5I0CA

Crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
89
Chain Sequence
EIREGHNKFYINDQGKQIAEIVFVPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YjdJ
publication title Crystal structure of predicted acyltransferase YjdJ with acyl-CoA N-acyltransferase domain from Escherichia coli str. K-12
rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 25
structure length 89
sequence length 90
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5i0cA00
2ZXVA 3F0AA 3W6SA 1IIDA 1QSOA 2QECA 2QIRA 2BUEA 5ISVA 3C26A 4QUSA 3S6KA 1M4DA 2FIAA 2GIVA 1XMTA 1S7KA 2ATRA 2Q04A 4UWJA 1NSLA 4EVYA 3SHPA 2Q44A 3TO9A 5F47A 4YFJA 3R95A 2C27A 4M85A 4PV6A 1IYLA 3EC4A 2R8VA 4KZTA 4AG9A 2FT0A 4AB7A 1V0CA 4R87A 3NE7A 4LX9A 2EUIA 4H89A 3PZJA 2WPWA 4JLYA 4QC6A 5EC4A 1OZPA 4MI4A 2VZYA 3FNCA 4NCZA 2QMLA 4L89A 4MBUA 4JXQA 4KOXA 1MJ9A 4E2AA 1NE9A 1WWZA 5HMNA 4KUAA 1P0HA 2I00A 2P6GA 4L8AA 3N7ZA 4HKFA 2REFA 4Y49B 1KUVA 4KOVA 2JDDA 4KOUA 2PSWA 1GHEA 4NXYA 3DSBA 4JWPA 2R1IA 2OZUA 2FCKA 4KOTA 3FBUA 3SXOA 2CNTA 3CXSA 1QSNA 4MJ8A 3TE4A 4KVOE 4F0YA 2I79A 2AE6A 2HQYA 4KORA 1L0CA 1TIQA 3I3GA 2Q0YA 2D4OA 3GKRA 1M4IA 3K9UA 4RI1A 2H5MA 2RC4A 2PQ8A 1N71A 2PR1A 3R96A 4QB9A 4QVTA 2GE3A 2ZW7A 2VZZA 4NF1A 1VKCA 2P6EA 3D2PA 3VWDA 1UFHA 1PU9A 3IWGA 2B4DB 1Q2YA 4Y49C 2FS5A 4AVBA 1LRZA 3ZZIA 3R1KA 2VXKA 3RYOA 1I12A 3TOAA 4MY0A 3D3SA 3VWEA 1KUYA 4AG7A 2B3UA 4CRZB 2VQYA 2IL4A 2KCWA 3BJ7A 2FSRA 3DR6A 4AVAA 4B5OA 1M44A 4R3KA 5IB0A 4J3GA 4JJXA 4II9A 3R9FA 3EO4A 5F49A 3R9EA 3F5BA 1CM0A 1Y9KA 5I0CA 3JUWA 3LODA 1Y7RA 4ZBGA 2B3VA 1YGHA 4OADA 3SXNA 1Q2DA 4RS2A 4M3SA 4AVCA 2REEA 3EFAA 4U9ZA 5IX3A 1VHSA 3IGRA 5CNPA 4F6AA 2ARHA 1KZFA 2B5GA 3DNSA 3G3SA 4KVXA 2B4BA 3PGPA 3TOBA 2K5TA 4H6ZA 3EXNA 5E96A 4PSXA 5F46A 1IB1E 3S6HA 1XE4A 2OZGA 4KUBA 1S3ZA 3TCVA 3P2HA 4HNYB 4MY3A 5DWMA 1QSTA 1QSRA 1YX0A 5JQ4A 4KVME 2R7HA 4CRYB 2JDCA 4YRHA 2BEIA 3TTHA 1I21A 1MK4A 3W6XA 1Q2CA 3E0KA 2OB0A 3S6FA 4CS0B 4PK3A 4LUAA 3S6GA 2P0WA 1S7FA 3BLNA 4BMHA 2J8RA 4NSQA 2Y0MA 4X5KA 3WR7A 4E8OA 4I49A 2GANA 2ZW6A 3D8PA 4XPKA 1M1DA 1KUXA 3D2MA 3LD2A 4XNHB 1CJWA 2JEVA 3G8WA 4JD6A 2Q4VA 4FD7A 2HV2A 4XPLA 3T9YA 2WPXA 5KTCA 4FD4A 5C88A 1MJAA 1WK4A 2O28A 3H4QA 3BJ8A 4YGOA 2Z0ZA 3F8KA 4KLWA 4XPDB 2FXFA 3PP9A 4UBRA 2Z10A 4CAXA 4QBJA 2AJ6A 3OWCA 2OH1A 4B5PA 1I1DA 2Z11A 1Y9WA 5H86A 3KKWA 2FIWA 1J4JA 1S60A 4KLVA 4NEXA 5IV0A 2EVNA 3MGDA 4PK2A 1MJBA 2HUZA 4FD5A 3DR8A 2JLMA 1S5KA 3I9SA 1QSMA 2ZW4A 2CNMA 3P2FA 5J8FA 3QB8A 2PC1A 1R57A 1YVKA 4U5YA 4UA3A 2BL1A 1YREA 4UWIA 5JPHA 2G0BA 1YVOA 5J8CA 4XNHC 2OZHA 2G3AA 4H6UA 1RO5A 1RXTA 4IUSA 4R57A 2G3TA 4KOSA 4ORFA 1K4JA 1SQHA 1B87A 1Z4RA 2A4NA 4GS4A 1BOBA 3TT2A 5GCNA 1XF8A 2FE7A 4XPDC 4OAEA 3GYAA 2J8MA 2B5GB 2B58A 3CXPA 1S7NA 3EY5A 3FIXA 4JXRA 1BO4A 1IYKA 3FRMA 2J8NA 2VI7A 2DXQA 5HH1A 4ONUA 2ZPAA 3TFYA 3QAHA 1PUAA 4FD6A 5KTDA 3FXTA 1Z4EA 2D4PA 5FVJA 3FB3A 3UY5A 3W91A 1M4GA 5KTAA 2BSWA 4R9MA 2P6FA 1FY7A 2CY2A 2VBQA 4OLLA 2R98A 5F48A 4HNXB 3TO7A 1XIXA 3FYNA 1B6BA 3V8IA 2NMTA 2F5IA 4CAWA 1ON0A 3DDDA 4MHDA 1IICA 2FL4A 1YR0A 2PDOA 2Q7BA 2ZW5A 4PSWA 5C82A 1S7LA 3CXQA 3R9GA 3JVNA 4HNWB 2OU2A 2PRBA 2VEZA 4KOYA 3TO6A 4DNCA 4E0AA 1YLEA 4KOWA 2PR8A 3B8GA 3GY9A 1U6MA 5DWNA 4CAVA 4K30A 2Q4YA 4B5PB 2X7BA 3ZJ0A 1P4NA 5H84A 1XEBA 3T90A 4IF5A 1YK3A 2CNSA 1Z9UA 2B4DA 4R3LA 1NMTA 5EBVA 4U9YA
chains in the Genus database with same CATH superfamily
2ZXVA 3F0AA 3W6SA 3SI2A 3RNZA 3D7GA 1BLLE 1IIDA 1QSOA 2QECA 1YW4A 5G22A 2QIRA 2BUEA 1CG2A 2HC9A 5ISVA 1ZLIA 3K9TA 3C26A 4QUSA 3S6KA 4ZI6A 1M4DA 2FIAA 2EK8A 2GIVA 4R7MA 2PJ4A 2WYRA 3B3WA 4CYPA 1XMTA 1S7KA 2ATRA 3I1UA 2Q04A 4ZY1A 1BPMA 4UWJA 1NSLA 1CP7A 2RB7A 3SHPA 5AG5A 4BBHA 4OIDA 4EVYA 4OMEA 2PJBA 2Q44A 1F2PA 3QAYA 3TO9A 5F47A 4YFJA 1YLOA 5LRJA 3R95A 4PXCA 2C27A 4M6IA 3SJEA 2WUUA 4MHZA 4M85A 2YNCC 4PV6A 1IYLA 3EC4A 2R8VA 4KZTA 1Z8WA 4OC1A 4AG9A 2POKA 2FT0A 4AB7A 1V0CA 2JBKA 3NE7A 4R87A 4LX9A 3HUVA 2C6CA 2EUIA 4H89A 1A2ZA 2ZEPA 2XEFA 3PZJA 2WPWA 3B3VA 2FVGA 4JLYA 5A28A 2F8HA 1LAMA 2PJ1A 4R76A 3H8GA 2GLFA 3IFEA 