5I0LA

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated arylsulfonamide carboxylate water-soluble inhibitor (dc27).
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i0lA00
1O0QA 2W12A 1KUIA 4DPEA 1GE6A 1GXDA 1OM7A 1Y93A 4PKRA 3LJTA 1GO7P 1J7NA 4ON1A 4FXQA 3LMCA 5H8XA 1Y0VA 1C8TA 3LGPA 4H3XA 2K9CA 2RJPA 3F1AA 1IACA 2OY4A 2I47A 4QKZA 3LJZA 2MZIA 3LIKA 3I7GA 1KUKA 1K7IA 5I4OA 4H2EA 1BQQM 1PWWA 2USNA 3EDHA 4Q1LA 1XFXA 1D7XA 4WKEA 3EDZA 1GKCA 3K7NA 3ZUKA 2X3CA 2X7MA 1MNCA 4AXQA 1QIAA 2KRJA 4GUYA 4H84A 1AF0A 3F18A 2EROA 3TT4A 4L6TA 1JK3A 1SATA 4IJOA 3EHYA 1CGFA 3LE9A 3LJGA 4CTHA 1IADA 1XFVA 2JT6A 3EWJA 5BPAA 3DL1A 2ERQA 3LUNA 1XURA 4I03A 2OW0A 3U1RA 3ZXHA 5LABA 4WZVA 1IAEA 1AKLA 4GR3A 4JP4A 4XM6A 1QICA 3L0VA 1I1IP 4A3WA 4WKIA 1UTTA 3AYKA 1C7KA 2OI0A 3OHOA 2D1OA 2WO9A 3RTSA 1YCMA 3RTTA 3OHLA 4IUWA 1I76A 2DW0A 2MLRA 3BA0A 3LK8A 3VI1A 2SRTA 4DF9A 4FU4A 2X3AA 830CA 1G12A 2D1NA 3HBUP 3CKIA 4FXYP 3G5CA 2OXZA 4DD8A 1PWPA 4GR8A 1MMRA 3G42A 3EDGA 5L7FA 2L0RA 1QJJA 4H82A 1I73A 2E2DA 1YP1A 3DSLA 5BOTA 2DW1A 1SRPA 5I3MA 2CLTA 3F19A 2DW2A 4XM8A 2A8HA 4PKWA 1DTHA 4FVLA 2OZRA 1EAKA 3DWBA 1CAQA 3B8ZA 4GWNA 4AIGA 2YIGA 4PKTA 4XBHA 5D1SA 1JH1A 2OXUA 3HY7A 1QJIA 3HDBA 2Z2DA 1ZTQA 1SLNA 1JJ9A 3B2ZA 4PKSA 1KUFA 1MMQA 4WF6A 3KWVC 1HY7A 1KAPP 3NX7A 3HDAP 1G05A 2OVZA 4L63A 2V4BA 3N2VA 3WV2A 3ZVSA 2FV5A 2W15A 1OO9A 3LKAA 2N8RA 1EUBA 1R1IA 1XFYA 4H30A 1BZSA 1JAOA 1ZXCA 5I12A 1C3IA 3EDIA 1R55A 3HBVP 4J4MA 2CKIA 2POJA 2XS4A 1FLSA 1K7QA 3DNGA 3P24A 1HFSA 3F17A 1UMTA 1QIBA 2YB9A 5D7WA 1SMPA 1ROSA 3UVCA 1A86A 2Y6DA 2RJQA 2PJTA 4H1QA 5D3CA 4XM7A 2HU6A 3HB2P 5I2ZA 1XUDA 1BUDA 1GKDA 3TSKA 1BSWA 1EB6A 1HV5A 1JKYA 2O36A 3F16A 4EFSA 1RMZA 2K2GA 2WOAA 1OMJA 2X3BA 3LILA 5B5OA 1R1HA 3KEKA 5I43A 2MZEA 1KUGA 3AYUA 1MMBA 1G9KA 1BKCA 1G4KA 3I7IA 2MZHA 1HOVA 1ND1A 1KBCA 1XUCA 5CUHA 966CA 3Q2GA 1FBLA 1OS9A 1ATLA 5L79A 3KHIA 2MLSA 2OW2A 1JIZA 1DMTA 1KUHA 1D8MA 1ZS0A 2XS3A 3WV1A 1RM8A 4JIJA 5D1TA 4R3VA 1ZP5A 2QPJA 3DPEA 1XFWA 1UTZA 1Y8JA 1CGLA 1CQRA 1R54A 1SU3A 4A7BA 1HTDA 1XFZA 3B92A 4HMAA 1GE5A 1BM6A 1G49A 1WNIA 1ZVXA 3L0TA 3N2UA 1Q3AA 4GQLA 1IAAA 4JPAA 2DDYA 1CIZA 2OY2A 2E3XA 4H49A 2FV9A 3LQBA 2AYKA 1JAQA 2ERPA 2J0TA 1JANA 4GF1A 3KRYA 1R1JA 1XFUA 1JIWP 2JSDA 1B8YA 5JMYA 456CA 4XCTA 1CGEA 3DPFA 3E8RA 3LQ0A 4WK7A 2J83A 2OW1A 2W0DA 1YOUA 2W14A 3VTGA 3Q2HA 2AIGP 2DDFA 3AIGA 1A85A 1IABA 1BKCE 1CXVA 1D8FA 4PKVA 1S4BP 1ZXVA 4GR0A 4AYKA 2JNPA 3K7LA 1BUVM 1MMPA 2JIHA 4AUOA 1OM6A 3LIRA 1USNA 4IN9A 3O64A 1CK7A 3TS4A 1SLMA 3V96B 1UEAA 4PKUA 