5I0CA

Crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
89
Chain Sequence
b'EIREGHNKFYINDQGKQIAEIVFVPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YjdJ
publication title Crystal structure of predicted acyltransferase YjdJ with acyl-CoA N-acyltransferase domain from Escherichia coli str. K-12
rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 25
structure length 89
sequence length 90
ec nomenclature
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5i0cA00
1RXTA 1MK4A 3S6HA 3BJ8A 1XEBA 1J4JA 3TT2A 3K9UA 5F47A 2B4DB 1ON0A 3G3SA 4XPDB 2CNMA 4H89A 1L0CA 1U6MA 5FVJA 4UBRA 4NXYA 3GY9A 4U5YA 4HNWB 2FS5A 1Z4RA 4OADA 1SQHA 4PSWA 2EVNA 1YX0A 2B4DA 4L8AA 2Z10A 3FBUA 3KKWA 2Q4YA 4JJXA 2PSWA 4CAXA 1I1DA 2VZZA 4MI4A 1IIDA 1GHEA 1M44A 4UA3A 2OU2A 3FXTA 4JD6A 1YVOA 2OZGA 3TO9A 3S6GA 4PK2A 1B6BA 2B5GB 3G8WA 4OAEA 2B4BA 3D8PA 3DNSA 3JVNA 4KLVA 4PV6A 3EFAA 2ZXVA 3PGPA 4M3SA 3LD2A 2PR8A 3V8IA 3F5BA 5F48A 1R57A 3R9EA 1QSTA 2B5GA 1OZPA 3S6KA 2FL4A 4LX9A 3MGDA 3TO7A 4MY0A 3P2FA 1S7NA 2P6GA 1S7LA 1KZFA 2AJ6A 4DNCA 4B5PA 4I49A 3QB8A 2FE7A 4AG7A 2P6FA 5GCNA 1I12A 3R1KA 4KOXA 5EC4A 2NMTA 3TTHA 5DWNA 4KVME 3RYOA 1YREA 2REEA 3TFYA 2K5TA 4H6UA 5DWMA 3N7ZA 1QSNA 1M4IA 1Y9WA 4UWIA 4R3LA 4PSXA 2FIAA 5ISVA 3ZJ0A 1NSLA 2OB0A 4CRZB 2R7HA 5F46A 2I79A 5I0CA 4MJ8A 4JWPA 1XF8A 2EUIA 4KLWA 1VKCA 1KUYA 4K30A 1P4NA 2HQYA 1MJBA 2VI7A 2ZW5A 1YLEA 2D4OA 1Z9UA 5CNPA 4XNHB 2VZYA 3WR7A 3C26A 2B58A 1NE9A 2BSWA 2H5MA 2Z11A 4QC6A 1I21A 2BUEA 1BOBA 2X7BA 4IF5A 1S7KA 2R98A 5KTCA 3CXSA 2FT0A 3W91A 4NCZA 3EY5A 4E0AA 4FD5A 1YGHA 4MHDA 3R9FA 3SHPA 1QSRA 2G3TA 2JDCA 2JDDA 1VHSA 4YFJA 3I9SA 4RI1A 3EXNA 4OLLA 4LUAA 5KTDA 2HV2A 4CRYB 3D3SA 3H4QA 3B8GA 2CY2A 5JQ4A 4CAVA 2QIRA 3ZZIA 2J8MA 1M4DA 1CJWA 4Y49C 4KOWA 2ZW7A 4M85A 3BJ7A 2JEVA 4UWJA 2G3AA 2VQYA 3GYAA 4XPLA 4R87A 4AVBA 4HKFA 3D2MA 2P6EA 3LODA 2FXFA 5HMNA 1NMTA 5C82A 4KOSA 4KOVA 1MJAA 3TE4A 1Y9KA 3PZJA 2FCKA 4B5PB 2R8VA 3SXOA 5C88A 5H86A 2BL1A 4KOTA 3TOAA 5F49A 2G0BA 4QB9A 1TIQA 2QECA 4IUSA 1S5KA 2BEIA 3SXNA 4L89A 2IL4A 1YVKA 2ZW4A 4F6AA 4EVYA 2R1IA 4FD4A 2A4NA 3GKRA 5EBVA 2PDOA 3TOBA 3FRMA 1IICA 5IX3A 4CAWA 2VEZA 1KUVA 4ZBGA 2HUZA 3P2HA 2ZW6A 4E2AA 3T9YA 2KCWA 1LRZA 4QVTA 2JLMA 5H84A 2FIWA 5HH1A 4YGOA 2ATRA 3S6FA 1KUXA 3QAHA 1IYKA 4MBUA 3D2PA 4J3GA 4II9A 2Q04A 3W6XA 3W6SA 1V0CA 3FYNA 2J8NA 1RO5A 4KORA 2B3UA 2ZPAA 3EO4A 4R9MA 2Q4VA 3FB3A 2GE3A 4KVXA 2VXKA 4NSQA 1YR0A 2PRBA 3DDDA 1N71A 3IWGA 5E96A 4FD7A 4KOUA 4KZTA 3DSBA 2D4PA 4NEXA 3BLNA 2F5IA 2O28A 4AVCA 3R9GA 2I00A 4R57A 2PR1A 1WWZA 4XPDC 3R95A 4KOYA 1PUAA 5JPHA 2Z0ZA 3IGRA 4AG9A 4Y49B 2CNTA 1CM0A 1PU9A 4X5KA 4RS2A 1Z4EA 3CXQA 1S7FA 2OH1A 4HNXB 2Q7BA 3FNCA 3FIXA 4KUBA 4PK3A 1QSMA 3TCVA 2VBQA 5IV0A 2CNSA 4NF1A 4ONUA 3UY5A 3TO6A 3OWCA 1Q2CA 2Y0MA 4JLYA 5KTAA 1Y7RA 5J8FA 4BMHA 4AVAA 4KUAA 5IB0A 1XE4A 2ARHA 1UFHA 2OZUA 4YRHA 1S3ZA 1FY7A 3F0AA 1MJ9A 4MY3A 4CS0B 3PP9A 4QBJA 2GANA 3JUWA 3VWEA 3DR8A 2J8RA 2FSRA 1XIXA 4U9ZA 4FD6A 4B5OA 4HNYB 4E8OA 1K4JA 2WPXA 4GS4A 1M1DA 2AE6A 1Q2YA 4JXQA 4U9YA 3NE7A 1BO4A 1IB1E 2Q0YA 2DXQA 4KVOE 2OZHA 2C27A 2PQ8A 3DR6A 1YK3A 2RC4A 1S60A 4AB7A 3VWDA 1Q2DA 4F0YA 4H6ZA 3R96A 1WK4A 1P0HA 1IYLA 1B87A 1M4GA 2WPWA 4R3KA 3EC4A 4XNHC 2Q44A 2PC1A 3E0KA 2B3VA 2QMLA 3F8KA 3I3GA 4XPKA 3CXPA 2P0WA 1XMTA 2REFA 4JXRA 2GIVA 4ORFA 3T90A 5J8CA 4QUSA 1QSOA
chains in the Genus database with same CATH superfamily
1RXTA 1CP7A 2NSMA 4ZY2A 1MK4A 3KASA 3S6HA 3V7ZA 2CTCA 4P4DA 3BJ8A 5D8NA 1JQGA 3WT4A 1XMBA 4ONWA 1XEBA 1J4JA 2GU2A 5AG5A 1Z8XA 3K9UA 5F47A 2B4DB 1ON0A 3TT2A 3G3SA 2PJAA 4XPDB 2CNMA 4H89A 1L0CA 1U6MA 5FVJA 1Y7EA 3WC6A 3IO1A 4CYQA 4UBRA 4KSFA 4NXYA 3GY9A 4U5YA 2ANPA 2PJ6A 2OOTA 4HNWB 2FS5A 3CDXA 1Z4RA 2EK8A 4MHNA 4IAVA 2PJ3A 4KS9A 4OADA 4X3RA 2ZEGA 3D67A 5IB9A 3B35A 2XEGA 2C1CA 2HB6A 1SQHA 4PXEA 4PSWA 2EVNA 5LYIA 2GLJA 1YX0A 1LANA 2B4DA 2AFUA 1Z2LA 1Z8TA 1ZG8A 4G1PA 4L8AA 4GXHA 2J9AA 2Z10A 3FBUA 3KKWA 2Q4YA 4JJXA 2PSWA 4CAXA 2PJ9A 1I1DA 4C7IA 2VZZA 3D7HA 1TKFA 4MI4A 3B3TA 3I1UA 1LFWA 1IIDA 1GHEA 