4ZYQA 4QC6A 1ZLHA 2Z3LA 2CF4A 3S9MA 4MFPA 3D7DA 2CIJA 2Q51A 5I4MA 4NGRA 5EC4A 3RAMA 1OZPA 4UCNA 4MI4A 3SI1A 5BWAB 2VZYA 3FNCA 2C1CA 4NCZA 2QMLA 4OP4A 5EMIA 4L89A 4MBUA 4X3RA 4JXQA 4KOXA 3RBUA 1MJ9A 4E2AA 1NE9A 1WWZA 2Z3MA 5LYIA 4MCQA 5HMNA 2ANPA 3PFOA 4KUAA 1P0HA 1AYEA 2I00A 2ZEGA 4MCPA 2P6GA 1XOVA 4L8AA 2PCUA 1VIXA 3SJFA 3N7ZA 2G9DA 4DYOA 4HKFA 2PJ6A 2REFA 1BAVA 4NGMA 4Y49B 1ELMP 3PBBA 4DUKA 1VGYA 4CAEA 4KSAA 1ZG8A 1FT7A 2IMOA 4PQAA 3JRUA 2NSMA 4F8ZA 1KUVA 4KOVA 4P4BA 2JDDA 4MRIA 4KOUA 2PSWA 1GHEA 4NXYA 2V8VA 3NH5A 3DSBA 4JWPA 2R1IA 2OZUA 1IY7A 2FCKA 4KOTA 1R3NA 3B3SA 3FBUA 5G1ZA 3SXOA 2ZEHA 2CNTA 3CXSA 1QSNA 4MJ8A 2F7VA 3TE4A 4KVOE 2AFWA 4F0YA 2I79A 3MN8A 3WC5A 2AE6A 4CYNA 2HQYA 4KORA 2GREA 3L2NA 1L0CA 4FUUA 1TIQA 4CGNA 3I3GA 3K2KA 3IU2A 2Q0YA 3KR4A 2D4OA 4MFKA 3IEHA 3PEIA 1M4IA 3GKRA 3K9UA 5DS0A 1R43A 2H5MA 4RI1A 2RC4A 5JGFA 2PQ8A 1N71A 3B2YA 4G1PA 2PR1A 3R96A 4QB9A 4MHPA 2PJ2A 3PFEA 3KHZA 4JZ0A 4PXBA 4QVTA 3SJGA 1LAPA 2JEWA 2GE3A 2ZW7A 2ZELA 2IQ6A 4B11A 2YNEA 1RTQA 2JBJA 2VZZA 3NFZA 1VKCA 2P6EA 4NF1A 3D2PA 3FF3A 3VWDA 1UFHA 3DLJA 4BD9A 1PU9A 4OC0A 2PVWA 3IWGA 1EE3P 3HLPA 3SJXA 3N5FA 2NYQA 2B4DB 4Q38A 3SI0A 4B14A 1Q2YA 4Y49C 2PJAA 1XBUA 3H5ZA 2ODFA 3BI1A 3KGQA 3KZWA 3PBEA 2FS5A 3D4UA 4AVBA 2PIYA 1LRZA 2Z3NA 4A94A 4B12A 3ZZIA 3R1KA 2VXKA 2DF5A 3RYOA 1I12A 1DE4C 3TOAA 4MY0A 3D3SA 3VWEA 1YQEA 4MXUA 1TKJA 1KUYA 2AFSA 4RUHA 1CP6A 1Y0YA 4W9YA 1BPNA 2AFUA 3NH4A 2ZENA 1IOFA 2ZEDA 3IO1A 2B3UA 4AG7A 3WC7A 2VQYA 4CRZB 2IL4A 2KCWA 2V8GA 2XEIA 3BJ7A 4EFDA 4M6HA 2FSRA 3DR6A 4AVAA 4B5OA 1M44A 4EMEA 4R3KA 4P4JA 4NFRA 5THWA 5IB0A 4J3GA 4JJXA 4II9A 3R9FA 4Q36A 3EO4A 4H2KA 2C6PA 1VHEA 1TF9A 1NSAA 4UFWA 1FNOA 5F49A 2OOTA 3R9EA 3F5BA 1CM0A 5HVFA 1Y9KA 4CGMA 5I0CA 1F57A 3JUWA 3LODA 4TWEA 3WT4A 1Y7RA 4OKOA 3PB7X 4ZBGA 4IAVA 4P4FA 2B3VA 4C2ZA 1YGHA 3WABA 4OADA 1DTDA 2C6GA 3IJ3A 4MFLA 3SXNA 4K3NA 2Q7SA 1Q2DA 4RS2A 2ZEMA 4M3SA 4AVCA 2PJ5A 2REEA 3FEDA 3EFAA 4U9ZA 5IX3A 1ARMA 1VHSA 2GFQA 3FECA 2Z3KA 3IGRA 5CNPA 1XJOA 4F6AA 4LQ6A 1IGBA 2ARHA 1KZFA 5AG4A 2B5GA 4PPZA 3DNSA 3G3SA 5LYFA 1AUGA 5CPAA 1TXRA 5G21A 4KVXA 1KWMA 2ZEEA 2B4BA 3PGPA 3TOBA 2K5TA 5HXDA 4H6ZA 4CYQA 1XRYA 4Z65A 3EXNA 5E96A 4PSXA 5F46A 4X8IA 2DPTA 3LACA 1JWQA 3KR5A 4AXVA 8CPAA 4FWUA 1IB1E 3S6HA 2V8HA 2OZGA 1XE4A 2Z3OA 2YGWA 3IC1A 4KUBA 4YWYA 4P4EA 2BO9A 1S3ZA 3TCVA 3P2HA 4HNYB 4MY3A 5DWMA 1YW6A 1QSTA 2PJ7A 1QSRA 1YX0A 3B7IA 4IHMA 5JQ4A 1F2OA 1QMUA 4KVME 2IJZA 2R7HA 4CRYB 4PXDA 2JDCA 4YRHA 2BEIA 3TTHA 3FEEA 2I3CA 2QYVA 1I21A 1MK4A 1LFWA 1Q2CA 3E0KA 4NGQA 3W6XA 4C7HA 2OB0A 3S6FA 4CGLA 4CS0B 4FAIA 4JYWA 2PJ0A 3IU1A 4UIAA 1LANA 4PK3A 7CPAA 4LUAA 3DGVA 3S6GA 4OC4A 3CT9A 4MHNA 2P0WA 2Q4ZA 3IIBA 4ZY0A 3ISXA 3T8WA 5AG7A 1S7FA 3BLNA 3TX8A 2J8RA 4BMHA 4NSQA 2Y0MA 4C7IA 6CPAA 3ISZA 3FVLA 4NGSA 4X5KA 3NH8A 4GXHA 3FX6A 3WR7A 4A33A 4E8OA 1Y7EA 3KASA 4I49A 2GANA 2ZW6A 1HDUA 3KQXA 3D8PA 4XPKA 1M1DA 3IWWA 1KUXA 1CPXA 3D2MA 3LD2A 4XNHB 1CJWA 2JEVA 2O53A 3G8WA 4UEZA 4JD6A 2EK9A 4UEFA 2Q4VA 3D67A 4FD7A 2HV2A 2QJ8A 4XPLA 2AFMA 2WPXA 2PIZA 3T9YA 5KTCA 4FD4A 2VL1A 4A37A 5C88A 4LQGA 3VH9A 1MJAA 4IK2A 4UF4A 5A27A 1WK4A 4B6ZA 2YNCA 1ELLP 3D68A 3JTKA 3PB6X 2PJ8A 5HVHA 2O28A 3H4QA 4P45A 3BJ8A 3CPAA 4YGOA 2Z0ZA 3F8KA 4KLWA 4MCRA 4XPDB 1ARLA 4DJLA 1PYTB 2WSAA 1PCAA 2EWBA 2FXFA 3PP9A 4UBRA 4C2XA 2Z10A 4ZX9A 4CAXA 4KSIA 3KI9A 2GU2A 4X2TA 4NGNA 1Q7LA 4QBJA 5CBMA 2AJ6A 3OWCA 2V77A 5AG6A 2OH1A 4B5PA 1I1DA 2Z11A 2ABZA 5JH9A 1Y9WA 1YMEA 2XEGA 5H86A 4ZX8A 4OC2A 3KKWA 4NGTA 2FIWA 3GLJA 3LMSA 1J4JA 1CX8A 1S60A 2ZOGA 3FH4A 4KLVA 4NEXA 5IV0A 2EVNA 5AGEA 5F09A 3MGDA 2J9AA 2PE3A 3WC6A 4B13A 3BHXA 1CBXA 2YNDA 4ZY2A 4PK2A 1MJBA 4P6YA 5D8NA 2HUZA 3B35A 4FD5A 3DR8A 2JLMA 1S5KA 3I9SA 4R8FA 1QSMA 2ZW4A 2CNMA 1M4LA 3NE8A 3P2FA 5J8FA 3B3TA 3QB8A 2PC1A 1R57A 4WJBA 1YVKA 5K8PA 4U5YA 4UA3A 2BL1A 1YREA 4UWIA 5JPHA 2G0BA 4MFQA 1YVOA 4MCSA 1Y0RA 5J8CA 4XNHC 1ZG9A 2OZHA 2G3AA 3GB0A 4UFVA 2DEAA 4H6UA 1RO5A 2DPSA 2ZEFA 1RXTA 4MHYA 4IUSA 4R57A 4F9UA 4ONWA 2G3TA 3PB9X 1TF8A 4KOSA 4NJRA 4ORFA 