3LUMA 2O3EA 1BQOA 4ZR5A 1PWUA 1ASTA 2W13A 4JQGA 1K7GA 4PKQA 4G9LA 1PWQA 3HY9A 3LEAA 1B3DA 2OXWA 3GBOA 1GE7A 3MA2A 4ILWD 4I35A 4L19A 3HYGA 5B5PA 3F15A 1Z3JA 2JT5A 1AYKA 5D1UA 1D5JA 3ELMA 1H71P 1IAGA 2OVXA 5BOYA 5CZMA 2Y6CA 3KEJA 4JA1A 3KMEA 3SHIA 4DV8A 3USNA 3EHXA 1JAPA 3KECA 5D2BA 1O0TA 4G0DA 3WV3A 1QUAA 4GWMA 1BKCI 3O2XA 1UMSA 1GO8P 1BIWA 3TVCA 4H76A 2OW9A 1OM8A 5I0LA 1HFCA 1L6JA 3KMCA 1OS2A 1FM1A 1YQYA 3P1VA 1PWVA 5CXAA 2WO8A 2TCLA 4HX3A
chains in the Genus database with same CATH superfamily
1O0QA 2W12A 1KUIA 4DPEA 1GE6A 1GXDA 1OM7A 1Y93A 4PKRA 3LJTA 1GO7P 1J7NA 4ON1A 4FXQA 3LMCA 5H8XA 1Y0VA 1C8TA 3LGPA 4H3XA 2K9CA 2RJPA 3F1AA 1IACA 2OY4A 2I47A 4QKZA 3LJZA 2MZIA 3LIKA 3I7GA 1KUKA 1K7IA 5I4OA 4H2EA 1BQQM 1PWWA 2USNA 1OZ9A 3EDHA 4Q1LA 1XFXA 1D7XA 4WKEA 3EDZA 1GKCA 3K7NA 3ZUKA 2X3CA 2X7MA 1MNCA 4AXQA 1QIAA 2KRJA 4GUYA 4H84A 1AF0A 3F18A 2EROA 3TT4A 4L6TA 1JK3A 1SATA 4IJOA 3EHYA 1CGFA 3LE9A 3LJGA 4CTHA 1IADA 1XFVA 2JT6A 3EWJA 5BPAA 3DL1A 2ERQA 3LUNA 1XURA 4I03A 2OW0A 3U1RA 3ZXHA 5LABA 4L7AA 4WZVA 1IAEA 1AKLA 4GR3A 4JP4A 4XM6A 1QICA 3L0VA 1I1IP 4A3WA 4WKIA 1UTTA 3AYKA 1C7KA 2OI0A 3OHOA 2D1OA 2WO9A 3RTSA 1YCMA 3RTTA 3OHLA 4IUWA 1I76A 2DW0A 2MLRA 3BA0A 3LK8A 3VI1A 2SRTA 4DF9A 4FU4A 2X3AA 830CA 1G12A 2D1NA 3HBUP 3CKIA 4FXYP 3G5CA 2OXZA 4DD8A 1PWPA 4GR8A 1MMRA 3G42A 3EDGA 5L7FA 2L0RA 1QJJA 4H82A 1I73A 2E2DA 1YP1A 3DSLA 5BOTA 2DW1A 1SRPA 5I3MA 2CLTA 3F19A 2DW2A 4XM8A 2A8HA 4PKWA 1DTHA 4FVLA 2OZRA 1EAKA 3DWBA 1CAQA 3B8ZA 4GWNA 4AIGA 2YIGA 4PKTA 1XM5A 4XBHA 5D1SA 1JH1A 2OXUA 3HY7A 1QJIA 3HDBA 2Z2DA 1ZTQA 1SLNA 1JJ9A 3B2ZA 4PKSA 1KUFA 1MMQA 4WF6A 3KWVC 1HY7A 1KAPP 3NX7A 3HDAP 1G05A 2OVZA 4L63A 2V4BA 3N2VA 3WV2A 3ZVSA 2FV5A 2W15A 1OO9A 3LKAA 2N8RA 1EUBA 1R1IA 1XFYA 4H30A 1BZSA 1JAOA 1ZXCA 5I12A 1C3IA 3EDIA 1R55A 3HBVP 4J4MA 2CKIA 2POJA 2XS4A 1FLSA 1K7QA 3DNGA 3P24A 3DTIA 1HFSA 3F17A 1UMTA 1QIBA 2YB9A 5D7WA 1SMPA 1ROSA 3UVCA 1A86A 2Y6DA 2RJQA 2PJTA 4H1QA 5D3CA 4XM7A 2HU6A 3HB2P 5I2ZA 1XUDA 1BUDA 1GKDA 3TSKA 1BSWA 1EB6A 1HV5A 1JKYA 2O36A 3F16A 4EFSA 1RMZA 2K2GA 2WOAA 1OMJA 2X3BA 3LILA 5B5OA 1R1HA 3KEKA 5I43A 2MZEA 1KUGA 3AYUA 1MMBA 1G9KA 1BKCA 1G4KA 3I7IA 2MZHA 1HOVA 1ND1A 1KBCA 1XUCA 5CUHA 966CA 3Q2GA 1FBLA 1OS9A 1ATLA 5L79A 3KHIA 2MLSA 2OW2A 1JIZA 1DMTA 1KUHA 1D8MA 1ZS0A 2XS3A 3WV1A 1RM8A 4JIJA 5D1TA 4R3VA 1ZP5A 2QPJA 3DPEA 1XFWA 1UTZA 1Y8JA 1CGLA 1CQRA 1R54A 1TVIA 1SU3A 4A7BA 1HTDA 1XFZA 3B92A 4HMAA 1GE5A 1BM6A 1G49A 1WNIA 1ZVXA 3L0TA 3N2UA 1Q3AA 4GQLA 1IAAA 4JPAA 2DDYA 1CIZA 2OY2A 2E3XA 4H49A 2FV9A 3LQBA 