;  1YX0 A;  1DTD A;  3LMS A;  2C27 A;  3HUV A;  5JQ4 A;  3D8P A;  5F09 A;  2Z0Z A;  2O4H A;  4ORF A;  2FE7 A;  1IB1 E;  4UIA A;  4C7H A;  2FCK A;  3PEI A;  5HVF A;  2B5G A;  4CGM A;  4UFV A;  4UFX A;  3IEH A;  4JXQ A;  1ARM A;  2PRB A;  2WPW A;  3FF3 A;  3FEC A;  2Q4Z A;  4KUA A;  4QB9 A;  3VAT A;  3C26 A;  3BI1 A;  1S3Z A;  3PFO A;  4LUA A;  4CPA A;  1QSM A;  4U9Y A;  2O28 A;  2OZH A;  3BXM A;  1JQG A;  3RBU A;  4Q36 A;  1VIX A;  3KAS A;  2D4P A;  3F0A A;  4FUU A;  5AG4 A;  4JYW A;  1HDU A;  1YVK A;  2EK9 A;  4AB7 A;  1U6M A;  2EK8 A;  3NFZ A;  3GUX A;  4KOU A;  4OC0 A;  2DPT A;  5H84 A;  1FT7 A;  2GLF A;  2ZEO A;  2ZEL A;  4BD9 A;  5LRK A;  1F57 A;  4R6T A;  2C6P A;  3BJ7 A;  2FS5 A;  3DSB A;  3PFE A;  5CNP A;  3WT4 A;  1IOI A;  2XEF A;  3FVL A;  4U5Y A;  5AG6 A;  1YRE A;  1DE4 C;  1RTQ A;  2G3T A;  2Q0Y A;  3PRT A;  4MCQ A;  4C2Y A;  3RNZ A;  4A2Z A;  3SI0 A;  3IO1 A;  2J8N A;  1IYK A;  1CX8 A;  3B35 A;  4PXE A;  4DUK A;  4OLL A;  3IU2 A;  4JZ0 A;  1LAP A;  4MHY A;  4MHD A;  3S6H A;  5A27 A;  4ZY2 A;  4UBR A;  4MY3 A;  5C82 A;  4P4E A;  3D4U A;  3D7D A;  4YFJ A;  4OAE A;  4E2A A;  5IV0 A;  4AVC A;  4A95 A;  2JLM A;  3JUW A;  3KR5 A;  4L89 A;  3SJF A;  2AE6 A;  1KUV A;  2B5G B;  1XIX A;  1Z4R A;  3NE8 A;  3SJE A; 
#chains in the Genus database with same CATH homology
 5IB0 A;  1R57 A;  1RO5 A;  2YNC A;  4K30 A;  5FVJ A;  4HNW B;  2OB0 A;  2FIW A;  2PC1 A;  2OZG A;  2B4D B;  3CXQ A;  3IGR A;  2X7B A;  4XPK A;  2REE A;  2FL4 A;  2B3V A;  2WPX A;  3EY5 A;  4XPL A;  3D2M A;  4NF1 A;  4AVB A;  3H5Z A;  1Y9W A;  3TTH A;  3LOD A;  3FNC A;  4A32 A;  3MGD A;  2BL1 A;  1WWZ A;  5F47 A;  3W91 A;  4KSA A;  2YNE A;  4HKF A;  5F46 A;  4B5P A;  2PR1 A;  5G1Z A;  3PZJ A;  2J8M A;  4AG7 A;  4CYO A;  2GE3 A;  2Z3L A;  2WSA A;  2K5T A;  4CGL A;  2Q4V A;  4ZBG A;  4E8O A;  3I3G A;  3IWE A;  3R1K A;  4XPD C;  2ZXV A;  2Z3M A;  2BSW A;  1XE4 A;  4DNC A;  1QSN A;  1PU9 A;  4QBJ A;  3TO6 A;  3EFA A;  3IU1 A;  4MY0 A;  4HNY B;  4XNH B;  2P6F A;  4QUS A;  5F48 A;  4KSF A;  1YGH A;  1Q2D A;  4UFW A;  4C7I A;  4CAW A;  3F5B A;  4L8A A;  