1K4JA 1SQHA 3PB8X 1B87A 1Z4RA 3KL9A 2A4NA 1ZO0A 4UIBA 2AFZA 4C68A 3PB4X 4GS4A 3BXMA 3QNVA 1XMBA 5K8MA 4F9VA 1BOBA 4MFJA 3TT2A 5GCNA 1XF8A 2AFOA 1AMPA 2WZNA 2FE7A 4CYOA 3D66A 4XPDC 4A30A 4OAEA 4O23A 4B10A 4M6GA 4UCMA 3GYAA 4MFZA 2J8MA 5LYDA 2XEJA 1H8LA 2B5GB 2B58A 4R6TA 3CXPA 2O4HA 1S7NA 3LWUA 3EY5A 4NGPA 3FMCA 1TKFA 3FIXA 3KQZA 4JXRA 5ELYA 5K8NA 1BO4A 4MMOA 4CPAA 2QVPA 1IYKA 3FRMA 2J8NA 2VI7A 4YU9A 1Z2LA 2RFHA 1QQ9A 4P44A 2DXQA 2OR4A 3BI0A 5HH1A 4ONUA 4F0XA 1UWYA 4A2ZA 4CAFA 2ZPAA 1TKHA 4P4DA 1Z5RA 2EBJA 3TFYA 3QAHA 1PUAA 3NA6A 4FD6A 1YSJA 2CTBA 5KTDA 4KS9A 2ZOFA 3FXTA 3VATA 1Z4EA 2D4PA 5FVJA 2V8DA 4CGOA 3FB3A 5JM6A 3UY5A 3H8EA 3IWEA 2PJCA 3CDXA 3S9LA 4OIWA 3W91A 2Q43A 1HDQA 1OBRA 1M4GA 4A38A 5KTAA 2BSWA 2CTCA 2GLJA 4R9MA 4A31A 2P6FA 1FY7A 3D7HA 2CY2A 5IB9A 2VBQA 4WWVA 4OLLA 2PJ3A 3CZXA 2R98A 1GYTA 3GIUA 5F48A 4HNXB 2BOAA 4HPSA 3TO7A 1XIXA 2EO8A 1Z8TA 3B3CA 3FYNA 4Q7AA 1B6BA 3V8IA 3PRTA 2NMTA 4A32A 1X10A 2F5IA 4PXEA 5D29A 5LRGA 4UCPA 4CAWA 1ON0A 3DDDA 2AFXA 4MHDA 1IICA 4C2YA 5K8OA 2FL4A 1YR0A 2PDOA 2Q7BA 1JQGA 1Z8XA 2ZW5A 4PSWA 3V7ZA 5C82A 1S7LA 3TC8A 4CGPA 3CXQA 3R9GA 4RN7A 2HB6A 3JVNA 4HNWB 2OU2A 2PRBA 4GM5A 1LCPA 2CXAA 2VEZA 4NJQA 3VARA 3MRUA 4OC5A 4A39A 4KOYA 4P4IA 4A95A 3TO6A 4OC3A 4DNCA 2PRQA 4ZGYB 2PJ9A 4TNUA 4UEEA 3D7FA 4E0AA 1YLEA 3RZAA 1XFOA 4KOWA 5HVGA 1ZG7A 2PR8A 5LRKA 3B8GA 3GY9A 2PVVA 3GUXA 1U6MA 5DWNA 3FJUA 1IU8A 3CPXA 4CAVA 3A9LA 2ZEOA 2Z3PA 4K30A 2Q4YA 2BCOA 4BINA 4KSFA 4B5PB 3S9NA 1LOKA 5G20A 4EWTA 5LYLA 4FBEA 2X7BA 1Z8LA 3ZJ0A 5J1QA 1P4NA 1CPSA 1VHOA 3V38A 5H84A 1XEBA 1X12A 3T90A 4UFXA 3RO0A 3KHXA 4P10A 1YK3A 4IF5A 2CNSA 1Z9UA 2B4DA 1HEEA 4R3LA 1IOIA 1NMTA 5EBVA 3H8FA 4U9YA
chains in the Genus database with same CATH topology
2ZXVA 3F0AA 3W6SA 1IIDA 1QSOA 2QECA 5G22A 2QIRA 2BUEA 5ISVA 3C26A 4QUSA 3S6KA 1M4DA 2FIAA 2GIVA 4CYPA 1XMTA 1S7KA 2ATRA 2Q04A 4UWJA 1NSLA 4EVYA 3SHPA 4BBHA 5AG5A 2Q44A 3TO9A 5F47A 4YFJA 3R95A 2C27A 2WUUA 4M85A 2YNCC 4PV6A 1IYLA 3EC4A 2R8VA 4KZTA 4AG9A 2FT0A 4AB7A 1V0CA 4R87A 3NE7A 4LX9A 2EUIA 4H89A 3PZJA 2WPWA 4JLYA 5A28A 4QC6A 2Z3LA 4MFPA 5EC4A 1OZPA 4UCNA 4MI4A 5BWAB 2VZYA 3FNCA 4NCZA 2QMLA 4L89A 4MBUA 4JXQA 4KOXA 1MJ9A 4E2AA 1NE9A 1WWZA 2Z3MA 5HMNA 4KUAA 1P0HA 2I00A 2P6GA 4L8AA 3N7ZA 4HKFA 2REFA 4Y49B 4CAEA 4KSAA 1KUVA 4KOVA 2JDDA 4KOUA 2PSWA 1GHEA 4NXYA 3DSBA 4JWPA 2R1IA 2OZUA 2FCKA 4KOTA 3FBUA 5G1ZA 3SXOA 2CNTA 3CXSA 1QSNA 4MJ8A 3TE4A 4KVOE 4F0YA 2I79A 4CYNA 2AE6A 2HQYA 4KORA 1L0CA 1TIQA 4CGNA 3I3GA 3IU2A 2Q0YA 2D4OA 4MFKA 3GKRA 1M4IA 3K9UA 4RI1A 2H5MA 2RC4A 2PQ8A 1N71A 2PR1A 3R96A 4QB9A 4QVTA 2GE3A 2ZW7A 4B11A 2YNEA 2VZZA 4NF1A 1VKCA 2P6EA 3D2PA 3VWDA 1UFHA 1PU9A 3IWGA 2B4DB 4Q38A 4B14A 1Q2YA 4Y49C 3H5ZA 2FS5A 4AVBA 2Z3NA 1LRZA 4B12A 3ZZIA 3R1KA 2VXKA 3RYOA 1I12A 3TOAA 4MY0A 3D3SA 3VWEA 1KUYA 4AG7A 2B3UA 4CRZB 2VQYA 2IL4A 2KCWA 3BJ7A 2FSRA 3DR6A 4AVAA 4B5OA 1M44A 4R3KA 5IB0A 4J3GA 4JJXA 4II9A 3R9FA 4Q36A 3EO4A 4UFWA 5F49A 3R9EA 3F5BA 1CM0A 1Y9KA 4CGMA 5I0CA 3JUWA 3LODA 1Y7RA 4ZBGA 2B3VA 4C2ZA 1YGHA 4OADA 4MFLA 3SXNA 1Q2DA 4RS2A 4M3SA 4AVCA 2REEA 3EFAA 4U9ZA 5IX3A 1VHSA 2Z3KA 3IGRA 5CNPA 4F6AA 2ARHA 1KZFA 5AG4A 2B5GA 3DNSA 3G3SA 5G21A 4KVXA 2B4BA 3PGPA 3TOBA 2K5TA 4H6ZA 4CYQA 3EXNA 5E96A 4PSXA 5F46A 2DPTA 1IB1E 3S6HA 1XE4A 2Z3OA 2OZGA 2YGWA 4KUBA 1S3ZA 3TCVA 3P2HA 4HNYB 4MY3A 5DWMA 1QSTA 1QSRA 1YX0A 5JQ4A 4KVME 2R7HA 4CRYB 2JDCA 4YRHA 2BEIA 3TTHA 1I21A 1MK4A 3W6XA 1Q2CA 3E0KA 4CGLA 4C7HA 2OB0A 3S6FA 4CS0B 3IU1A 4PK3A 4LUAA 3S6GA 2P0WA 5AG7A 1S7FA 3BLNA 4BMHA 2J8RA 4NSQA 2Y0MA 4C7IA 4X5KA 3WR7A 4E8OA 4A33A 4I49A 2GANA 2ZW6A 3D8PA 4XPKA 1M1DA 1KUXA 3D2MA 3LD2A 4XNHB 1CJWA 2JEVA 3G8WA 4JD6A 2Q4VA 4FD7A 2HV2A 4XPLA 3T9YA 2WPXA 5KTCA 4FD4A 5C88A 1MJAA 5A27A 1WK4A 2YNCA 3JTKA 2O28A 3H4QA 3BJ8A 4YGOA 2Z0ZA 3F8KA 4KLWA 4XPDB 2WSAA 2FXFA 3PP9A 4UBRA 4C2XA 2Z10A 4CAXA 4QBJA 2AJ6A 3OWCA 5AG6A 2OH1A 4B5PA 1I1DA 2Z11A 1Y9WA 5H86A 3KKWA 2FIWA 1J4JA 1S60A 4KLVA 4NEXA 5IV0A 2EVNA 5AGEA 3MGDA 4B13A 2YNDA 4PK2A 1MJBA 2HUZA 4FD5A 3DR8A 2JLMA 1S5KA 