4MHPA 3PBEA 1M44A 4UA3A 2OU2A 3FXTA 4JD6A 1YVOA 2OZGA 2IQ6A 4OC1A 4MMOA 3S6GA 3TO9A 3PFEA 4PK2A 1B6BA 1M4LA 2B5GB 3G8WA 3SJXA 2PJ5A 4OAEA 1JWQA 2B4BA 1FNOA 2YNEA 3D8PA 3DNSA 3FVLA 1TKJA 2F7VA 3EFAA 3JVNA 4KLVA 2ZXVA 3PGPA 4PV6A 5JH9A 4M3SA 3LD2A 2POKA 3FJUA 2PR8A 3V8IA 2ZEMA 1LCPA 2Z3LA 3F5BA 3IU2A 1FT7A 3IIBA 5EMIA 5F48A 4M6IA 3S9NA 4PPZA 2PCUA 1R57A 3R9EA 1QSTA 5CPAA 4RN7A 2B5GA 1OZPA 3PB8X 4R7MA 3S6KA 3SJGA 5A27A 2FL4A 5CBMA 4LX9A 3MGDA 3TO7A 4MY0A 3P2FA 2IMOA 1S7NA 1BLLE 1TF9A 2P6GA 4FUUA 1S7LA 1KZFA 4HPSA 4A39A 2V8VA 3PBBA 2AJ6A 4DNCA 1R3NA 4NGSA 4B5PA 2CF4A 4I49A 2FVGA 2ZOFA 3QB8A 1IOFA 2FE7A 2Z3OA 4AG7A 3IEHA 2P6FA 5GCNA 5JM6A 1I12A 1ZG7A 3R1KA 4KOXA 4YU9A 2ODFA 2NMTA 1XFOA 2PJ4A 4K3NA 4MRIA 5EC4A 3H8FA 4CGMA 3TTHA 5DWNA 1YMEA 1CPXA 4KVME 4A94A 2GREA 4MFQA 2I3CA 3RYOA 2PE3A 3GB0A 3IFEA 1AUGA 1YREA 2REEA 3TFYA 2K5TA 4H6UA 4MXUA 4NFRA 4FWUA 2AFSA 3N7ZA 5DWMA 2DEAA 3CZXA 3ISXA 4DUKA 1QSNA 1M4IA 1Y9WA 2QYVA 3BI0A 3PB9X 4UWIA 4R3LA 4A95A 4PSXA 4Z65A 2FIAA 4OC2A 3BHXA 3FMCA 2PIZA 5ISVA 3ZJ0A 4ZX8A 1NSLA 2OB0A 4CRZB 2R7HA 2V8GA 4OC4A 1IOIA 5F46A 4EFDA 2I79A 5I0CA 1TKHA 1BAVA 4JWPA 4MJ8A 1XF8A 2EUIA 4KLWA 5LRGA 5HXDA 1VKCA 2CTBA 3JTKA 4R76A 1KUYA 2CIJA 3IWEA 4K30A 4LQ6A 3NH4A 1P4NA 2HQYA 1MJBA 2VI7A 2ZW5A 1YLEA 3RAMA 2PJ1A 2D4OA 4MFLA 1Z9UA 4ZYQA 2WSAA 5CNPA 4XNHB 2CXAA 2VZYA 3FEDA 4OIWA 4ZX9A 3SI1A 1CBXA 3MN8A 1F57A 3WR7A 3C26A 4A30A 2B58A 1NE9A 2BSWA 2H5MA 2Z11A 4H2KA 1I21A 4QC6A 2EBJA 2EO8A 1CP6A 4R8FA 3KQXA 2Z3NA 2BUEA 3ISZA 1BOBA 2PJ8A 2X7BA 3KGQA 4F9UA 4IF5A 4A37A 1S7KA 2R98A 4CYPA 2Q4ZA 2YNDA 8CPAA 4A31A 4F8ZA 3V38A 5KTCA 3CXSA 1LAMA 2FT0A 1UWYA 3PB4X 1BPMA 3W91A 4UCMA 6CPAA 4NCZA 3EY5A 4E0AA 1PCAA 1TXRA 4FD5A 3PRTA 1YGHA 4C2XA 4MCSA 4MHDA 2HC9A 3R9FA 3SHPA 1QSRA 1VHOA 2G3TA 2GLFA 4MCRA 5LRKA 2JBJA 3KZWA 2JDCA 5G22A 3B2YA 2JDDA 1VHSA 2OR4A 3GIUA 4GM5A 4YFJA 3SJFA 1YSJA 5A28A 3I9SA 4RI1A 1X12A 2YGWA 3EXNA 4OLLA 2XEJA 4LUAA 5KTDA 1XRYA 2HV2A 2JBKA 4CRYB 5AG7A 3D3SA 2ZOGA 3B8GA 3H4QA 4CAEA 1CG2A 2CY2A 4UCNA 4BD9A 5JQ4A 4CAVA 2QIRA 3ZZIA 2C6GA 2J8MA 3CT9A 1M4DA 1CJWA 2ZEFA 3GLJA 4KOWA 4Y49C 5D29A 2ZW7A 2BOAA 4M85A 5AG4A 3BJ7A 2ZEHA 2JEVA 3WC5A 4UWJA 2G3AA 2VQYA 3GYAA 4XPLA 4R87A 4AVBA 4TNUA 4HKFA 2RB7A 1ZO0A 3D2MA 3TX8A 4CYNA 2P6EA 3LODA 2FXFA 5HMNA 5BWAB 2PVVA 4TWEA 1NMTA 4A33A 2Z3KA 4KOSA 4KOVA 5C82A 1MJAA 3B7IA 3TE4A 3NE8A 1Y9KA 2Q7SA 7CPAA 3PZJA 4P44A 2FCKA 3K2KA 4NGQA 2R8VA 4PXDA 4B5PB 3D68A 3SXOA 5C88A 2AFMA 2NYQA 4M6HA 2BL1A 5H86A 2AFZA 4B14A 4ZI6A 3FEEA 4KOTA 3TOAA 5F49A 1ARLA 2G0BA 2PRQA 4CYOA 3BI1A 4QB9A 1TIQA 2ZELA 3B3WA 4X8IA 2QECA 5K8PA 2PJBA 4X2TA 4IUSA 1VHEA 1S5KA 5HVHA 2BEIA 4MFZA 4NGRA 3SXNA 5AGEA 4L89A 2IL4A 3LMSA 3S9LA 1YVKA 2ZW4A 4OC5A 4IHMA 4F6AA 1Z8WA 4AXVA 4EVYA 2R1IA 1A2ZA 3LWUA 4FD4A 2A4NA 3GKRA 5EBVA 5HVFA 2PDOA 3TOBA 3FRMA 1IY7A 2Z3PA 1IICA 5IX3A 1YQEA 4CAWA 2VEZA 1KUVA 4ZBGA 2HUZA 2C6CA 3D7FA 1ARMA 3P2HA 2ZW6A 2Z3MA 1ZLHA 4RUHA 3IC1A 4E2AA 4CGPA 2JEWA 3T9YA 2KCWA 4P10A 1LRZA 3QAYA 2BCOA 4C7HA 5LRJA 4PXBA 4QVTA 5K8OA 1VIXA 2JLMA 3RZAA 5H84A 2FIWA 4FBEA 3FF3A 5HH1A 4MFPA 3QNVA 4CGLA 4YGOA 2ATRA 4Q38A 3S6FA 2ZEDA 2XEIA 1RTQA 1AYEA 1KUXA 3PB6X 3LACA 3QAHA 2V77A 4MHYA 1IYKA 3NFZA 4MBUA 3D2PA 4FAIA 1PYTB 1YW4A 2IJZA 3GUXA 4J3GA 4II9A 2Q04A 4UCPA 3SJEA 1F2OA 3W6XA 4LQGA 3W6SA 4JYWA 4ZY0A 1V0CA 3FYNA 4P4FA 4P4BA 4UEFA 4BINA 2J8NA 4DYOA 3BXMA 1IU8A 1XJOA 4NJQA 1Z5RA 1RO5A 4UFXA 4KORA 2B3UA 5G1ZA 3B3VA 5THWA 4NGNA 2ZPAA 3EO4A 4R9MA 3KHXA 2Q4VA 4ZY1A 2DF5A 2O4HA 1IGBA 5K8NA 2BO9A 2GE3A 3FB3A 4KVXA 3JRUA 2VXKA 4O23A 4NSQA 1TF8A 3IJ3A 1YR0A 4P4EA 3D66A 1R43A 3KHZA 2PRBA 3DDDA 1N71A 3VH9A 4UEEA 1LOKA 4BBHA 3IWGA 4ZGYB 5E96A 4FD7A 1VGYA 4OKOA 4KOUA 1YW6A 3DLJA 2Q51A 4KZTA 3PB7X 3DSBA 2D4PA 3KL9A 3T8WA 2YNCC 3WABA 4NEXA 4KSAA 3BLNA 3FH4A 4OC0A 2F5IA 2PJCA 5F09A 5G20A 2GFQA 2O28A 4EMEA 2Q43A 3FECA 4AVCA 1NSAA 5K8MA 3R9GA 2I00A 4R57A 3N5FA 2PR1A 3VATA 4P6YA 2V8DA 1WWZA 4XPDC 3K9TA 4R6TA 4KOYA 3R95A 1HDQA 1PUAA 2DPTA 1ELMP 4NGPA 5JPHA 3CPAA 3KI9A 4NGMA 4W9YA 2Z0ZA 