3W6S A;  4R87 A;  5GCN A;  1QST A;  1BOB A;  4NCZ A;  5EBV A;  3SHP A;  4CS0 B;  3R96 A;  4FD6 A;  1M4D A;  4R57 A;  3SXO A;  2ZW4 A;  4GS4 A;  1YK3 A;  2Q7B A;  4M85 A;  2BUE A;  1Y9K A;  2VZY A;  4B10 A;  2HUZ A;  1ON0 A;  5H86 A;  4CAE A;  1KUX A;  2FXF A;  1I12 A;  4NEX A;  5AGE A;  5KTA A;  2FT0 A;  5G22 A;  5G20 A;  3VWE A;  3DR8 A;  5AG5 A;  3GYA A;  2QML A;  4IF5 A;  4NSQ A;  2GAN A;  4CYN A;  2PSW A;  2EUI A;  1L0C A;  4FD4 A;  2NMT A;  3PGP A;  2QIR A;  3R95 A;  4BMH A;  1CM0 A;  2Z11 A;  3S6K A;  1Q2Y A;  1Z4E A;  2G0B A;  1YLE A;  4PSX A;  2YND A;  4UWI A;  2R7H A;  4R3K A;  3JTK A;  2HQY A;  4XNH C;  4CYP A;  2Z10 A;  2J8R A;  4KZT A;  2JDD A;  1YVO A;  1V0C A;  3B8G A;  1MJ9 A;  3TO7 A;  4RI1 A;  2H5M A;  5J8C A;  3TT2 A;  1KZF A;  1S5K A;  1NE9 A;  1S7L A;  2QEC A;  2VXK A;  3W6X A;  4B13 A;  4MFQ A;  1NMT A;  1WK4 A;  3FB3 A;  4JWP A;  4LX9 A;  5HH1 A;  4QC6 A;  2Q04 A;  2CNT A;  2R98 A;  4EVY A;  3T90 A;  4OAD A;  5JPH A;  1IIC A;  2PDO A;  2JEV A;  4UWJ A;  3EO4 A;  1YR0 A;  1M4G A;  3S6F A;  2FSR A;  4KOV A;  3P2F A;  2G3A A;  1S7K A;  2B58 A;  4JJX A;  4MJ8 A;  1FY7 A;  1M1D A;  2CY2 A;  3RYO A;  1LRZ A;  4F0Y A;  4I49 A;  2Z3K A;  4XPD B;  2D4O A;  4KVM E;  3EC4 A;  2B4B A;  4QVT A;  3NE7 A;  5EC4 A;  2I79 A;  4KVX A;  4KOY A;  4R9M A;  1IID A;  3LD2 A;  4KLW A;  3P2H A;  2VBQ A;  4NXY A;  1S7F A;  4PK3 A;  4KS9 A;  2RC4 A;  4B12 A;  4H6U A;  4CAV A;  2VZZ A;  2P6G A;  3DNS A;  2VQY A;  4AVA A;  4Y49 C;  2ZW5 A;  3GKR A;  1ZO0 A;  2ZW6 A;  1Q2C A;  3FBU A;  4II9 A;  1CJW A;  1RXT A;  3PP9 A;  4BBH A;  2FIA A;  2OZU A;  4F0X A;  3BLN A;  2WUU A;  4CGP A;  2CNS A;  3TFY A;  2PR8 A;  3ZJ0 A;  3D3S A;  5F49 A;  4KOX A;  1QSR A;  1UFH A;  2OH1 A;  3QAH A;  4RS2 A;  3TE4 A;  5BWA B;  4Q38 A;  2F5I A;  4PSW A;  1Y7R A;  1S60 A;  2GIV A;  5DWN A;  1NSL A;  3H4Q A;  3TO9 A;  4JD6 A;  4H6Z A;  3A9L A;  5KTC A;  2PQ8 A;  4MFL A;  2JDC A;  3OWC A;  3F8K A;  3I9S A;  4UCP A;  2DPS A;  4PV6 A;  3DDD A;  3FRM A;  3VWD A;  2REF A;  1BO4 A;  4FD5 A;  2Z3P A;  2I00 A;  4MFJ A;  4IUS A;  1S7N A;  4R3L A;  2A4N