2AYKA 1JAQA 2ERPA 2J0TA 1JANA 4GF1A 3KRYA 1R1JA 1XFUA 1JIWP 2JSDA 1B8YA 5JMYA 456CA 4XCTA 1CGEA 3DPFA 3E8RA 3LQ0A 4WK7A 2J83A 2OW1A 2W0DA 1YOUA 2W14A 3VTGA 3Q2HA 2AIGP 2DDFA 3AIGA 1A85A 1IABA 1BKCE 1CXVA 2YUFA 1D8FA 4PKVA 1S4BP 1ZXVA 4GR0A 4AYKA 2JNPA 3K7LA 1BUVM 1MMPA 2JIHA 4AUOA 1OM6A 3LIRA 3DTKA 1USNA 4IN9A 3O64A 1CK7A 3TS4A 1SLMA 3V96B 1UEAA 4PKUA 3LUMA 2O3EA 1BQOA 4ZR5A 1PWUA 1ASTA 3DTEA 2W13A 4JQGA 1K7GA 4PKQA 4G9LA 1PWQA 3HY9A 3LEAA 1B3DA 2OXWA 3GBOA 1GE7A 3MA2A 4ILWD 4I35A 4L19A 3HYGA 5B5PA 3F15A 1Z3JA 2JT5A 1AYKA 5D1UA 1D5JA 3ELMA 1H71P 1IAGA 2OVXA 5BOYA 5CZMA 2Y6CA 3KEJA 4JA1A 3KMEA 1XAXA 3SHIA 4DV8A 3USNA 3EHXA 1JAPA 3KECA 5D2BA 1O0TA 4G0DA 3WV3A 1QUAA 4GWMA 1BKCI 3O2XA 1UMSA 1GO8P 1BIWA 3TVCA 4H76A 2OW9A 1OM8A 5I0LA 1HFCA 1L6JA 3KMCA 1OS2A 1FM1A 1YQYA 3P1VA 1PWVA 5CXAA 2WO8A 2TCLA 4HX3A
chains in the Genus database with same CATH topology
1O0QA 2W12A 1KUIA 4DPEA 1GE6A 1GXDA 1OM7A 1Y93A 4PKRA 3LJTA 1GO7P 1J7NA 4ON1A 4FXQA 3LMCA 5H8XA 1Y0VA 1C8TA 3LGPA 4H3XA 2K9CA 2RJPA 3F1AA 1IACA 2OY4A 2I47A 4QKZA 3LJZA 2MZIA 3LIKA 3I7GA 1KUKA 1K7IA 5I4OA 4H2EA 1BQQM 1PWWA 2USNA 3EDHA 4Q1LA 1XFXA 1D7XA 4WKEA 3EDZA 1GKCA 3K7NA 3ZUKA 2X3CA 2X7MA 1MNCA 4AXQA 1QIAA 2KRJA 4GUYA 4H84A 1AF0A 3F18A 2EROA 3TT4A 4L6TA 1JK3A 1SATA 4IJOA 3EHYA 1CGFA 3LE9A 3LJGA 4CTHA 1IADA 1XFVA 2JT6A 3EWJA 5BPAA 3DL1A 2ERQA 3LUNA 1XURA 4I03A 2OW0A 3U1RA 3ZXHA 5LABA 4L7AA 4WZVA 1IAEA 1AKLA 4GR3A 4JP4A 4XM6A 1QICA 3L0VA 1I1IP 4A3WA 4WKIA 1UTTA 3AYKA 1C7KA 2OI0A 3OHOA 2D1OA 2WO9A 3RTSA 1YCMA 3RTTA 3OHLA 4IUWA 1I76A 2DW0A 2MLRA 3BA0A 3LK8A 3VI1A 2SRTA 4DF9A 4FU4A 2X3AA 830CA 1G12A 2D1NA 3HBUP 3CKIA 4FXYP 3G5CA 2OXZA 4DD8A 1PWPA 4GR8A 1MMRA 3G42A 3EDGA 5L7FA 2L0RA 1QJJA 4H82A 1I73A 2E2DA 1YP1A 3DSLA 5BOTA 2DW1A 1SRPA 5I3MA 2CLTA 3F19A 2DW2A 4XM8A 2A8HA 4PKWA 1DTHA 4FVLA 2OZRA 1EAKA 3DWBA 1CAQA 3B8ZA 4GWNA 4AIGA 2YIGA 4PKTA 4XBHA 5D1SA 1JH1A 2OXUA 3HY7A 1QJIA 3HDBA 2Z2DA 1ZTQA 1SLNA 1JJ9A 3B2ZA 4PKSA 1KUFA 1MMQA 4WF6A 3KWVC 1HY7A 1KAPP 3NX7A 3HDAP 1G05A 2OVZA 4L63A 2V4BA 3N2VA 3WV2A 3ZVSA 2FV5A 2W15A 1OO9A 3LKAA 2N8RA 1EUBA 1R1IA 1XFYA 4H30A 1BZSA 1JAOA 1ZXCA 5I12A 1C3IA 3EDIA 1R55A 3HBVP 4J4MA 2CKIA 2POJA 2XS4A 1FLSA 1K7QA 3DNGA 3P24A 3DTIA 1HFSA 3F17A 1UMTA 1QIBA 2YB9A 5D7WA 1SMPA 1ROSA 3UVCA 1A86A 2Y6DA 2RJQA 2PJTA 4H1QA 5D3CA 4XM7A 2HU6A 3HB2P 5I2ZA 1XUDA 1BUDA 1GKDA 3TSKA 1BSWA 1EB6A 1HV5A 1JKYA 2O36A 3F16A 4EFSA 1RMZA 2K2GA 2WOAA 1OMJA 2X3BA 3LILA 5B5OA 1R1HA 3KEKA 5I43A 2MZEA 1KUGA 3AYUA 1MMBA 1G9KA 1BKCA 1G4KA 3I7IA 2MZHA 