2YNCA 3IGRA 4OMEA 2CNTA 4Y49B 3TC8A 2AFOA 1Y0YA 1CM0A 2ZEEA 4AG9A 4F9VA 1PU9A 4DJLA 2AFWA 2ZENA 4CAFA 4X5KA 2EWBA 4MCQA 4RS2A 4M6GA 4CPAA 1QQ9A 3PFOA 1Z4EA 5AG6A 3HLPA 4MFKA 4MHZA 4P4JA 3CXQA 1S7FA 2OH1A 3H8GA 4HNXB 4C2ZA 2Q7BA 4Q36A 3FNCA 3FIXA 3B3SA 3HUVA 4KUBA 4PK3A 5LYDA 4UIAA 4B12A 1QSMA 3TCVA 2VBQA 5IV0A 2CNSA 3H5ZA 2WUUA 1CX8A 4NF1A 4ONUA 3UY5A 3TO6A 1CPSA 3KQZA 3RO0A 3OWCA 4A38A 4C2YA 4C68A 1Q2CA 2Y0MA 4JLYA 3RBUA 3WC7A 5KTAA 2G9DA 2ABZA 1YLOA 5LYLA 1Y7RA 4MFJA 5J8FA 2EK9A 2PJ7A 2PJ0A 1XOVA 4BMHA 4UIBA 3IWWA 3PEIA 3CPXA 4UF4A 4UEZA 2PIYA 4P45A 3KR5A 3S9MA 1AMPA 3RNZA 2C6PA 3KR4A 4A32A 3DGVA 4PXCA 4AVAA 5I4MA 4KUAA 4YWYA 2ZEPA 1HEEA 1XE4A 2ARHA 1UFHA 1QMUA 4KSIA 5IB0A 2OZUA 1DE4C 4YRHA 1S3ZA 1FY7A 3F0AA 1MJ9A 4MY3A 3B3CA 4CS0B 3PP9A 4QBJA 1XBUA 2GANA 3JUWA 1Q7LA 3VWEA 1H8LA 3DR8A 2J8RA 2XEFA 2VL1A 4WJBA 2FSRA 1XIXA 2PJ2A 3SI2A 4U9ZA 4FD6A 4B5OA 4HNYB 2PVWA 3SI0A 3NH8A 4E8OA 1K4JA 2WPXA 1KWMA 4GS4A 3L2NA 1F2PA 1OBRA 1M1DA 2AE6A 2ZEOA 2QJ8A 4B10A 1BPNA 2V8HA 5LYFA 4F0XA 1Q2YA 4JXQA 4A2ZA 4U9YA 4PQAA 4EWTA 3NE7A 4B6ZA 1ZG9A 4IK2A 4UFVA 4WWVA 1BO4A 2WZNA 3D4UA 1IB1E 1LAPA 4JZ0A 2Q0YA 2DXQA 2WYRA 4KVOE 4NJRA 2OZHA 2C27A 4MCPA 3FX6A 2PQ8A 3DR6A 1YK3A 1X10A 3D7GA 2RC4A 5J1QA 1S60A 5G21A 1GYTA 4AB7A 3VWDA 2F8HA 1Q2DA 4NGTA 4H6ZA 3R96A 4CGOA 1WK4A 1P0HA 4F0YA 5DS0A 1Y0RA 1IYLA 5ELYA 1B87A 1M4GA 2WPWA 4R3KA 4B13A 1Z8LA 3EC4A 4XNHC 4Q7AA 4UFWA 4CGNA 2DPSA 5JGFA 2Q44A 2PC1A 1EE3P 2B3VA 3E0KA 4OC3A 4P4IA 2RFHA 2AFXA 3A9LA 3NH5A 2QVPA 4B11A 3IU1A 2QMLA 3MRUA 3F8KA 1ZLIA 3I3GA 4XPKA 1HDUA 3CXPA 2P0WA 1ELLP 1XMTA 2REFA 3H8EA 4JXRA 2GIVA 4OIDA 4ORFA 3VARA 4OP4A 3T90A 5J8CA 4QUSA 3D7DA 3NA6A 1QSOA 5HVGA 1DTDA 2O53A
chains in the Genus database with same CATH topology
1RXTA 1MK4A 3S6HA 3BJ8A 1XEBA 1J4JA 5AG5A 3TT2A 3K9UA 5F47A 2B4DB 1ON0A 3G3SA 4XPDB 2CNMA 4H89A 1L0CA 1U6MA 5FVJA 4CYQA 4UBRA 4KSFA 4NXYA 3GY9A 4U5YA 4HNWB 2FS5A 1Z4RA 4KS9A 4OADA 1SQHA 4PSWA 2EVNA 1YX0A 2B4DA 4L8AA 2Z10A 3FBUA 3KKWA 2Q4YA 4JJXA 2PSWA 4CAXA 1I1DA 4C7IA 2VZZA 4MI4A 1IIDA 1GHEA 1M44A 4UA3A 2OU2A 3FXTA 4JD6A 1YVOA 2OZGA 3TO9A 3S6GA 4PK2A 1B6BA 2B5GB 3G8WA 4OAEA 2B4BA 2YNEA 3D8PA 3DNSA 3JVNA 4KLVA 4PV6A 3EFAA 2ZXVA 3PGPA 4M3SA 3LD2A 2PR8A 3V8IA 2Z3LA 3F5BA 3IU2A 5F48A 1R57A 3R9EA 1QSTA 2B5GA 1OZPA 3S6KA 5A27A 2FL4A 4LX9A 3MGDA 3TO7A 4MY0A 3P2FA 1S7NA 2P6GA 1S7LA 1KZFA 2AJ6A 4DNCA 4B5PA 4I49A 3QB8A 2Z3OA 2FE7A 4AG7A 2P6FA 5GCNA 1I12A 3R1KA 4KOXA 5EC4A 2NMTA 4CGMA 3TTHA 5DWNA 4KVME 4MFQA 3RYOA 1YREA 2REEA 3TFYA 2K5TA 4H6UA 5DWMA 3N7ZA 1QSNA 1M4IA 1Y9WA 4UWIA 4R3LA 4A95A 4PSXA 2FIAA 5ISVA 3ZJ0A 1NSLA 2OB0A 4CRZB 2R7HA 5F46A 2I79A 5I0CA 4MJ8A 4JWPA 1XF8A 2EUIA 4KLWA 1VKCA 3JTKA 1KUYA 3IWEA 4K30A 1P4NA 2HQYA 1MJBA 2VI7A 2ZW5A 1YLEA 2D4OA 4MFLA 1Z9UA 2WSAA 5CNPA 4XNHB 2CXAA 2VZYA 3WR7A 3C26A 4A30A 2B58A 1NE9A 2BSWA 2H5MA 2Z11A 4QC6A 1I21A 2Z3NA 2BUEA 1BOBA 2X7BA 4IF5A 1S7KA 2R98A 4CYPA 2YNDA 4A31A 5KTCA 3CXSA 2FT0A 3W91A 4UCMA 4NCZA 3EY5A 4E0AA 4FD5A 1YGHA 4C2XA 4MHDA 3R9FA 3SHPA 1QSRA 2G3TA 5G22A 2JDCA 2JDDA 1VHSA 4YFJA 5A28A 3I9SA 4RI1A 2YGWA 3EXNA 4OLLA 4LUAA 5KTDA 2HV2A 4CRYB 5AG7A 3D3SA 3H4QA 3B8GA 4CAEA 2CY2A 4UCNA 5JQ4A 4CAVA 2QIRA 3ZZIA 2J8MA 1M4DA 1CJWA 4Y49C 4KOWA 2ZW7A 4M85A 5AG4A 3BJ7A 2JEVA 4UWJA 2G3AA 2VQYA 3GYAA 4XPLA 4R87A 4AVBA 4HKFA 1ZO0A 3D2MA 4CYNA 2P6EA 3LODA 2FXFA 5HMNA 5BWAB 1NMTA 4A33A 2Z3KA 4KOSA 4KOVA 5C82A 1MJAA 3TE4A 1Y9KA 3PZJA 2FCKA 4B5PB 2R8VA 3SXOA 5C88A 5H86A 2BL1A 4B14A 4KOTA 3TOAA 5F49A 2G0BA 4CYOA 4QB9A 1TIQA 2QECA 4IUSA 1S5KA 2BEIA 4MFZA 3SXNA 5AGEA 4L89A 2IL4A 1YVKA 2ZW4A 4F6AA 4EVYA 2R1IA 4FD4A 2A4NA 3GKRA 5EBVA 2PDOA 3TOBA 3FRMA 2Z3PA 1IICA 5IX3A 4CAWA 2VEZA 1KUVA 4ZBGA 2HUZA 3P2HA 2ZW6A 2Z3MA 4E2AA 4CGPA 3T9YA 2KCWA 1LRZA 4C7HA 4QVTA 2JLMA 5H84A 2FIWA 5HH1A 4MFPA 4CGLA 4YGOA 2ATRA 4Q38A 3S6FA 1KUXA 3QAHA 1IYKA 4MBUA 3D2PA 4J3GA 4II9A 2Q04A 4UCPA 3W6XA 3W6SA 1V0CA 3FYNA 2J8NA 4UFXA 1RO5A 4KORA 2B3UA 5G1ZA 2ZPAA 3EO4A 4R9MA 2Q4VA 3FB3A 2GE3A 4KVXA 2VXKA 4NSQA 1YR0A 2PRBA 3DDDA 1N71A 