3I9SA 1QSMA 2ZW4A 2CNMA 3P2FA 5J8FA 3QB8A 2PC1A 1R57A 1YVKA 4U5YA 4UA3A 2BL1A 1YREA 4UWIA 5JPHA 2G0BA 4MFQA 1YVOA 5J8CA 4XNHC 2OZHA 2G3AA 4UFVA 4H6UA 1RO5A 2DPSA 1RXTA 4IUSA 4R57A 2G3TA 4KOSA 4ORFA 1K4JA 1SQHA 1B87A 1Z4RA 2A4NA 1ZO0A 4C68A 4GS4A 1BOBA 4MFJA 3TT2A 5GCNA 1XF8A 2FE7A 4CYOA 4XPDC 4A30A 4OAEA 4B10A 4UCMA 3GYAA 4MFZA 2J8MA 2B5GB 2B58A 3CXPA 1S7NA 3EY5A 3FIXA 4JXRA 1BO4A 1IYKA 3FRMA 2J8NA 2VI7A 2DXQA 5HH1A 4ONUA 4F0XA 4CAFA 4A2ZA 2ZPAA 3TFYA 3QAHA 1PUAA 4FD6A 5KTDA 4KS9A 3FXTA 1Z4EA 2D4PA 5FVJA 4CGOA 3FB3A 3UY5A 3IWEA 3W91A 1M4GA 5KTAA 2BSWA 4R9MA 4A31A 2P6FA 1FY7A 2CY2A 2VBQA 4OLLA 2R98A 5F48A 4HNXB 3TO7A 1XIXA 3FYNA 1B6BA 3V8IA 2NMTA 4A32A 2F5IA 4UCPA 4CAWA 1ON0A 3DDDA 4MHDA 1IICA 4C2YA 2FL4A 1YR0A 2PDOA 2Q7BA 2ZW5A 4PSWA 5C82A 1S7LA 4CGPA 3CXQA 3R9GA 3JVNA 4HNWB 2OU2A 2PRBA 2VEZA 2CXAA 4KOYA 4A95A 3TO6A 4DNCA 4ZGYB 4E0AA 1YLEA 4KOWA 2PR8A 3B8GA 3GY9A 1U6MA 5DWNA 4CAVA 3A9LA 4K30A 2Z3PA 2Q4YA 4KSFA 4B5PB 5G20A 2X7BA 3ZJ0A 1P4NA 5H84A 1XEBA 3T90A 4UFXA 4IF5A 1YK3A 2CNSA 1Z9UA 2B4DA 4R3LA 1NMTA 5EBVA 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXV A;  3F0A A;  3W6S A;  1IID A;  1QSO A;  2QEC A;  2QIR A;  2BUE A;  5ISV A;  3C26 A;  4QUS A;  3S6K A;  1M4D A;  2FIA A;  2GIV A;  1XMT A;  1S7K A;  2ATR A;  2Q04 A;  4UWJ A;  1NSL A;  4EVY A;  3SHP A;  2Q44 A;  3TO9 A;  5F47 A;  4YFJ A;  3R95 A;  2C27 A;  4M85 A;  4PV6 A;  1IYL A;  3EC4 A;  2R8V A;  4KZT A;  4AG9 A;  2FT0 A;  4AB7 A;  1V0C A;  4R87 A;  3NE7 A;  4LX9 A;  2EUI A;  4H89 A;  3PZJ A;  2WPW A;  4JLY A;  4QC6 A;  5EC4 A;  1OZP A;  4MI4 A;  2VZY A;  3FNC A;  4NCZ A;  2QML A;  4L89 A;  4MBU A;  4JXQ A;  4KOX A;  1MJ9 A;  4E2A A;  1NE9 A;  1WWZ A;  5HMN A;  4KUA A;  1P0H A;  2I00 A;  2P6G A;  4L8A A;  3N7Z A;  4HKF A;  2REF A;  4Y49 B;  1KUV A;  4KOV A;  2JDD A;  4KOU A;  2PSW A;  1GHE A;  4NXY A;  3DSB A;  4JWP A;  2R1I A;  2OZU A;  2FCK A;  4KOT A;  3FBU A;  3SXO A;  2CNT A;  3CXS A;  1QSN A;  4MJ8 A;  3TE4 A;  4KVO E;  4F0Y A;  2I79 A;  2AE6 A;  2HQY A;  4KOR A;  1L0C A;  1TIQ A;  3I3G A;  2Q0Y A;  2D4O A;  3GKR A;  1M4I A;  3K9U A;  4RI1 A;  2H5M A;  2RC4 A;  2PQ8 A;  1N71 A;  2PR1 A;  3R96 A;  4QB9 A;  4QVT A;  2GE3 A;  2ZW7 A;  2VZZ A;  4NF1 A;  1VKC A;  2P6E A;  3D2P A;  3VWD A;  1UFH A;  1PU9 A;  3IWG A;  2B4D B;  1Q2Y A;  4Y49 C;  2FS5 A;  4AVB A;  1LRZ A;  3ZZI A;  3R1K A;  2VXK A;  3RYO A;  1I12 A;  3TOA A;  4MY0 A;  3D3S A;  3VWE A;  1KUY A;  4AG7 A;  2B3U A;  4CRZ B;  2VQY A;  2IL4 A;  2KCW A;  3BJ7 A;  2FSR A;  3DR6 A;  4AVA A;  4B5O A;  1M44 A;  4R3K A;  5IB0 A;  4J3G A;  4JJX A;  4II9 A;  3R9F A;  3EO4 A;  5F49 A;  3R9E A;  3F5B A;  1CM0 A;  1Y9K A;  5I0C A;  3JUW A;  3LOD A;  1Y7R A;  4ZBG A;  2B3V A;  1YGH A;  4OAD A;  3SXN A;  1Q2D A;  4RS2 A;  4M3S A;  4AVC A;  2REE A;  3EFA A;  4U9Z A;  5IX3 A;  1VHS A;  3IGR A;  5CNP A;  4F6A A;  2ARH A;  1KZF A;  2B5G A;  3DNS A;  3G3S A;  4KVX A;  2B4B A;  3PGP A;  3TOB A;  2K5T A;  4H6Z A;  3EXN A;  5E96 A;  4PSX A;  5F46 A;  1IB1 E;  3S6H A;  1XE4 A;  2OZG A;  4KUB A;  1S3Z A;  3TCV A;  3P2H A;  4HNY B;  4MY3 A;  5DWM A;  1QST A;  1QSR A;  1YX0 A;  5JQ4 A;  4KVM E;  2R7H A;  4CRY B;  2JDC A;  4YRH A;  2BEI A;  3TTH A;  1I21 A;  1MK4 A;  3W6X A;  1Q2C A;  3E0K A;  2OB0 A;  3S6F A;  4CS0 B;  4PK3 A;  4LUA A;  3S6G A;  2P0W A;  1S7F A;  3BLN A;  4BMH A;  2J8R A;  4NSQ A;  2Y0M A;  4X5K A;  3WR7 A;  4E8O A;  4I49 A;  2GAN A;  2ZW6 A;  3D8P A;  4XPK A;  1M1D A;  1KUX A;  3D2M A;  3LD2 A;  4XNH B;  1CJW A;  2JEV A;  3G8W A;  4JD6 A;  2Q4V A;  4FD7 A;  2HV2 A;  4XPL A;  3T9Y A;  2WPX A;  5KTC A;  4FD4 A;  5C88 A;  1MJA A;  1WK4 A;  2O28 A;  3H4Q A;  3BJ8 A;  4YGO A;  2Z0Z A;  3F8K A;  4KLW A;  4XPD B;  2FXF A;  3PP9 A;  4UBR A;  2Z10 A;  4CAX A;  4QBJ A;  2AJ6 A;  3OWC A;  2OH1 A;  4B5P A;  1I1D A;  2Z11 A;  1Y9W A;  5H86 A;  3KKW A;  2FIW A;  1J4J A;  1S60 A;  4KLV A;  4NEX A;  5IV0 A;  2EVN A;  3MGD A;  4PK2 A;  1MJB A;  2HUZ A;  4FD5 A;  3DR8 A;  