1HOVA 1ND1A 1KBCA 1XUCA 5CUHA 966CA 3Q2GA 1FBLA 1OS9A 1ATLA 5L79A 3KHIA 2MLSA 2OW2A 1JIZA 1DMTA 1KUHA 1D8MA 1ZS0A 2XS3A 3WV1A 1RM8A 4JIJA 5D1TA 4R3VA 1ZP5A 2QPJA 3DPEA 1XFWA 1UTZA 1Y8JA 1CGLA 1CQRA 1R54A 1SU3A 4A7BA 1HTDA 1XFZA 3B92A 4HMAA 1GE5A 1BM6A 1G49A 1WNIA 1ZVXA 3L0TA 3N2UA 1Q3AA 4GQLA 1IAAA 4JPAA 2DDYA 1CIZA 2OY2A 2E3XA 4H49A 2FV9A 3LQBA 2AYKA 1JAQA 2ERPA 2J0TA 1JANA 4GF1A 3KRYA 1R1JA 1XFUA 1JIWP 2JSDA 1B8YA 5JMYA 456CA 4XCTA 1CGEA 3DPFA 3E8RA 3LQ0A 4WK7A 2J83A 2OW1A 2W0DA 1YOUA 2W14A 3VTGA 3Q2HA 2AIGP 2DDFA 3AIGA 1A85A 1IABA 1BKCE 1CXVA 2YUFA 1D8FA 4PKVA 1S4BP 1ZXVA 4GR0A 4AYKA 2JNPA 3K7LA 1BUVM 1MMPA 2JIHA 4AUOA 1OM6A 3LIRA 3DTKA 1USNA 4IN9A 3O64A 1CK7A 3TS4A 1SLMA 3V96B 1UEAA 4PKUA 3LUMA 2O3EA 1BQOA 4ZR5A 1PWUA 1ASTA 3DTEA 2W13A 4JQGA 1K7GA 4PKQA 4G9LA 1PWQA 3HY9A 3LEAA 1B3DA 2OXWA 3GBOA 1GE7A 3MA2A 4ILWD 4I35A 4L19A 3HYGA 5B5PA 3F15A 1Z3JA 2JT5A 1AYKA 5D1UA 1D5JA 3ELMA 1H71P 1IAGA 2OVXA 5BOYA 5CZMA 2Y6CA 3KEJA 4JA1A 3KMEA 3SHIA 4DV8A 3USNA 3EHXA 1JAPA 3KECA 5D2BA 1O0TA 4G0DA 3WV3A 1QUAA 4GWMA 1BKCI 3O2XA 1UMSA 1GO8P 1BIWA 3TVCA 4H76A 2OW9A 1OM8A 5I0LA 1HFCA 1L6JA 3KMCA 1OS2A 1FM1A 1YQYA 3P1VA 1PWVA 5CXAA 2WO8A 2TCLA 4HX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0Q A;  2W12 A;  1KUI A;  4DPE A;  1GE6 A;  1GXD A;  1OM7 A;  1Y93 A;  4PKR A;  3LJT A;  1GO7 P;  1J7N A;  4ON1 A;  4FXQ A;  3LMC A;  5H8X A;  1Y0V A;  1C8T A;  3LGP A;  4H3X A;  2K9C A;  2RJP A;  3F1A A;  1IAC A;  2OY4 A;  2I47 A;  4QKZ A;  3LJZ A;  2MZI A;  3LIK A;  3I7G A;  1KUK A;  1K7I A;  5I4O A;  4H2E A;  1BQQ M;  1PWW A;  2USN A;  3EDH A;  4Q1L A;  1XFX A;  1D7X A;  4WKE A;  3EDZ A;  1GKC A;  3K7N A;  3ZUK A;  2X3C A;  2X7M A;  1MNC A;  4AXQ A;  1QIA A;  2KRJ A;  4GUY A;  4H84 A;  1AF0 A;  3F18 A;  2ERO A;  3TT4 A;  4L6T A;  1JK3 A;  1SAT A;  4IJO A;  3EHY A;  1CGF A;  3LE9 A;  3LJG A;  4CTH A;  1IAD A;  1XFV A;  2JT6 A;  3EWJ A;  5BPA A;  3DL1 A;  2ERQ A;  3LUN A;  1XUR A;  4I03 A;  2OW0 A;  3U1R A;  3ZXH A;  5LAB A;  4WZV A;  1IAE A;  1AKL A;  4GR3 A;  4JP4 A;  4XM6 A;  1QIC A;  3L0V A;  1I1I P;  4A3W A;  4WKI A;  1UTT A;  3AYK A;  1C7K A;  2OI0 A;  3OHO A;  2D1O A;  2WO9 A;  3RTS A;  1YCM A;  3RTT A;  3OHL A;  4IUW A;  1I76 A;  2DW0 A;  2MLR A;  3BA0 A;  3LK8 A;  3VI1 A;  2SRT A;  4DF9 A;  4FU4 A;  2X3A A;  830C A;  1G12 A;  2D1N A;  3HBU P;  3CKI A;  4FXY P;  3G5C A;  2OXZ A;  4DD8 A;  1PWP A;  4GR8 A;  1MMR A;  3G42 A;  3EDG A;  5L7F A;  2L0R A;  1QJJ A;  4H82 A;  1I73 A;  2E2D A;  1YP1 A;  3DSL A;  