4BBHA 3IWGA 4ZGYB 5E96A 4FD7A 4KOUA 4KZTA 3DSBA 2D4PA 2YNCC 4NEXA 4KSAA 3BLNA 2F5IA 5G20A 2O28A 4AVCA 3R9GA 2I00A 4R57A 2PR1A 1WWZA 4XPDC 3R95A 4KOYA 1PUAA 2DPTA 5JPHA 2Z0ZA 3IGRA 2YNCA 4Y49B 2CNTA 4AG9A 1CM0A 1PU9A 4CAFA 4X5KA 4RS2A 1Z4EA 5AG6A 4MFKA 3CXQA 1S7FA 2OH1A 4HNXB 4C2ZA 2Q7BA 4Q36A 3FNCA 3FIXA 4KUBA 4PK3A 4B12A 1QSMA 3TCVA 2VBQA 5IV0A 2CNSA 3H5ZA 2WUUA 4NF1A 4ONUA 3UY5A 3TO6A 3OWCA 4C2YA 4C68A 1Q2CA 2Y0MA 4JLYA 5KTAA 1Y7RA 4MFJA 5J8FA 4BMHA 4A32A 4AVAA 4KUAA 5IB0A 1XE4A 2ARHA 1UFHA 2OZUA 4YRHA 1S3ZA 1FY7A 3F0AA 1MJ9A 4MY3A 4CS0B 3PP9A 4QBJA 2GANA 3JUWA 3VWEA 3DR8A 2J8RA 2FSRA 1XIXA 4U9ZA 4FD6A 4B5OA 4HNYB 4E8OA 1K4JA 2WPXA 4GS4A 1M1DA 2AE6A 4B10A 4F0XA 1Q2YA 4JXQA 4A2ZA 4U9YA 3NE7A 4UFVA 1BO4A 1IB1E 2Q0YA 2DXQA 4KVOE 2OZHA 2C27A 2PQ8A 3DR6A 1YK3A 2RC4A 1S60A 5G21A 4AB7A 3VWDA 4CGOA 1Q2DA 4F0YA 4H6ZA 3R96A 1WK4A 1P0HA 1IYLA 1B87A 1M4GA 2WPWA 4R3KA 4B13A 3EC4A 4XNHC 4UFWA 4CGNA 2DPSA 2Q44A 2PC1A 3E0KA 2B3VA 3A9LA 4B11A 3IU1A 2QMLA 3F8KA 3I3GA 4XPKA 3CXPA 2P0WA 1XMTA 2REFA 4JXRA 2GIVA 4ORFA 3T90A 5J8CA 4QUSA 1QSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXT A;  1MK4 A;  3S6H A;  3BJ8 A;  1XEB A;  1J4J A;  3TT2 A;  3K9U A;  5F47 A;  2B4D B;  1ON0 A;  3G3S A;  4XPD B;  2CNM A;  4H89 A;  1L0C A;  1U6M A;  5FVJ A;  4UBR A;  4NXY A;  3GY9 A;  4U5Y A;  4HNW B;  2FS5 A;  1Z4R A;  4OAD A;  1SQH A;  4PSW A;  2EVN A;  1YX0 A;  2B4D A;  4L8A A;  2Z10 A;  3FBU A;  3KKW A;  2Q4Y A;  4JJX A;  2PSW A;  4CAX A;  1I1D A;  2VZZ A;  4MI4 A;  1IID A;  1GHE A;  1M44 A;  4UA3 A;  2OU2 A;  3FXT A;  4JD6 A;  1YVO A;  2OZG A;  3TO9 A;  3S6G A;  4PK2 A;  1B6B A;  2B5G B;  3G8W A;  4OAE A;  2B4B A;  3D8P A;  3DNS A;  3JVN A;  4KLV A;  4PV6 A;  3EFA A;  2ZXV A;  3PGP A;  4M3S A;  3LD2 A;  2PR8 A;  3V8I A;  3F5B A;  5F48 A;  1R57 A;  3R9E A;  1QST A;  2B5G A;  1OZP A;  3S6K A;  2FL4 A;  4LX9 A;  3MGD A;  3TO7 A;  4MY0 A;  3P2F A;  1S7N A;  2P6G A;  1S7L A;  1KZF A;  2AJ6 A;  4DNC A;  4B5P A;  4I49 A;  3QB8 A;  2FE7 A;  4AG7 A;  2P6F A;  5GCN A;  1I12 A;  3R1K A;  4KOX A;  5EC4 A;  2NMT A;  3TTH A;  5DWN A;  4KVM E;  3RYO A;  1YRE A;  2REE A;  3TFY A;  2K5T A;  4H6U A;  5DWM A;  3N7Z A;  1QSN A;  1M4I A;  1Y9W A;  4UWI A;  4R3L A;  4PSX A;  2FIA A;  5ISV A;  3ZJ0 A;  1NSL A;  2OB0 A;  4CRZ B;  2R7H A;  5F46 A;  2I79 A;  5I0C A;  4MJ8 A;  4JWP A;  1XF8 A;  2EUI A;  4KLW A;  1VKC A;  1KUY A;  4K30 A;  1P4N A;  2HQY A;  1MJB A;  2VI7 A;  2ZW5 A;  1YLE A;  2D4O A;  1Z9U A;  5CNP A;  4XNH B;  2VZY A;  3WR7 A;  3C26 A;  2B58 A;  1NE9 A;  2BSW A;  2H5M A;  2Z11 A;  4QC6 A;  1I21 A;  2BUE A;  1BOB A;  2X7B A;  4IF5 A;  1S7K A;  2R98 A;  5KTC A;  3CXS A;  2FT0 A;  3W91 A;  4NCZ A;  3EY5 A;  4E0A A;  4FD5 A;  1YGH A;  4MHD A;  3R9F A;  3SHP A;  1QSR A;  2G3T A;  2JDC A;  2JDD A;  1VHS A;  4YFJ A;  3I9S A;  4RI1 A;  3EXN A;  4OLL A;  4LUA A;  5KTD A;  2HV2 A;  4CRY B;  3D3S A;  3H4Q A;  3B8G A;  2CY2 A;  5JQ4 A;  4CAV A;  2QIR A;  3ZZI A;  2J8M A;  1M4D A;  1CJW A;  4Y49 C;  4KOW A;  2ZW7 A;  4M85 A;  3BJ7 A;  2JEV A;  4UWJ A;  2G3A A;  2VQY A;  3GYA A;  4XPL A;  4R87 A;  4AVB A;  4HKF A;  3D2M A;  2P6E A;  3LOD A;  2FXF A;  5HMN A;  1NMT A;  5C82 A;  4KOS A;  4KOV A;  1MJA A;  3TE4 A;  1Y9K A;  3PZJ A;  2FCK A;  4B5P B;  2R8V A;  3SXO A;  5C88 A;  5H86 A;  2BL1 A;  4KOT A;  3TOA A;  5F49 A;  2G0B A;  4QB9 A;  1TIQ A;  2QEC A;  4IUS A;  1S5K A;  2BEI A;  3SXN A;  4L89 A;  2IL4 A;  1YVK A;  2ZW4 A;  4F6A A;  4EVY A;  2R1I A;  4FD4 A;  2A4N A;  3GKR A;  5EBV A;  2PDO A;  3TOB A;  3FRM A;  1IIC A;  5IX3 A;  4CAW A;  2VEZ A;  1KUV A;  4ZBG A;  2HUZ A;  3P2H A;  2ZW6 A;  4E2A A;  3T9Y A;  2KCW A;  1LRZ A;  4QVT A;  2JLM A;  5H84 A;  2FIW A;  5HH1 A;  4YGO A;  2ATR A;  3S6F A;  1KUX A;  3QAH A;  1IYK A;  4MBU A;  3D2P A;  4J3G A;  4II9 A;  2Q04 A;  3W6X A;  3W6S A;  1V0C A;  3FYN A;  2J8N A;  1RO5 A;  4KOR A;  2B3U A;  2ZPA A;  3EO4 A;  4R9M A;  2Q4V A;  3FB3 A;  2GE3 A;  4KVX A;  2VXK A;  4NSQ A;  1YR0 