A;  5AG7 A;  5KTD A;  1VHS A;  3SXN A;  4E0A A;  4UA3 A;  2Q44 A;  1J4J A;  1VKC A;  3FIX A;  3T9Y A;  4C2Z A;  5A28 A;  1XMT A;  4PK2 A;  2P6E A;  1MJA A;  2CXA A;  4KLV A;  4CRY B;  2Q4Y A;  5I0C A;  3ZZI A;  4UCM A;  3FYN A;  4B11 A;  1XF8 A;  4Y49 B;  4KUB A;  1B87 A;  2YNC C;  2Y0M A;  4UCN A;  3R9F A;  1N71 A;  2Z3N A;  4B14 A;  2B3U A;  3GY9 A;  4M3S A;  4ZGY B;  5IX3 A;  2IL4 A;  1K4J A;  1IYL A;  1PUA A;  3R9E A;  4U9Z A;  5HMN A;  3CXP A;  4MI4 A;  2HV2 A;  4KOW A;  1M4I A;  1OZP A;  2BEI A;  4HNX B;  1I21 A;  4ONU A;  4B5O A;  4A31 A;  4CRZ B;  4X5K A;  2R1I A;  5E96 A;  1TIQ A;  4FD7 A;  3KKW A;  4KOT A;  5C88 A;  4MFZ A;  3QB8 A;  1I1D A;  1MK4 A;  4C68 A;  5ISV A;  1Z9U A;  2VI7 A;  1GHE A;  1P0H A;  3R9G A;  3G8W A;  4CYQ A;  3CXS A;  2EVN A;  2VEZ A;  5J8F A;  4CGN A;  4AG9 A;  3EXN A;  4MFP A;  1MJB A;  5G21 A;  4C2X A;  4CAX A;  2Z3O A;  3TOB A;  3E0K A;  1XEB A;  4F6A A;  3IWG A;  2ARH A;  2P0W A;  2ZPA A;  2DXQ A;  2KCW A;  2CNM A;  2YGW A;  4B5P B;  3BJ8 A;  3K9U A;  4A33 A;  3DR6 A;  3N7Z A;  4KOR A;  3JVN A;  1SQH A;  4MBU A;  4J3G A;  1QSO A;  2ZW7 A;  4JLY A;  3S6G A;  1B6B A;  4KOS A;  1P4N A;  3TOA A;  1KUY A;  4YRH A;  4KVO E;  2ATR A;  3UY5 A;  5DWM A;  2R8V A;  4MFK A;  2AJ6 A;  4CAF A;  3TCV A;  1M44 A;  3D2P A;  3FXT A;  4YGO A;  3V8I A;  3G3S A;  4H89 A;  4JXR A;  4A30 A;  4CGO A;  2B4D A;  2OU2 A;  3WR7 A;  1YX0 A;  2C27 A;  5JQ4 A;  3D8P A;  2Z0Z A;  4ORF A;  2FE7 A;  1IB1 E;  4C7H A;  2FCK A;  2B5G A;  4CGM A;  4UFV A;  4UFX A;  4JXQ A;  2PRB A;  4KUA A;  2WPW A;  4QB9 A;  3C26 A;  1S3Z A;  4LUA A;  1QSM A;  4U9Y A;  2O28 A;  2OZH A;  4Q36 A;  2D4P A;  3F0A A;  5AG4 A;  1YVK A;  4AB7 A;  1U6M A;  4KOU A;  2DPT A;  5H84 A;  3BJ7 A;  2FS5 A;  3DSB A;  5CNP A;  5AG6 A;  4U5Y A;  1YRE A;  2G3T A;  2Q0Y A;  4C2Y A;  4A2Z A;  2J8N A;  1IYK A;  4OLL A;  3IU2 A;  3S6H A;  4MHD A;  5A27 A;  4UBR A;  4MY3 A;  5C82 A;  4YFJ A;  4OAE A;  4E2A A;  5IV0 A;  4AVC A;  4A95 A;  2JLM A;  3JUW A;  4L89 A;  2AE6 A;  1KUV A;  2B5G B;  1XIX A;  1Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...