2JLM A;  1S5K A;  3I9S A;  1QSM A;  2ZW4 A;  2CNM A;  3P2F A;  5J8F A;  3QB8 A;  2PC1 A;  1R57 A;  1YVK A;  4U5Y A;  4UA3 A;  2BL1 A;  1YRE A;  4UWI A;  5JPH A;  2G0B A;  1YVO A;  5J8C A;  4XNH C;  2OZH A;  2G3A A;  4H6U A;  1RO5 A;  1RXT A;  4IUS A;  4R57 A;  2G3T A;  4KOS A;  4ORF A;  1K4J A;  1SQH A;  1B87 A;  1Z4R A;  2A4N A;  4GS4 A;  1BOB A;  3TT2 A;  5GCN A;  1XF8 A;  2FE7 A;  4XPD C;  4OAE A;  3GYA A;  2J8M A;  2B5G B;  2B58 A;  3CXP A;  1S7N A;  3EY5 A;  3FIX A;  4JXR A;  1BO4 A;  1IYK A;  3FRM A;  2J8N A;  2VI7 A;  2DXQ A;  5HH1 A;  4ONU A;  2ZPA A;  3TFY A;  3QAH A;  1PUA A;  4FD6 A;  5KTD A;  3FXT A;  1Z4E A;  2D4P A;  5FVJ A;  3FB3 A;  3UY5 A;  3W91 A;  1M4G A;  5KTA A;  2BSW A;  4R9M A;  2P6F A;  1FY7 A;  2CY2 A;  2VBQ A;  4OLL A;  2R98 A;  5F48 A;  4HNX B;  3TO7 A;  1XIX A;  3FYN A;  1B6B A;  3V8I A;  2NMT A;  2F5I A;  4CAW A;  1ON0 A;  3DDD A;  4MHD A;  1IIC A;  2FL4 A;  1YR0 A;  2PDO A;  2Q7B A;  2ZW5 A;  4PSW A;  5C82 A;  1S7L A;  3CXQ A;  3R9G A;  3JVN A;  4HNW B;  2OU2 A;  2PRB A;  2VEZ A;  4KOY A;  3TO6 A;  4DNC A;  4E0A A;  1YLE A;  4KOW A;  2PR8 A;  3B8G A;  3GY9 A;  1U6M A;  5DWN A;  4CAV A;  4K30 A;  2Q4Y A;  4B5P B;  2X7B A;  3ZJ0 A;  1P4N A;  5H84 A;  1XEB A;  3T90 A;  4IF5 A;  1YK3 A;  2CNS A;  1Z9U A;  2B4D A;  4R3L A;  1NMT A;  5EBV A;  4U9Y A; 
#chains in the Genus database with same CATH topology
 2ZXV A;  3F0A A;  3W6S A;  3SI2 A;  3RNZ A;  3D7G A;  1BLL E;  1IID A;  1QSO A;  2QEC A;  1YW4 A;  5G22 A;  2QIR A;  2BUE A;  1CG2 A;  2HC9 A;  5ISV A;  1ZLI A;  3K9T A;  3C26 A;  4QUS A;  3S6K A;  4ZI6 A;  1M4D A;  2FIA A;  2EK8 A;  2GIV A;  4R7M A;  2PJ4 A;  2WYR A;  3B3W A;  4CYP A;  1XMT A;  1S7K A;  2ATR A;  3I1U A;  2Q04 A;  4ZY1 A;  1BPM A;  4UWJ A;  1NSL A;  1CP7 A;  2RB7 A;  3SHP A;  5AG5 A;  4BBH A;  4OID A;  4EVY A;  4OME A;  2PJB A;  2Q44 A;  1F2P A;  3QAY A;  3TO9 A;  5F47 A;  4YFJ A;  1YLO A;  5LRJ A;  3R95 A;  4PXC A;  2C27 A;  4M6I A;  3SJE A;  2WUU A;  4MHZ A;  4M85 A;  2YNC C;  4PV6 A;  1IYL A;  3EC4 A;  2R8V A;  4KZT A;  1Z8W A;  4OC1 A;  4AG9 A;  2POK A;  2FT0 A;  4AB7 A;  1V0C A;  2JBK A;  3NE7 A;  4R87 A;  4LX9 A;  3HUV A;  2C6C A;  2EUI A;  4H89 A;  1A2Z A;  2ZEP A;  2XEF A;  3PZJ A;  2WPW A;  3B3V A;  2FVG A;  4JLY A;  5A28 A;  2F8H A;  1LAM A;  2PJ1 A;  4R76 A;  3H8G A;  2GLF A;  3IFE A;  4ZYQ A;  4QC6 A;  1ZLH A;  2Z3L A;  2CF4 A;  3S9M A;  4MFP A;  3D7D A;  2CIJ A;  2Q51 A;  5I4M A;  4NGR A;  5EC4 A;  3RAM A;  1OZP A;  4UCN A;  4MI4 A;  3SI1 A;  5BWA B;  2VZY A;  3FNC A;  2C1C A;  4NCZ A;  2QML A;  4OP4 A;  5EMI A;  4L89 A;  4MBU A;  4X3R A;  4JXQ A;  4KOX A;  3RBU A;  1MJ9 A;  4E2A A;  1NE9 A;  1WWZ A;  2Z3M A;  5LYI A;  4MCQ A;  5HMN A;  2ANP A;  3PFO A;  4KUA A;  1P0H A;  1AYE A;  2I00 A;  2ZEG A;  4MCP A;  2P6G A;  1XOV A;  4L8A A;  2PCU A;  1VIX A;  3SJF A;  3N7Z A;  2G9D A;  4DYO A;  4HKF A;  2PJ6 A;  2REF A;  1BAV A;  4NGM A;  4Y49 B;  1ELM P;  3PBB A;  4DUK A;  1VGY A;  4CAE A;  4KSA A;  1ZG8 A;  1FT7 A;  2IMO A;  4PQA A;  3JRU A;  2NSM A;  4F8Z A;  1KUV A;  4KOV A;  4P4B A;  2JDD A;  4MRI A;  4KOU A;  2PSW A;  1GHE A;  4NXY A;  2V8V A;  3NH5 A;  3DSB A;  4JWP A;  2R1I A;  2OZU A;  1IY7 A;  2FCK A;  4KOT A;  1R3N A;  3B3S A;  3FBU A;  5G1Z A;  3SXO A;  2ZEH A;  2CNT A;  3CXS A;  1QSN A;  4MJ8 A;  2F7V A;  3TE4 A;  4KVO E;  2AFW A;  4F0Y A;  2I79 A;  3MN8 A;  3WC5 A;  2AE6 A;  4CYN A;  2HQY A;  4KOR A;  2GRE A;  3L2N A;  1L0C A;  4FUU A;  1TIQ A;  4CGN A;  3I3G A;  3K2K A;  3IU2 A;  2Q0Y A;  3KR4 A;  2D4O A;  4MFK A;  3IEH A;  3PEI A;  1M4I A;  3GKR A;  3K9U A;  5DS0 A;  1R43 A;  2H5M A;  4RI1 A;  2RC4 A;  5JGF A;  2PQ8 A;  1N71 A;  3B2Y A;  4G1P A;  2PR1 A;  3R96 A;  4QB9 A;  4MHP A;  2PJ2 A;  3PFE A;  3KHZ A;  4JZ0 A;  4PXB A;  4QVT A;  3SJG A;  1LAP A;  2JEW A;  2GE3 A;  2ZW7 A;  2ZEL A;  2IQ6 A;  4B11 A;  2YNE A;  1RTQ A;  2JBJ A;  2VZZ A;  3NFZ A;  1VKC A;  2P6E A;  4NF1 A;  3D2P A;  3FF3 A;  3VWD A;  1UFH A;  