5BOT A;  2DW1 A;  1SRP A;  5I3M A;  2CLT A;  3F19 A;  2DW2 A;  4XM8 A;  2A8H A;  4PKW A;  1DTH A;  4FVL A;  2OZR A;  1EAK A;  3DWB A;  1CAQ A;  3B8Z A;  4GWN A;  4AIG A;  2YIG A;  4PKT A;  4XBH A;  5D1S A;  1JH1 A;  2OXU A;  3HY7 A;  1QJI A;  3HDB A;  2Z2D A;  1ZTQ A;  1SLN A;  1JJ9 A;  3B2Z A;  4PKS A;  1KUF A;  1MMQ A;  4WF6 A;  3KWV C;  1HY7 A;  1KAP P;  3NX7 A;  3HDA P;  1G05 A;  2OVZ A;  4L63 A;  2V4B A;  3N2V A;  3WV2 A;  3ZVS A;  2FV5 A;  2W15 A;  1OO9 A;  3LKA A;  2N8R A;  1EUB A;  1R1I A;  1XFY A;  4H30 A;  1BZS A;  1JAO A;  1ZXC A;  5I12 A;  1C3I A;  3EDI A;  1R55 A;  3HBV P;  4J4M A;  2CKI A;  2POJ A;  2XS4 A;  1FLS A;  1K7Q A;  3DNG A;  3P24 A;  1HFS A;  3F17 A;  1UMT A;  1QIB A;  2YB9 A;  5D7W A;  1SMP A;  1ROS A;  3UVC A;  1A86 A;  2Y6D A;  2RJQ A;  2PJT A;  4H1Q A;  5D3C A;  4XM7 A;  2HU6 A;  3HB2 P;  5I2Z A;  1XUD A;  1BUD A;  1GKD A;  3TSK A;  1BSW A;  1EB6 A;  1HV5 A;  1JKY A;  2O36 A;  3F16 A;  4EFS A;  1RMZ A;  2K2G A;  2WOA A;  1OMJ A;  2X3B A;  3LIL A;  5B5O A;  1R1H A;  3KEK A;  5I43 A;  2MZE A;  1KUG A;  3AYU A;  1MMB A;  1G9K A;  1BKC A;  1G4K A;  3I7I A;  2MZH A;  1HOV A;  1ND1 A;  1KBC A;  1XUC A;  5CUH A;  966C A;  3Q2G A;  1FBL A;  1OS9 A;  1ATL A;  5L79 A;  3KHI A;  2MLS A;  2OW2 A;  1JIZ A;  1DMT A;  1KUH A;  1D8M A;  1ZS0 A;  2XS3 A;  3WV1 A;  1RM8 A;  4JIJ A;  5D1T A;  4R3V A;  1ZP5 A;  2QPJ A;  3DPE A;  1XFW A;  1UTZ A;  1Y8J A;  1CGL A;  1CQR A;  1R54 A;  1SU3 A;  4A7B A;  1HTD A;  1XFZ A;  3B92 A;  4HMA A;  1GE5 A;  1BM6 A;  1G49 A;  1WNI A;  1ZVX A;  3L0T A;  3N2U A;  1Q3A A;  4GQL A;  1IAA A;  4JPA A;  2DDY A;  1CIZ A;  2OY2 A;  2E3X A;  4H49 A;  2FV9 A;  3LQB A;  2AYK A;  1JAQ A;  2ERP A;  2J0T A;  1JAN A;  4GF1 A;  3KRY A;  1R1J A;  1XFU A;  1JIW P;  2JSD A;  1B8Y A;  5JMY A;  456C A;  4XCT A;  1CGE A;  3DPF A;  3E8R A;  3LQ0 A;  4WK7 A;  2J83 A;  2OW1 A;  2W0D A;  1YOU A;  2W14 A;  3VTG A;  3Q2H A;  2AIG P;  2DDF A;  3AIG A;  1A85 A;  1IAB A;  1BKC E;  1CXV A;  1D8F A;  4PKV A;  1S4B P;  1ZXV A;  4GR0 A;  4AYK A;  2JNP A;  3K7L A;  1BUV M;  1MMP A;  2JIH A;  4AUO A;  1OM6 A;  3LIR A;  1USN A;  4IN9 A;  3O64 A;  1CK7 A;  3TS4 A;  1SLM A;  3V96 B;  1UEA A;  4PKU A;  3LUM A;  2O3E A;  1BQO A;  4ZR5 A;  1PWU A;  1AST A;  2W13 A;  4JQG A;  1K7G A;  4PKQ A;  4G9L A;  1PWQ A;  3HY9 A;  3LEA A;  1B3D A;  2OXW A;  3GBO A;  1GE7 A;  3MA2 A;  4ILW D;  4I35 A;  4L19 A;  3HYG A;  5B5P A;  3F15 A;  1Z3J A;  2JT5 A;  1AYK A;  5D1U A;  1D5J A;  3ELM A;  1H71 P;  1IAG A;  