A;  2PRB A;  3DDD A;  1N71 A;  3IWG A;  5E96 A;  4FD7 A;  4KOU A;  4KZT A;  3DSB A;  2D4P A;  4NEX A;  3BLN A;  2F5I A;  2O28 A;  4AVC A;  3R9G A;  2I00 A;  4R57 A;  2PR1 A;  1WWZ A;  4XPD C;  3R95 A;  4KOY A;  1PUA A;  5JPH A;  2Z0Z A;  3IGR A;  4AG9 A;  4Y49 B;  2CNT A;  1CM0 A;  1PU9 A;  4X5K A;  4RS2 A;  1Z4E A;  3CXQ A;  1S7F A;  2OH1 A;  4HNX B;  2Q7B A;  3FNC A;  3FIX A;  4KUB A;  4PK3 A;  1QSM A;  3TCV A;  2VBQ A;  5IV0 A;  2CNS A;  4NF1 A;  4ONU A;  3UY5 A;  3TO6 A;  3OWC A;  1Q2C A;  2Y0M A;  4JLY A;  5KTA A;  1Y7R A;  5J8F A;  4BMH A;  4AVA A;  4KUA A;  5IB0 A;  1XE4 A;  2ARH A;  1UFH A;  2OZU A;  4YRH A;  1S3Z A;  1FY7 A;  3F0A A;  1MJ9 A;  4MY3 A;  4CS0 B;  3PP9 A;  4QBJ A;  2GAN A;  3JUW A;  3VWE A;  3DR8 A;  2J8R A;  2FSR A;  1XIX A;  4U9Z A;  4FD6 A;  4B5O A;  4HNY B;  4E8O A;  1K4J A;  2WPX A;  4GS4 A;  1M1D A;  2AE6 A;  1Q2Y A;  4JXQ A;  4U9Y A;  3NE7 A;  1BO4 A;  1IB1 E;  2Q0Y A;  2DXQ A;  4KVO E;  2OZH A;  2C27 A;  2PQ8 A;  3DR6 A;  1YK3 A;  2RC4 A;  1S60 A;  4AB7 A;  3VWD A;  1Q2D A;  4F0Y A;  4H6Z A;  3R96 A;  1WK4 A;  1P0H A;  1IYL A;  1B87 A;  1M4G A;  2WPW A;  4R3K A;  3EC4 A;  4XNH C;  2Q44 A;  2PC1 A;  3E0K A;  2B3V A;  2QML A;  3F8K A;  3I3G A;  4XPK A;  3CXP A;  2P0W A;  1XMT A;  2REF A;  4JXR A;  2GIV A;  4ORF A;  3T90 A;  5J8C A;  4QUS A;  1QSO A; 
#chains in the Genus database with same CATH topology
 1RXT A;  1CP7 A;  2NSM A;  4ZY2 A;  1MK4 A;  3KAS A;  3S6H A;  3V7Z A;  2CTC A;  4P4D A;  3BJ8 A;  5D8N A;  1JQG A;  3WT4 A;  1XMB A;  4ONW A;  1XEB A;  1J4J A;  2GU2 A;  5AG5 A;  1Z8X A;  3K9U A;  5F47 A;  2B4D B;  1ON0 A;  3TT2 A;  3G3S A;  2PJA A;  4XPD B;  2CNM A;  4H89 A;  1L0C A;  1U6M A;  5FVJ A;  1Y7E A;  3WC6 A;  3IO1 A;  4CYQ A;  4UBR A;  4KSF A;  4NXY A;  3GY9 A;  4U5Y A;  2ANP A;  2PJ6 A;  2OOT A;  4HNW B;  2FS5 A;  3CDX A;  1Z4R A;  2EK8 A;  4MHN A;  4IAV A;  2PJ3 A;  4KS9 A;  4OAD A;  4X3R A;  2ZEG A;  3D67 A;  5IB9 A;  3B35 A;  2XEG A;  2C1C A;  2HB6 A;  1SQH A;  4PXE A;  4PSW A;  2EVN A;  5LYI A;  2GLJ A;  1YX0 A;  1LAN A;  2B4D A;  2AFU A;  1Z2L A;  1Z8T A;  1ZG8 A;  4G1P A;  4L8A A;  4GXH A;  2J9A A;  2Z10 A;  3FBU A;  3KKW A;  2Q4Y A;  4JJX A;  2PSW A;  4CAX A;  2PJ9 A;  1I1D A;  4C7I A;  2VZZ A;  3D7H A;  1TKF A;  4MI4 A;  3B3T A;  3I1U A;  1LFW A;  1IID A;  1GHE A;  4MHP A;  3PBE A;  1M44 A;  4UA3 A;  2OU2 A;  3FXT A;  4JD6 A;  1YVO A;  2OZG A;  2IQ6 A;  4OC1 A;  4MMO A;  3S6G A;  3TO9 A;  3PFE A;  4PK2 A;  1B6B A;  1M4L A;  2B5G B;  3G8W A;  3SJX A;  2PJ5 A;  4OAE A;  1JWQ A;  2B4B A;  1FNO A;  2YNE A;  3D8P A;  3DNS A;  3FVL A;  1TKJ A;  2F7V A;  3EFA A;  3JVN A;  4KLV A;  2ZXV A;  3PGP A;  4PV6 A;  5JH9 A;  4M3S A;  3LD2 A;  2POK A;  3FJU A;  2PR8 A;  3V8I A;  2ZEM A;  1LCP A;  2Z3L A;  3F5B A;  3IU2 A;  1FT7 A;  3IIB A;  5EMI A;  5F48 A;  4M6I A;  3S9N A;  4PPZ A;  2PCU A;  1R57 A;  3R9E A;  1QST A;  5CPA A;  4RN7 A;  2B5G A;  1OZP A;  3PB8 X;  4R7M A;  3S6K A;  3SJG A;  5A27 A;  2FL4 A;  5CBM A;  4LX9 A;  3MGD A;  3TO7 A;  4MY0 A;  3P2F A;  2IMO A;  1S7N A;  1BLL E;  1TF9 A;  2P6G A;  4FUU A;  1S7L A;  1KZF A;  4HPS A;  4A39 A;  2V8V A;  3PBB A;  2AJ6 A;  4DNC A;  1R3N A;  4NGS A;  4B5P A;  2CF4 A;  4I49 A;  2FVG A;  2ZOF A;  3QB8 A;  1IOF A;  2FE7 A;  2Z3O A;  4AG7 A;  3IEH A;  2P6F A;  5GCN A;  5JM6 A;  1I12 A;  1ZG7 A;  3R1K A;  4KOX A;  4YU9 A;  2ODF A;  2NMT A;  1XFO A;  2PJ4 A;  4K3N A;  4MRI A;  5EC4 A;  3H8F A;  4CGM A;  3TTH A;  5DWN A;  1YME A;  1CPX A;  4KVM E;  4A94 A;  2GRE A;  4MFQ A;  2I3C A;  3RYO A;  2PE3 A;  3GB0 A;  3IFE A;  1AUG A;  1YRE A;  2REE A;  3TFY A;  2K5T A;  4H6U A;  4MXU A;  4NFR A;  4FWU A;  2AFS A;  3N7Z A;  5DWM A;  2DEA A;  3CZX A;  3ISX A;  4DUK A;  1QSN A;  1M4I A;  1Y9W A;  2QYV A;  3BI0 A;  3PB9 X;  4UWI A;  4R3L A;  4A95 A;  4PSX A;  4Z65 A;  2FIA A;  4OC2 A;  3BHX A;  3FMC A;  2PIZ A;  5ISV A;  3ZJ0 A;  4ZX8 A;  1NSL A;  2OB0 A;  4CRZ B;  2R7H A;  2V8G A;  4OC4 A;  1IOI A;  5F46 