3DLJ A;  4BD9 A;  1PU9 A;  4OC0 A;  2PVW A;  3IWG A;  1EE3 P;  3HLP A;  3SJX A;  3N5F A;  2NYQ A;  2B4D B;  4Q38 A;  3SI0 A;  4B14 A;  1Q2Y A;  4Y49 C;  2PJA A;  1XBU A;  3H5Z A;  2ODF A;  3BI1 A;  3KGQ A;  3KZW A;  3PBE A;  2FS5 A;  3D4U A;  4AVB A;  2PIY A;  1LRZ A;  2Z3N A;  4A94 A;  4B12 A;  3ZZI A;  3R1K A;  2VXK A;  2DF5 A;  3RYO A;  1I12 A;  1DE4 C;  3TOA A;  4MY0 A;  3D3S A;  3VWE A;  1YQE A;  4MXU A;  1TKJ A;  1KUY A;  2AFS A;  4RUH A;  1CP6 A;  1Y0Y A;  4W9Y A;  1BPN A;  2AFU A;  3NH4 A;  2ZEN A;  1IOF A;  2ZED A;  3IO1 A;  2B3U A;  4AG7 A;  3WC7 A;  2VQY A;  4CRZ B;  2IL4 A;  2KCW A;  2V8G A;  2XEI A;  3BJ7 A;  4EFD A;  4M6H A;  2FSR A;  3DR6 A;  4AVA A;  4B5O A;  1M44 A;  4EME A;  4R3K A;  4P4J A;  4NFR A;  5THW A;  5IB0 A;  4J3G A;  4JJX A;  4II9 A;  3R9F A;  4Q36 A;  3EO4 A;  4H2K A;  2C6P A;  1VHE A;  1TF9 A;  1NSA A;  4UFW A;  1FNO A;  5F49 A;  2OOT A;  3R9E A;  3F5B A;  1CM0 A;  5HVF A;  1Y9K A;  4CGM A;  5I0C A;  1F57 A;  3JUW A;  3LOD A;  4TWE A;  3WT4 A;  1Y7R A;  4OKO A;  3PB7 X;  4ZBG A;  4IAV A;  4P4F A;  2B3V A;  4C2Z A;  1YGH A;  3WAB A;  4OAD A;  1DTD A;  2C6G A;  3IJ3 A;  4MFL A;  3SXN A;  4K3N A;  2Q7S A;  1Q2D A;  4RS2 A;  2ZEM A;  4M3S A;  4AVC A;  2PJ5 A;  2REE A;  3FED A;  3EFA A;  4U9Z A;  5IX3 A;  1ARM A;  1VHS A;  2GFQ A;  3FEC A;  2Z3K A;  3IGR A;  5CNP A;  1XJO A;  4F6A A;  4LQ6 A;  1IGB A;  2ARH A;  1KZF A;  5AG4 A;  2B5G A;  4PPZ A;  3DNS A;  3G3S A;  5LYF A;  1AUG A;  5CPA A;  1TXR A;  5G21 A;  4KVX A;  1KWM A;  2ZEE A;  2B4B A;  3PGP A;  3TOB A;  2K5T A;  5HXD A;  4H6Z A;  4CYQ A;  1XRY A;  4Z65 A;  3EXN A;  5E96 A;  4PSX A;  5F46 A;  4X8I A;  2DPT A;  3LAC A;  1JWQ A;  3KR5 A;  4AXV A;  8CPA A;  4FWU A;  1IB1 E;  3S6H A;  2V8H A;  2OZG A;  1XE4 A;  2Z3O A;  2YGW A;  3IC1 A;  4KUB A;  4YWY A;  4P4E A;  2BO9 A;  1S3Z A;  3TCV A;  3P2H A;  4HNY B;  4MY3 A;  5DWM A;  1YW6 A;  1QST A;  2PJ7 A;  1QSR A;  1YX0 A;  3B7I A;  4IHM A;  5JQ4 A;  1F2O A;  1QMU A;  4KVM E;  2IJZ A;  2R7H A;  4CRY B;  4PXD A;  2JDC A;  4YRH A;  2BEI A;  3TTH A;  3FEE A;  2I3C A;  2QYV A;  1I21 A;  1MK4 A;  1LFW A;  1Q2C A;  3E0K A;  4NGQ A;  3W6X A;  4C7H A;  2OB0 A;  3S6F A;  4CGL A;  4CS0 B;  4FAI A;  4JYW A;  2PJ0 A;  3IU1 A;  4UIA A;  1LAN A;  4PK3 A;  7CPA A;  4LUA A;  3DGV A;  3S6G A;  4OC4 A;  3CT9 A;  4MHN A;  2P0W A;  2Q4Z A;  3IIB A;  4ZY0 A;  3ISX A;  3T8W A;  5AG7 A;  1S7F A;  3BLN A;  3TX8 A;  2J8R A;  4BMH A;  4NSQ A;  2Y0M A;  4C7I A;  6CPA A;  3ISZ A;  3FVL A;  4NGS A;  4X5K A;  3NH8 A;  4GXH A;  3FX6 A;  3WR7 A;  4A33 A;  4E8O A;  1Y7E A;  3KAS A;  4I49 A;  2GAN A;  2ZW6 A;  1HDU A;  3KQX A;  3D8P A;  4XPK A;  1M1D A;  3IWW A;  1KUX A;  1CPX A;  3D2M A;  3LD2 A;  4XNH B;  1CJW A;  2JEV A;  2O53 A;  3G8W A;  4UEZ A;  4JD6 A;  2EK9 A;  4UEF A;  2Q4V A;  3D67 A;  4FD7 A;  2HV2 A;  2QJ8 A;  4XPL A;  2AFM A;  2WPX A;  2PIZ A;  3T9Y A;  5KTC A;  4FD4 A;  2VL1 A;  4A37 A;  5C88 A;  4LQG A;  3VH9 A;  1MJA A;  4IK2 A;  4UF4 A;  5A27 A;  1WK4 A;  4B6Z A;  2YNC A;  1ELL P;  3D68 A;  3JTK A;  3PB6 X;  2PJ8 A;  5HVH A;  2O28 A;  3H4Q A;  4P45 A;  3BJ8 A;  3CPA A;  4YGO A;  2Z0Z A;  3F8K A;  4KLW A;  4MCR A;  4XPD B;  1ARL A;  4DJL A;  1PYT B;  2WSA A;  1PCA A;  2EWB A;  2FXF A;  3PP9 A;  4UBR A;  4C2X A;  2Z10 A;  4ZX9 A;  4CAX A;  4KSI A;  3KI9 A;  2GU2 A;  4X2T A;  4NGN A;  1Q7L A;  4QBJ A;  5CBM A;  2AJ6 A;  3OWC A;  2V77 A;  5AG6 A;  2OH1 A;  4B5P A;  1I1D A;  2Z11 A;  2ABZ A;  5JH9 A;  1Y9W A;  1YME A;  2XEG A;  5H86 A;  4ZX8 A;  4OC2 A;  3KKW A;  4NGT A;  2FIW A;  3GLJ A;  3LMS A;  1J4J A;  1CX8 A;  1S60 A;  2ZOG A;  3FH4 A;  4KLV A;  4NEX A;  5IV0 A;  2EVN A;  5AGE A;  5F09 A;  3MGD A;  2J9A A;  2PE3 A;  3WC6 A;  4B13 A;  3BHX A;  1CBX A;  2YND A;  4ZY2 A;  4PK2 A;  1MJB A;  4P6Y A;  5D8N A;  2HUZ A;  3B35 A;  4FD5 A;  3DR8 A;  2JLM A;  1S5K A;  3I9S A;  4R8F A;  1QSM A;  2ZW4 A;  2CNM A;  1M4L A;  3NE8 A;  3P2F A;  5J8F A;  3B3T A;  3QB8 A;  2PC1 A;  