2OVX A;  5BOY A;  5CZM A;  2Y6C A;  3KEJ A;  4JA1 A;  3KME A;  3SHI A;  4DV8 A;  3USN A;  3EHX A;  1JAP A;  3KEC A;  5D2B A;  1O0T A;  4G0D A;  3WV3 A;  1QUA A;  4GWM A;  1BKC I;  3O2X A;  1UMS A;  1GO8 P;  1BIW A;  3TVC A;  4H76 A;  2OW9 A;  1OM8 A;  5I0L A;  1HFC A;  1L6J A;  3KMC A;  1OS2 A;  1FM1 A;  1YQY A;  3P1V A;  1PWV A;  5CXA A;  2WO8 A;  2TCL A;  4HX3 A; 
#chains in the Genus database with same CATH topology
 1O0Q A;  2W12 A;  1KUI A;  4DPE A;  1GE6 A;  1GXD A;  1OM7 A;  1Y93 A;  4PKR A;  3LJT A;  1GO7 P;  1J7N A;  4ON1 A;  4FXQ A;  3LMC A;  5H8X A;  1Y0V A;  1C8T A;  3LGP A;  4H3X A;  2K9C A;  2RJP A;  3F1A A;  1IAC A;  2OY4 A;  2I47 A;  4QKZ A;  3LJZ A;  2MZI A;  3LIK A;  3I7G A;  1KUK A;  1K7I A;  5I4O A;  4H2E A;  1BQQ M;  1PWW A;  2USN A;  1OZ9 A;  3EDH A;  4Q1L A;  1XFX A;  1D7X A;  4WKE A;  3EDZ A;  1GKC A;  3K7N A;  3ZUK A;  2X3C A;  2X7M A;  1MNC A;  4AXQ A;  1QIA A;  2KRJ A;  4GUY A;  4H84 A;  1AF0 A;  3F18 A;  2ERO A;  3TT4 A;  4L6T A;  1JK3 A;  1SAT A;  4IJO A;  3EHY A;  1CGF A;  3LE9 A;  3LJG A;  4CTH A;  1IAD A;  1XFV A;  2JT6 A;  3EWJ A;  5BPA A;  3DL1 A;  2ERQ A;  3LUN A;  1XUR A;  4I03 A;  2OW0 A;  3U1R A;  3ZXH A;  5LAB A;  4L7A A;  4WZV A;  1IAE A;  1AKL A;  4GR3 A;  4JP4 A;  4XM6 A;  1QIC A;  3L0V A;  1I1I P;  4A3W A;  4WKI A;  1UTT A;  3AYK A;  1C7K A;  2OI0 A;  3OHO A;  2D1O A;  2WO9 A;  3RTS A;  1YCM A;  3RTT A;  3OHL A;  4IUW A;  1I76 A;  2DW0 A;  2MLR A;  3BA0 A;  3LK8 A;  3VI1 A;  2SRT A;  4DF9 A;  4FU4 A;  2X3A A;  830C A;  1G12 A;  2D1N A;  3HBU P;  3CKI A;  4FXY P;  3G5C A;  2OXZ A;  4DD8 A;  1PWP A;  4GR8 A;  1MMR A;  3G42 A;  3EDG A;  5L7F A;  2L0R A;  1QJJ A;  4H82 A;  1I73 A;  2E2D A;  1YP1 A;  3DSL A;  5BOT A;  2DW1 A;  1SRP A;  5I3M A;  2CLT A;  3F19 A;  2DW2 A;  4XM8 A;  2A8H A;  4PKW A;  1DTH A;  4FVL A;  2OZR A;  1EAK A;  3DWB A;  1CAQ A;  3B8Z A;  4GWN A;  4AIG A;  2YIG A;  4PKT A;  1XM5 A;  4XBH A;  5D1S A;  1JH1 A;  2OXU A;  3HY7 A;  1QJI A;  3HDB A;  2Z2D A;  1ZTQ A;  1SLN A;  1JJ9 A;  3B2Z A;  4PKS A;  1KUF A;  1MMQ A;  4WF6 A;  3KWV C;  1HY7 A;  1KAP P;  3NX7 A;  3HDA P;  1G05 A;  2OVZ A;  4L63 A;  2V4B A;  3N2V A;  3WV2 A;  3ZVS A;  2FV5 A;  2W15 A;  1OO9 A;  3LKA A;  2N8R A;  1EUB A;  1R1I A;  1XFY A;  4H30 A;  1BZS A;  1JAO A;  1ZXC A;  5I12 A;  1C3I A;  3EDI A;  1R55 A;  3HBV P;  4J4M A;  2CKI A;  2POJ A;  2XS4 A;  1FLS A;  1K7Q A;  3DNG A;  3P24 A;  3DTI A;  1HFS A;  3F17 A;  1UMT A;  1QIB A;  2YB9 A;  5D7W A;  1SMP A;  1ROS A;  3UVC