A;  4EFD A;  2I79 A;  5I0C A;  1TKH A;  1BAV A;  4JWP A;  4MJ8 A;  1XF8 A;  2EUI A;  4KLW A;  5LRG A;  5HXD A;  1VKC A;  2CTB A;  3JTK A;  4R76 A;  1KUY A;  2CIJ A;  3IWE A;  4K30 A;  4LQ6 A;  3NH4 A;  1P4N A;  2HQY A;  1MJB A;  2VI7 A;  2ZW5 A;  1YLE A;  3RAM A;  2PJ1 A;  2D4O A;  4MFL A;  1Z9U A;  4ZYQ A;  2WSA A;  5CNP A;  4XNH B;  2CXA A;  2VZY A;  3FED A;  4OIW A;  4ZX9 A;  3SI1 A;  1CBX A;  3MN8 A;  1F57 A;  3WR7 A;  3C26 A;  4A30 A;  2B58 A;  1NE9 A;  2BSW A;  2H5M A;  2Z11 A;  4H2K A;  1I21 A;  4QC6 A;  2EBJ A;  2EO8 A;  1CP6 A;  4R8F A;  3KQX A;  2Z3N A;  2BUE A;  3ISZ A;  1BOB A;  2PJ8 A;  2X7B A;  3KGQ A;  4F9U A;  4IF5 A;  4A37 A;  1S7K A;  2R98 A;  4CYP A;  2Q4Z A;  2YND A;  8CPA A;  4A31 A;  4F8Z A;  3V38 A;  5KTC A;  3CXS A;  1LAM A;  2FT0 A;  1UWY A;  3PB4 X;  1BPM A;  3W91 A;  4UCM A;  6CPA A;  4NCZ A;  3EY5 A;  4E0A A;  1PCA A;  1TXR A;  4FD5 A;  3PRT A;  1YGH A;  4C2X A;  4MCS A;  4MHD A;  2HC9 A;  3R9F A;  3SHP A;  1QSR A;  1VHO A;  2G3T A;  2GLF A;  4MCR A;  5LRK A;  2JBJ A;  3KZW A;  2JDC A;  5G22 A;  3B2Y A;  2JDD A;  1VHS A;  2OR4 A;  3GIU A;  4GM5 A;  4YFJ A;  3SJF A;  1YSJ A;  5A28 A;  3I9S A;  4RI1 A;  1X12 A;  2YGW A;  3EXN A;  4OLL A;  2XEJ A;  4LUA A;  5KTD A;  1XRY A;  2HV2 A;  2JBK A;  4CRY B;  5AG7 A;  3D3S A;  2ZOG A;  3B8G A;  3H4Q A;  4CAE A;  1CG2 A;  2CY2 A;  4UCN A;  4BD9 A;  5JQ4 A;  4CAV A;  2QIR A;  3ZZI A;  2C6G A;  2J8M A;  3CT9 A;  1M4D A;  1CJW A;  2ZEF A;  3GLJ A;  4KOW A;  4Y49 C;  5D29 A;  2ZW7 A;  2BOA A;  4M85 A;  5AG4 A;  3BJ7 A;  2ZEH A;  2JEV A;  3WC5 A;  4UWJ A;  2G3A A;  2VQY A;  3GYA A;  4XPL A;  4R87 A;  4AVB A;  4TNU A;  4HKF A;  2RB7 A;  1ZO0 A;  3D2M A;  3TX8 A;  4CYN A;  2P6E A;  3LOD A;  2FXF A;  5HMN A;  5BWA B;  2PVV A;  4TWE A;  1NMT A;  4A33 A;  2Z3K A;  4KOS A;  4KOV A;  5C82 A;  1MJA A;  3B7I A;  3TE4 A;  3NE8 A;  1Y9K A;  2Q7S A;  7CPA A;  3PZJ A;  4P44 A;  2FCK A;  3K2K A;  4NGQ A;  2R8V A;  4PXD A;  4B5P B;  3D68 A;  3SXO A;  5C88 A;  2AFM A;  2NYQ A;  4M6H A;  2BL1 A;  5H86 A;  2AFZ A;  4B14 A;  4ZI6 A;  3FEE A;  4KOT A;  3TOA A;  5F49 A;  1ARL A;  2G0B A;  2PRQ A;  4CYO A;  3BI1 A;  4QB9 A;  1TIQ A;  2ZEL A;  3B3W A;  4X8I A;  2QEC A;  5K8P A;  2PJB A;  4X2T A;  4IUS A;  1VHE A;  1S5K A;  5HVH A;  2BEI A;  4MFZ A;  4NGR A;  3SXN A;  5AGE A;  4L89 A;  2IL4 A;  3LMS A;  3S9L A;  1YVK A;  2ZW4 A;  4OC5 A;  4IHM A;  4F6A A;  1Z8W A;  4AXV A;  4EVY A;  2R1I A;  1A2Z A;  3LWU A;  4FD4 A;  2A4N A;  3GKR A;  5EBV A;  5HVF A;  2PDO A;  3TOB A;  3FRM A;  1IY7 A;  2Z3P A;  1IIC A;  5IX3 A;  1YQE A;  4CAW A;  2VEZ A;  1KUV A;  4ZBG A;  2HUZ A;  2C6C A;  3D7F A;  1ARM A;  3P2H A;  2ZW6 A;  2Z3M A;  1ZLH A;  4RUH A;  3IC1 A;  4E2A A;  4CGP A;  2JEW A;  3T9Y A;  2KCW A;  4P10 A;  1LRZ A;  3QAY A;  2BCO A;  4C7H A;  5LRJ A;  4PXB A;  4QVT A;  5K8O A;  1VIX A;  2JLM A;  3RZA A;  5H84 A;  2FIW A;  4FBE A;  3FF3 A;  5HH1 A;  4MFP A;  3QNV A;  4CGL A;  4YGO A;  2ATR A;  4Q38 A;  3S6F A;  2ZED A;  2XEI A;  1RTQ A;  1AYE A;  1KUX A;  3PB6 X;  3LAC A;  3QAH A;  2V77 A;  4MHY A;  1IYK A;  3NFZ A;  4MBU A;  3D2P A;  4FAI A;  1PYT B;  1YW4 A;  2IJZ A;  3GUX A;  4J3G A;  4II9 A;  2Q04 A;  4UCP A;  3SJE A;  1F2O A;  3W6X A;  4LQG A;  3W6S A;  4JYW A;  4ZY0 A;  1V0C A;  3FYN A;  4P4F A;  4P4B A;  4UEF A;  4BIN A;  2J8N A;  4DYO A;  3BXM A;  1IU8 A;  1XJO A;  4NJQ A;  1Z5R A;  1RO5 A;  4UFX A;  4KOR A;  2B3U A;  5G1Z A;  3B3V A;  5THW A;  4NGN A;  2ZPA A;  3EO4 A;  4R9M A;  3KHX A;  2Q4V A;  4ZY1 A;  2DF5 A;  2O4H A;  1IGB A;  5K8N A;  2BO9 A;  2GE3 A;  3FB3 A;  4KVX A;  3JRU A;  2VXK A;  4O23 A;  4NSQ A;  1TF8 A;  3IJ3 A;  1YR0 A;  4P4E A;  3D66 A;  1R43 A;  3KHZ A;  2PRB A;  3DDD A;  1N71 A;  3VH9 A;  4UEE A;  1LOK A;  4BBH A;  3IWG A;  4ZGY B;  5E96 A;  4FD7 A;  1VGY A;  4OKO A;  4KOU A;  1YW6 A;  3DLJ A;  2Q51 A;  4KZT A;  3PB7 X;  3DSB A;  2D4P A;  3KL9 A;  3T8W A;  2YNC C;  3WAB A;  4NEX A;  4KSA A;  3BLN A;  3FH4 A;  4OC0 A;  