1R57 A;  4WJB A;  1YVK A;  5K8P A;  4U5Y A;  4UA3 A;  2BL1 A;  1YRE A;  4UWI A;  5JPH A;  2G0B A;  4MFQ A;  1YVO A;  4MCS A;  1Y0R A;  5J8C A;  4XNH C;  1ZG9 A;  2OZH A;  2G3A A;  3GB0 A;  4UFV A;  2DEA A;  4H6U A;  1RO5 A;  2DPS A;  2ZEF A;  1RXT A;  4MHY A;  4IUS A;  4R57 A;  4F9U A;  4ONW A;  2G3T A;  3PB9 X;  1TF8 A;  4KOS A;  4NJR A;  4ORF A;  1K4J A;  1SQH A;  3PB8 X;  1B87 A;  1Z4R A;  3KL9 A;  2A4N A;  1ZO0 A;  4UIB A;  2AFZ A;  4C68 A;  3PB4 X;  4GS4 A;  3BXM A;  3QNV A;  1XMB A;  5K8M A;  4F9V A;  1BOB A;  4MFJ A;  3TT2 A;  5GCN A;  1XF8 A;  2AFO A;  1AMP A;  2WZN A;  2FE7 A;  4CYO A;  3D66 A;  4XPD C;  4A30 A;  4OAE A;  4O23 A;  4B10 A;  4M6G A;  4UCM A;  3GYA A;  4MFZ A;  2J8M A;  5LYD A;  2XEJ A;  1H8L A;  2B5G B;  2B58 A;  4R6T A;  3CXP A;  2O4H A;  1S7N A;  3LWU A;  3EY5 A;  4NGP A;  3FMC A;  1TKF A;  3FIX A;  3KQZ A;  4JXR A;  5ELY A;  5K8N A;  1BO4 A;  4MMO A;  4CPA A;  2QVP A;  1IYK A;  3FRM A;  2J8N A;  2VI7 A;  4YU9 A;  1Z2L A;  2RFH A;  1QQ9 A;  4P44 A;  2DXQ A;  2OR4 A;  3BI0 A;  5HH1 A;  4ONU A;  4F0X A;  1UWY A;  4A2Z A;  4CAF A;  2ZPA A;  1TKH A;  4P4D A;  1Z5R A;  2EBJ A;  3TFY A;  3QAH A;  1PUA A;  3NA6 A;  4FD6 A;  1YSJ A;  2CTB A;  5KTD A;  4KS9 A;  2ZOF A;  3FXT A;  3VAT A;  1Z4E A;  2D4P A;  5FVJ A;  2V8D A;  4CGO A;  3FB3 A;  5JM6 A;  3UY5 A;  3H8E A;  3IWE A;  2PJC A;  3CDX A;  3S9L A;  4OIW A;  3W91 A;  2Q43 A;  1HDQ A;  1OBR A;  1M4G A;  4A38 A;  5KTA A;  2BSW A;  2CTC A;  2GLJ A;  4R9M A;  4A31 A;  2P6F A;  1FY7 A;  3D7H A;  2CY2 A;  5IB9 A;  2VBQ A;  4WWV A;  4OLL A;  2PJ3 A;  3CZX A;  2R98 A;  1GYT A;  3GIU A;  5F48 A;  4HNX B;  2BOA A;  4HPS A;  3TO7 A;  1XIX A;  2EO8 A;  1Z8T A;  3B3C A;  3FYN A;  4Q7A A;  1B6B A;  3V8I A;  3PRT A;  2NMT A;  4A32 A;  1X10 A;  2F5I A;  4PXE A;  5D29 A;  5LRG A;  4UCP A;  4CAW A;  1ON0 A;  3DDD A;  2AFX A;  4MHD A;  1IIC A;  4C2Y A;  5K8O A;  2FL4 A;  1YR0 A;  2PDO A;  2Q7B A;  1JQG A;  1Z8X A;  2ZW5 A;  4PSW A;  3V7Z A;  5C82 A;  1S7L A;  3TC8 A;  4CGP A;  3CXQ A;  3R9G A;  4RN7 A;  2HB6 A;  3JVN A;  4HNW B;  2OU2 A;  2PRB A;  4GM5 A;  1LCP A;  2CXA A;  2VEZ A;  4NJQ A;  3VAR A;  3MRU A;  4OC5 A;  4A39 A;  4KOY A;  4P4I A;  4A95 A;  3TO6 A;  4OC3 A;  4DNC A;  2PRQ A;  4ZGY B;  2PJ9 A;  4TNU A;  4UEE A;  3D7F A;  4E0A A;  1YLE A;  3RZA A;  1XFO A;  4KOW A;  5HVG A;  1ZG7 A;  2PR8 A;  5LRK A;  3B8G A;  3GY9 A;  2PVV A;  3GUX A;  1U6M A;  5DWN A;  3FJU A;  1IU8 A;  3CPX A;  4CAV A;  3A9L A;  2ZEO A;  2Z3P A;  4K30 A;  2Q4Y A;  2BCO A;  4BIN A;  4KSF A;  4B5P B;  3S9N A;  1LOK A;  5G20 A;  4EWT A;  5LYL A;  4FBE A;  2X7B A;  1Z8L A;  3ZJ0 A;  5J1Q A;  1P4N A;  1CPS A;  1VHO A;  3V38 A;  5H84 A;  1XEB A;  1X12 A;  3T90 A;  4UFX A;  3RO0 A;  3KHX A;  4P10 A;  1YK3 A;  4IF5 A;  2CNS A;  1Z9U A;  2B4D A;  1HEE A;  4R3L A;  1IOI A;  1NMT A;  5EBV A;  3H8F A;  4U9Y A; 
#chains in the Genus database with same CATH homology
 2ZXV A;  3F0A A;  3W6S A;  1IID A;  1QSO A;  2QEC A;  5G22 A;  2QIR A;  2BUE A;  5ISV A;  3C26 A;  4QUS A;  3S6K A;  1M4D A;  2FIA A;  2GIV A;  4CYP A;  1XMT A;  1S7K A;  2ATR A;  2Q04 A;  4UWJ A;  1NSL A;  4EVY A;  3SHP A;  4BBH A;  5AG5 A;  2Q44 A;  3TO9 A;  5F47 A;  4YFJ A;  3R95 A;  2C27 A;  2WUU A;  4M85 A;  2YNC C;  4PV6 A;  1IYL A;  3EC4 A;  2R8V A;  4KZT A;  4AG9 A;  2FT0 A;  4AB7 A;  1V0C A;  4R87 A;  3NE7 A;  4LX9 A;  2EUI A;  4H89 A;  3PZJ A;  2WPW A;  4JLY A;  5A28 A;  4QC6 A;  2Z3L A;  4MFP A;  5EC4 A;  1OZP A;  4UCN A;  4MI4 A;  5BWA B;  2VZY A;  3FNC A;  4NCZ A;  2QML A;  4L89 A;  4MBU A;  4JXQ A;  4KOX A;  1MJ9 A;  4E2A A;  1NE9 A;  1WWZ A;  2Z3M A;  5HMN A;  4KUA A;  1P0H A;  2I00 A;  2P6G A;  4L8A A;  3N7Z A;  4HKF A;  2REF A;  4Y49 B;  4CAE A;  4KSA A;  1KUV A;  4KOV A;  2JDD A;  4KOU A;  2PSW A;  1GHE A;  4NXY A;  3DSB A;  4JWP A;  2R1I A;  2OZU A;  2FCK A;  4KOT A;  3FBU A;  5G1Z A;  3SXO A;  2CNT A;  3CXS A;  1QSN A;  4MJ8 A;  3TE4 A;  4KVO E;  4F0Y A;  2I79 A;  4CYN A;  