A;  1A86 A;  2Y6D A;  2RJQ A;  2PJT A;  4H1Q A;  5D3C A;  4XM7 A;  2HU6 A;  3HB2 P;  5I2Z A;  1XUD A;  1BUD A;  1GKD A;  3TSK A;  1BSW A;  1EB6 A;  1HV5 A;  1JKY A;  2O36 A;  3F16 A;  4EFS A;  1RMZ A;  2K2G A;  2WOA A;  1OMJ A;  2X3B A;  3LIL A;  5B5O A;  1R1H A;  3KEK A;  5I43 A;  2MZE A;  1KUG A;  3AYU A;  1MMB A;  1G9K A;  1BKC A;  1G4K A;  3I7I A;  2MZH A;  1HOV A;  1ND1 A;  1KBC A;  1XUC A;  5CUH A;  966C A;  3Q2G A;  1FBL A;  1OS9 A;  1ATL A;  5L79 A;  3KHI A;  2MLS A;  2OW2 A;  1JIZ A;  1DMT A;  1KUH A;  1D8M A;  1ZS0 A;  2XS3 A;  3WV1 A;  1RM8 A;  4JIJ A;  5D1T A;  4R3V A;  1ZP5 A;  2QPJ A;  3DPE A;  1XFW A;  1UTZ A;  1Y8J A;  1CGL A;  1CQR A;  1R54 A;  1TVI A;  1SU3 A;  4A7B A;  1HTD A;  1XFZ A;  3B92 A;  4HMA A;  1GE5 A;  1BM6 A;  1G49 A;  1WNI A;  1ZVX A;  3L0T A;  3N2U A;  1Q3A A;  4GQL A;  1IAA A;  4JPA A;  2DDY A;  1CIZ A;  2OY2 A;  2E3X A;  4H49 A;  2FV9 A;  3LQB A;  2AYK A;  1JAQ A;  2ERP A;  2J0T A;  1JAN A;  4GF1 A;  3KRY A;  1R1J A;  1XFU A;  1JIW P;  2JSD A;  1B8Y A;  5JMY A;  456C A;  4XCT A;  1CGE A;  3DPF A;  3E8R A;  3LQ0 A;  4WK7 A;  2J83 A;  2OW1 A;  2W0D A;  1YOU A;  2W14 A;  3VTG A;  3Q2H A;  2AIG P;  2DDF A;  3AIG A;  1A85 A;  1IAB A;  1BKC E;  1CXV A;  2YUF A;  1D8F A;  4PKV A;  1S4B P;  1ZXV A;  4GR0 A;  4AYK A;  2JNP A;  3K7L A;  1BUV M;  1MMP A;  2JIH A;  4AUO A;  1OM6 A;  3LIR A;  3DTK A;  1USN A;  4IN9 A;  3O64 A;  1CK7 A;  3TS4 A;  1SLM A;  3V96 B;  1UEA A;  4PKU A;  3LUM A;  2O3E A;  1BQO A;  4ZR5 A;  1PWU A;  1AST A;  3DTE A;  2W13 A;  4JQG A;  1K7G A;  4PKQ A;  4G9L A;  1PWQ A;  3HY9 A;  3LEA A;  1B3D A;  2OXW A;  3GBO A;  1GE7 A;  3MA2 A;  4ILW D;  4I35 A;  4L19 A;  3HYG A;  5B5P A;  3F15 A;  1Z3J A;  2JT5 A;  1AYK A;  5D1U A;  1D5J A;  3ELM A;  1H71 P;  1IAG A;  2OVX A;  5BOY A;  5CZM A;  2Y6C A;  3KEJ A;  4JA1 A;  3KME A;  1XAX A;  3SHI A;  4DV8 A;  3USN A;  3EHX A;  1JAP A;  3KEC A;  5D2B A;  1O0T A;  4G0D A;  3WV3 A;  1QUA A;  4GWM A;  1BKC I;  3O2X A;  1UMS A;  1GO8 P;  1BIW A;  3TVC A;  4H76 A;  2OW9 A;  1OM8 A;  5I0L A;  1HFC A;  1L6J A;  3KMC A;  1OS2 A;  1FM1 A;  1YQY A;  3P1V A;  1PWV A;  5CXA A;  2WO8 A;  2TCL A;  4HX3 A; 
#chains in the Genus database with same CATH homology