2F5I A;  2PJC A;  5F09 A;  5G20 A;  2GFQ A;  2O28 A;  4EME A;  2Q43 A;  3FEC A;  4AVC A;  1NSA A;  5K8M A;  3R9G A;  2I00 A;  4R57 A;  3N5F A;  2PR1 A;  3VAT A;  4P6Y A;  2V8D A;  1WWZ A;  4XPD C;  3K9T A;  4R6T A;  4KOY A;  3R95 A;  1HDQ A;  1PUA A;  2DPT A;  1ELM P;  4NGP A;  5JPH A;  3CPA A;  3KI9 A;  4NGM A;  4W9Y A;  2Z0Z A;  2YNC A;  3IGR A;  4OME A;  2CNT A;  4Y49 B;  3TC8 A;  2AFO A;  1Y0Y A;  1CM0 A;  2ZEE A;  4AG9 A;  4F9V A;  1PU9 A;  4DJL A;  2AFW A;  2ZEN A;  4CAF A;  4X5K A;  2EWB A;  4MCQ A;  4RS2 A;  4M6G A;  4CPA A;  1QQ9 A;  3PFO A;  1Z4E A;  5AG6 A;  3HLP A;  4MFK A;  4MHZ A;  4P4J A;  3CXQ A;  1S7F A;  2OH1 A;  3H8G A;  4HNX B;  4C2Z A;  2Q7B A;  4Q36 A;  3FNC A;  3FIX A;  3B3S A;  3HUV A;  4KUB A;  4PK3 A;  5LYD A;  4UIA A;  4B12 A;  1QSM A;  3TCV A;  2VBQ A;  5IV0 A;  2CNS A;  3H5Z A;  2WUU A;  1CX8 A;  4NF1 A;  4ONU A;  3UY5 A;  3TO6 A;  1CPS A;  3KQZ A;  3RO0 A;  3OWC A;  4A38 A;  4C2Y A;  4C68 A;  1Q2C A;  2Y0M A;  4JLY A;  3RBU A;  3WC7 A;  5KTA A;  2G9D A;  2ABZ A;  1YLO A;  5LYL A;  1Y7R A;  4MFJ A;  5J8F A;  2EK9 A;  2PJ7 A;  2PJ0 A;  1XOV A;  4BMH A;  4UIB A;  3IWW A;  3PEI A;  3CPX A;  4UF4 A;  4UEZ A;  2PIY A;  4P45 A;  3KR5 A;  3S9M A;  1AMP A;  3RNZ A;  2C6P A;  3KR4 A;  4A32 A;  3DGV A;  4PXC A;  4AVA A;  5I4M A;  4KUA A;  4YWY A;  2ZEP A;  1HEE A;  1XE4 A;  2ARH A;  1UFH A;  1QMU A;  4KSI A;  5IB0 A;  2OZU A;  1DE4 C;  4YRH A;  1S3Z A;  1FY7 A;  3F0A A;  1MJ9 A;  4MY3 A;  3B3C A;  4CS0 B;  3PP9 A;  4QBJ A;  1XBU A;  2GAN A;  3JUW A;  1Q7L A;  3VWE A;  1H8L A;  3DR8 A;  2J8R A;  2XEF A;  2VL1 A;  4WJB A;  2FSR A;  1XIX A;  2PJ2 A;  3SI2 A;  4U9Z A;  4FD6 A;  4B5O A;  4HNY B;  2PVW A;  3SI0 A;  3NH8 A;  4E8O A;  1K4J A;  2WPX A;  1KWM A;  4GS4 A;  3L2N A;  1F2P A;  1OBR A;  1M1D A;  2AE6 A;  2ZEO A;  2QJ8 A;  4B10 A;  1BPN A;  2V8H A;  5LYF A;  4F0X A;  1Q2Y A;  4JXQ A;  4A2Z A;  4U9Y A;  4PQA A;  4EWT A;  3NE7 A;  4B6Z A;  1ZG9 A;  4IK2 A;  4UFV A;  4WWV A;  1BO4 A;  2WZN A;  3D4U A;  1IB1 E;  1LAP A;  4JZ0 A;  2Q0Y A;  2DXQ A;  2WYR A;  4KVO E;  4NJR A;  2OZH A;  2C27 A;  4MCP A;  3FX6 A;  2PQ8 A;  3DR6 A;  1YK3 A;  1X10 A;  3D7G A;  2RC4 A;  5J1Q A;  1S60 A;  5G21 A;  1GYT A;  4AB7 A;  3VWD A;  2F8H A;  1Q2D A;  4NGT A;  4H6Z A;  3R96 A;  4CGO A;  1WK4 A;  1P0H A;  4F0Y A;  5DS0 A;  1Y0R A;  1IYL A;  5ELY A;  1B87 A;  1M4G A;  2WPW A;  4R3K A;  4B13 A;  1Z8L A;  3EC4 A;  4XNH C;  4Q7A A;  4UFW A;  4CGN A;  2DPS A;  5JGF A;  2Q44 A;  2PC1 A;  1EE3 P;  2B3V A;  3E0K A;  4OC3 A;  4P4I A;  2RFH A;  2AFX A;  3A9L A;  3NH5 A;  2QVP A;  4B11 A;  3IU1 A;  2QML A;  3MRU A;  3F8K A;  1ZLI A;  3I3G A;  4XPK A;  1HDU A;  3CXP A;  2P0W A;  1ELL P;  1XMT A;  2REF A;  3H8E A;  4JXR A;  2GIV A;  4OID A;  4ORF A;  3VAR A;  4OP4 A;  3T90 A;  5J8C A;  4QUS A;  3D7D A;  3NA6 A;  1QSO A;  5HVG A;  1DTD A;  2O53 A; 
#chains in the Genus database with same CATH homology
 1RXT A;  1MK4 A;  3S6H A;  3BJ8 A;  1XEB A;  1J4J A;  5AG5 A;  3TT2 A;  3K9U A;  5F47 A;  2B4D B;  1ON0 A;  3G3S A;  4XPD B;  2CNM A;  4H89 A;  1L0C A;  1U6M A;  5FVJ A;  4CYQ A;  4UBR A;  4KSF A;  4NXY A;  3GY9 A;  4U5Y A;  4HNW B;  2FS5 A;  1Z4R A;  4KS9 A;  4OAD A;  1SQH A;  4PSW A;  2EVN A;  1YX0 A;  2B4D A;  4L8A A;  2Z10 A;  3FBU A;  3KKW A;  2Q4Y A;  4JJX A;  2PSW A;  4CAX A;  1I1D A;  4C7I A;  2VZZ A;  4MI4 A;  1IID A;  1GHE A;  1M44 A;  4UA3 A;  2OU2 A;  3FXT A;  4JD6 A;  1YVO A;  2OZG A;  3TO9 A;  3S6G A;  4PK2 A;  1B6B A;  2B5G B;  3G8W A;  4OAE A;  2B4B A;  2YNE A;  3D8P A;  3DNS A;  3JVN A;  4KLV A;  4PV6 A;  3EFA A;  2ZXV A;  3PGP A;  4M3S A;  3LD2 A;  2PR8 A;  3V8I A;  2Z3L A;  3F5B A;  3IU2 A;  5F48 A;  1R57 A;  3R9E A;  1QST A;  2B5G A;  1OZP A;  3S6K A;  5A27 A;  2FL4 A;  4LX9 A;  3MGD A;  3TO7 A;  4MY0 A;  3P2F A;  1S7N A;  2P6G A;  1S7L A;  1KZF A;  2AJ6 A;  4DNC A;  4B5P A;  4I49 A;  3QB8 A;  2Z3O A;  2FE7 A;  4AG7 A;  2P6F A;  5GCN A;  1I12 A;  3R1K A;  4KOX A;  5EC4 A;  