2AE6 A;  2HQY A;  4KOR A;  1L0C A;  1TIQ A;  4CGN A;  3I3G A;  3IU2 A;  2Q0Y A;  2D4O A;  4MFK A;  3GKR A;  1M4I A;  3K9U A;  4RI1 A;  2H5M A;  2RC4 A;  2PQ8 A;  1N71 A;  2PR1 A;  3R96 A;  4QB9 A;  4QVT A;  2GE3 A;  2ZW7 A;  4B11 A;  2YNE A;  2VZZ A;  4NF1 A;  1VKC A;  2P6E A;  3D2P A;  3VWD A;  1UFH A;  1PU9 A;  3IWG A;  2B4D B;  4Q38 A;  4B14 A;  1Q2Y A;  4Y49 C;  3H5Z A;  2FS5 A;  4AVB A;  2Z3N A;  1LRZ A;  4B12 A;  3ZZI A;  3R1K A;  2VXK A;  3RYO A;  1I12 A;  3TOA A;  4MY0 A;  3D3S A;  3VWE A;  1KUY A;  4AG7 A;  2B3U A;  4CRZ B;  2VQY A;  2IL4 A;  2KCW A;  3BJ7 A;  2FSR A;  3DR6 A;  4AVA A;  4B5O A;  1M44 A;  4R3K A;  5IB0 A;  4J3G A;  4JJX A;  4II9 A;  3R9F A;  4Q36 A;  3EO4 A;  4UFW A;  5F49 A;  3R9E A;  3F5B A;  1CM0 A;  1Y9K A;  4CGM A;  5I0C A;  3JUW A;  3LOD A;  1Y7R A;  4ZBG A;  2B3V A;  4C2Z A;  1YGH A;  4OAD A;  4MFL A;  3SXN A;  1Q2D A;  4RS2 A;  4M3S A;  4AVC A;  2REE A;  3EFA A;  4U9Z A;  5IX3 A;  1VHS A;  2Z3K A;  3IGR A;  5CNP A;  4F6A A;  2ARH A;  1KZF A;  5AG4 A;  2B5G A;  3DNS A;  3G3S A;  5G21 A;  4KVX A;  2B4B A;  3PGP A;  3TOB A;  2K5T A;  4H6Z A;  4CYQ A;  3EXN A;  5E96 A;  4PSX A;  5F46 A;  2DPT A;  1IB1 E;  3S6H A;  1XE4 A;  2Z3O A;  2OZG A;  2YGW A;  4KUB A;  1S3Z A;  3TCV A;  3P2H A;  4HNY B;  4MY3 A;  5DWM A;  1QST A;  1QSR A;  1YX0 A;  5JQ4 A;  4KVM E;  2R7H A;  4CRY B;  2JDC A;  4YRH A;  2BEI A;  3TTH A;  1I21 A;  1MK4 A;  3W6X A;  1Q2C A;  3E0K A;  4CGL A;  4C7H A;  2OB0 A;  3S6F A;  4CS0 B;  3IU1 A;  4PK3 A;  4LUA A;  3S6G A;  2P0W A;  5AG7 A;  1S7F A;  3BLN A;  4BMH A;  2J8R A;  4NSQ A;  2Y0M A;  4C7I A;  4X5K A;  3WR7 A;  4E8O A;  4A33 A;  4I49 A;  2GAN A;  2ZW6 A;  3D8P A;  4XPK A;  1M1D A;  1KUX A;  3D2M A;  3LD2 A;  4XNH B;  1CJW A;  2JEV A;  3G8W A;  4JD6 A;  2Q4V A;  4FD7 A;  2HV2 A;  4XPL A;  3T9Y A;  2WPX A;  5KTC A;  4FD4 A;  5C88 A;  1MJA A;  5A27 A;  1WK4 A;  2YNC A;  3JTK A;  2O28 A;  3H4Q A;  3BJ8 A;  4YGO A;  2Z0Z A;  3F8K A;  4KLW A;  4XPD B;  2WSA A;  2FXF A;  3PP9 A;  4UBR A;  4C2X A;  2Z10 A;  4CAX A;  4QBJ A;  2AJ6 A;  3OWC A;  5AG6 A;  2OH1 A;  4B5P A;  1I1D A;  2Z11 A;  1Y9W A;  5H86 A;  3KKW A;  2FIW A;  1J4J A;  1S60 A;  4KLV A;  4NEX A;  5IV0 A;  2EVN A;  5AGE A;  3MGD A;  4B13 A;  2YND A;  4PK2 A;  1MJB A;  2HUZ A;  4FD5 A;  3DR8 A;  2JLM A;  1S5K A;  3I9S A;  1QSM A;  2ZW4 A;  2CNM A;  3P2F A;  5J8F A;  3QB8 A;  2PC1 A;  1R57 A;  1YVK A;  4U5Y A;  4UA3 A;  2BL1 A;  1YRE A;  4UWI A;  5JPH A;  2G0B A;  4MFQ A;  1YVO A;  5J8C A;  4XNH C;  2OZH A;  2G3A A;  4UFV A;  4H6U A;  1RO5 A;  2DPS A;  1RXT A;  4IUS A;  4R57 A;  2G3T A;  4KOS A;  4ORF A;  1K4J A;  1SQH A;  1B87 A;  1Z4R A;  2A4N A;  1ZO0 A;  4C68 A;  4GS4 A;  1BOB A;  4MFJ A;  3TT2 A;  5GCN A;  1XF8 A;  2FE7 A;  4CYO A;  4XPD C;  4A30 A;  4OAE A;  4B10 A;  4UCM A;  3GYA A;  4MFZ A;  2J8M A;  2B5G B;  2B58 A;  3CXP A;  1S7N A;  3EY5 A;  3FIX A;  4JXR A;  1BO4 A;  1IYK A;  3FRM A;  2J8N A;  2VI7 A;  2DXQ A;  5HH1 A;  4ONU A;  4F0X A;  4CAF A;  4A2Z A;  2ZPA A;  3TFY A;  3QAH A;  1PUA A;  4FD6 A;  5KTD A;  4KS9 A;  3FXT A;  1Z4E A;  2D4P A;  5FVJ A;  4CGO A;  3FB3 A;  3UY5 A;  3IWE A;  3W91 A;  1M4G A;  5KTA A;  2BSW A;  4R9M A;  4A31 A;  2P6F A;  1FY7 A;  2CY2 A;  2VBQ A;  4OLL A;  2R98 A;  5F48 A;  4HNX B;  3TO7 A;  1XIX A;  3FYN A;  1B6B A;  3V8I A;  2NMT A;  4A32 A;  2F5I A;  4UCP A;  4CAW A;  1ON0 A;  3DDD A;  4MHD A;  1IIC A;  4C2Y A;  2FL4 A;  1YR0 A;  2PDO A;  2Q7B A;  2ZW5 A;  4PSW A;  5C82 A;  1S7L A;  4CGP A;  3CXQ A;  3R9G A;  3JVN A;  4HNW B;  2OU2 A;  2PRB A;  2VEZ A;  2CXA A;  4KOY A;  4A95 A;  3TO6 A;  4DNC A;  4ZGY B;  4E0A A;  1YLE A;  4KOW A;  2PR8 A;  3B8G A;  3GY9 A;  1U6M A;  5DWN A;  4CAV A;  3A9L A;  4K30 A;  2Z3P A;  2Q4Y A;  4KSF A;  4B5P B;  5G20 A;  2X7B A;  3ZJ0 A;  1P4N A;  5H84 A;  1XEB A;  3T90 A;  4UFX A;  4IF5 A;  1YK3 A;  2CNS A;  1Z9U A;  2B4D A;  4R3L A;  1NMT A;  5EBV A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...