2NMT A;  4CGM A;  3TTH A;  5DWN A;  4KVM E;  4MFQ A;  3RYO A;  1YRE A;  2REE A;  3TFY A;  2K5T A;  4H6U A;  5DWM A;  3N7Z A;  1QSN A;  1M4I A;  1Y9W A;  4UWI A;  4R3L A;  4A95 A;  4PSX A;  2FIA A;  5ISV A;  3ZJ0 A;  1NSL A;  2OB0 A;  4CRZ B;  2R7H A;  5F46 A;  2I79 A;  5I0C A;  4MJ8 A;  4JWP A;  1XF8 A;  2EUI A;  4KLW A;  1VKC A;  3JTK A;  1KUY A;  3IWE A;  4K30 A;  1P4N A;  2HQY A;  1MJB A;  2VI7 A;  2ZW5 A;  1YLE A;  2D4O A;  4MFL A;  1Z9U A;  2WSA A;  5CNP A;  4XNH B;  2CXA A;  2VZY A;  3WR7 A;  3C26 A;  4A30 A;  2B58 A;  1NE9 A;  2BSW A;  2H5M A;  2Z11 A;  4QC6 A;  1I21 A;  2Z3N A;  2BUE A;  1BOB A;  2X7B A;  4IF5 A;  1S7K A;  2R98 A;  4CYP A;  2YND A;  4A31 A;  5KTC A;  3CXS A;  2FT0 A;  3W91 A;  4UCM A;  4NCZ A;  3EY5 A;  4E0A A;  4FD5 A;  1YGH A;  4C2X A;  4MHD A;  3R9F A;  3SHP A;  1QSR A;  2G3T A;  5G22 A;  2JDC A;  2JDD A;  1VHS A;  4YFJ A;  5A28 A;  3I9S A;  4RI1 A;  2YGW A;  3EXN A;  4OLL A;  4LUA A;  5KTD A;  2HV2 A;  4CRY B;  5AG7 A;  3D3S A;  3H4Q A;  3B8G A;  4CAE A;  2CY2 A;  4UCN A;  5JQ4 A;  4CAV A;  2QIR A;  3ZZI A;  2J8M A;  1M4D A;  1CJW A;  4Y49 C;  4KOW A;  2ZW7 A;  4M85 A;  5AG4 A;  3BJ7 A;  2JEV A;  4UWJ A;  2G3A A;  2VQY A;  3GYA A;  4XPL A;  4R87 A;  4AVB A;  4HKF A;  1ZO0 A;  3D2M A;  4CYN A;  2P6E A;  3LOD A;  2FXF A;  5HMN A;  5BWA B;  1NMT A;  4A33 A;  2Z3K A;  4KOS A;  4KOV A;  5C82 A;  1MJA A;  3TE4 A;  1Y9K A;  3PZJ A;  2FCK A;  4B5P B;  2R8V A;  3SXO A;  5C88 A;  5H86 A;  2BL1 A;  4B14 A;  4KOT A;  3TOA A;  5F49 A;  2G0B A;  4CYO A;  4QB9 A;  1TIQ A;  2QEC A;  4IUS A;  1S5K A;  2BEI A;  4MFZ A;  3SXN A;  5AGE A;  4L89 A;  2IL4 A;  1YVK A;  2ZW4 A;  4F6A A;  4EVY A;  2R1I A;  4FD4 A;  2A4N A;  3GKR A;  5EBV A;  2PDO A;  3TOB A;  3FRM A;  2Z3P A;  1IIC A;  5IX3 A;  4CAW A;  2VEZ A;  1KUV A;  4ZBG A;  2HUZ A;  3P2H A;  2ZW6 A;  2Z3M A;  4E2A A;  4CGP A;  3T9Y A;  2KCW A;  1LRZ A;  4C7H A;  4QVT A;  2JLM A;  5H84 A;  2FIW A;  5HH1 A;  4MFP A;  4CGL A;  4YGO A;  2ATR A;  4Q38 A;  3S6F A;  1KUX A;  3QAH A;  1IYK A;  4MBU A;  3D2P A;  4J3G A;  4II9 A;  2Q04 A;  4UCP A;  3W6X A;  3W6S A;  1V0C A;  3FYN A;  2J8N A;  4UFX A;  1RO5 A;  4KOR A;  2B3U A;  5G1Z A;  2ZPA A;  3EO4 A;  4R9M A;  2Q4V A;  3FB3 A;  2GE3 A;  4KVX A;  2VXK A;  4NSQ A;  1YR0 A;  2PRB A;  3DDD A;  1N71 A;  4BBH A;  3IWG A;  4ZGY B;  5E96 A;  4FD7 A;  4KOU A;  4KZT A;  3DSB A;  2D4P A;  2YNC C;  4NEX A;  4KSA A;  3BLN A;  2F5I A;  5G20 A;  2O28 A;  4AVC A;  3R9G A;  2I00 A;  4R57 A;  2PR1 A;  1WWZ A;  4XPD C;  3R95 A;  4KOY A;  1PUA A;  2DPT A;  5JPH A;  2Z0Z A;  3IGR A;  2YNC A;  4Y49 B;  2CNT A;  4AG9 A;  1CM0 A;  1PU9 A;  4CAF A;  4X5K A;  4RS2 A;  1Z4E A;  5AG6 A;  4MFK A;  3CXQ A;  1S7F A;  2OH1 A;  4HNX B;  4C2Z A;  2Q7B A;  4Q36 A;  3FNC A;  3FIX A;  4KUB A;  4PK3 A;  4B12 A;  1QSM A;  3TCV A;  2VBQ A;  5IV0 A;  2CNS A;  3H5Z A;  2WUU A;  4NF1 A;  4ONU A;  3UY5 A;  3TO6 A;  3OWC A;  4C2Y A;  4C68 A;  1Q2C A;  2Y0M A;  4JLY A;  5KTA A;  1Y7R A;  4MFJ A;  5J8F A;  4BMH A;  4A32 A;  4AVA A;  4KUA A;  5IB0 A;  1XE4 A;  2ARH A;  1UFH A;  2OZU A;  4YRH A;  1S3Z A;  1FY7 A;  3F0A A;  1MJ9 A;  4MY3 A;  4CS0 B;  3PP9 A;  4QBJ A;  2GAN A;  3JUW A;  3VWE A;  3DR8 A;  2J8R A;  2FSR A;  1XIX A;  4U9Z A;  4FD6 A;  4B5O A;  4HNY B;  4E8O A;  1K4J A;  2WPX A;  4GS4 A;  1M1D A;  2AE6 A;  4B10 A;  4F0X A;  1Q2Y A;  4JXQ A;  4A2Z A;  4U9Y A;  3NE7 A;  4UFV A;  1BO4 A;  1IB1 E;  2Q0Y A;  2DXQ A;  4KVO E;  2OZH A;  2C27 A;  2PQ8 A;  3DR6 A;  1YK3 A;  2RC4 A;  1S60 A;  5G21 A;  4AB7 A;  3VWD A;  4CGO A;  1Q2D A;  4F0Y A;  4H6Z A;  3R96 A;  1WK4 A;  1P0H A;  1IYL A;  1B87 A;  1M4G A;  2WPW A;  4R3K A;  4B13 A;  3EC4 A;  4XNH C;  4UFW A;  4CGN A;  2DPS A;  2Q44 A;  2PC1 A;  3E0K A;  2B3V A;  3A9L A;  4B11 A;  3IU1 A;  2QML A;  3F8K A;  3I3G A;  4XPK A;  3CXP A;  2P0W A;  1XMT A;  2REF A;  4JXR A;  2GIV A;  4ORF A;  3T90 A;  5J8C A;  4QUS A;  1QSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...