 1O0Q A;  2W12 A;  1KUI A;  4DPE A;  1GE6 A;  1GXD A;  1OM7 A;  1Y93 A;  4PKR A;  3LJT A;  1GO7 P;  1J7N A;  4ON1 A;  4FXQ A;  3LMC A;  5H8X A;  1Y0V A;  1C8T A;  3LGP A;  4H3X A;  2K9C A;  2RJP A;  3F1A A;  1IAC A;  2OY4 A;  2I47 A;  4QKZ A;  3LJZ A;  2MZI A;  3LIK A;  3I7G A;  1KUK A;  1K7I A;  5I4O A;  4H2E A;  1BQQ M;  1PWW A;  2USN A;  3EDH A;  4Q1L A;  1XFX A;  1D7X A;  4WKE A;  3EDZ A;  1GKC A;  3K7N A;  3ZUK A;  2X3C A;  2X7M A;  1MNC A;  4AXQ A;  1QIA A;  2KRJ A;  4GUY A;  4H84 A;  1AF0 A;  3F18 A;  2ERO A;  3TT4 A;  4L6T A;  1JK3 A;  1SAT A;  4IJO A;  3EHY A;  1CGF A;  3LE9 A;  3LJG A;  4CTH A;  1IAD A;  1XFV A;  2JT6 A;  3EWJ A;  5BPA A;  3DL1 A;  2ERQ A;  3LUN A;  1XUR A;  4I03 A;  2OW0 A;  3U1R A;  3ZXH A;  5LAB A;  4L7A A;  4WZV A;  1IAE A;  1AKL A;  4GR3 A;  4JP4 A;  4XM6 A;  1QIC A;  3L0V A;  1I1I P;  4A3W A;  4WKI A;  1UTT A;  3AYK A;  1C7K A;  2OI0 A;  3OHO A;  2D1O A;  2WO9 A;  3RTS A;  1YCM A;  3RTT A;  3OHL A;  4IUW A;  1I76 A;  2DW0 A;  2MLR A;  3BA0 A;  3LK8 A;  3VI1 A;  2SRT A;  4DF9 A;  4FU4 A;  2X3A A;  830C A;  1G12 A;  2D1N A;  3HBU P;  3CKI A;  4FXY P;  3G5C A;  2OXZ A;  4DD8 A;  1PWP A;  4GR8 A;  1MMR A;  3G42 A;  3EDG A;  5L7F A;  2L0R A;  1QJJ A;  4H82 A;  1I73 A;  2E2D A;  1YP1 A;  3DSL A;  5BOT A;  2DW1 A;  1SRP A;  5I3M A;  2CLT A;  3F19 A;  2DW2 A;  4XM8 A;  2A8H A;  4PKW A;  1DTH A;  4FVL A;  2OZR A;  1EAK A;  3DWB A;  1CAQ A;  3B8Z A;  4GWN A;  4AIG A;  2YIG A;  4PKT A;  4XBH A;  5D1S A;  1JH1 A;  2OXU A;  3HY7 A;  1QJI A;  3HDB A;  2Z2D A;  1ZTQ A;  1SLN A;  1JJ9 A;  3B2Z A;  4PKS A;  1KUF A;  1MMQ A;  4WF6 A;  3KWV C;  1HY7 A;  1KAP P;  3NX7 A;  3HDA P;  1G05 A;  2OVZ A;  4L63 A;  2V4B A;  3N2V A;  3WV2 A;  3ZVS A;  2FV5 A;  2W15 A;  1OO9 A;  3LKA A;  2N8R A;  1EUB A;  1R1I A;  1XFY A;  4H30 A;  1BZS A;  1JAO A;  1ZXC A;  5I12 A;  1C3I A;  3EDI A;  1R55 A;  3HBV P;  4J4M A;  2CKI A;  2POJ A;  2XS4 A;  1FLS A;  1K7Q A;  3DNG A;  3P24 A;  3DTI A;  1HFS A;  3F17 A;  1UMT A;  1QIB A;  2YB9 A;  5D7W A;  1SMP A;  1ROS A;  3UVC A;  1A86 A;  2Y6D A;  2RJQ A;  2PJT A;  4H1Q A;  5D3C A;  4XM7 A;  2HU6 A;  3HB2 P;  5I2Z A;  1XUD A;  1BUD A;  1GKD A;  3TSK A;  1BSW A;  1EB6 A;  1HV5 A;  1JKY A;  2O36 A;  3F16 A;  4EFS A;  1RMZ A;  2K2G A;  2WOA A;  1OMJ A;  2X3B A;  3LIL A;  5B5O A;  1R1H A;  3KEK A;  5I43 A;  2MZE A;  1KUG A;  3AYU A;  1MMB A;  1G9K A;  1BKC A;  1G4K A;  3I7I A;  2MZH A;  1HOV A;  1ND1 A;  1KBC A;  1XUC A;  5CUH A;  966C A;  3Q2G A;  1FBL A;  1OS9 A;  1ATL A;  5L79 A;  3KHI A;  2MLS A;  2OW2 A;  1JIZ A;  1DMT A;  1KUH A;  1D8M A;  1ZS0 A;  2XS3 A;  3WV1 A;  1RM8 A;  4JIJ A;  5D1T A;  4R3V A;  1ZP5 A;  2QPJ A;  3DPE A;  1XFW A;  1UTZ A;  1Y8J A;  1CGL A;  1CQR A;  1R54 A;  1SU3 A;  4A7B A;  1HTD A;  1XFZ A;  3B92 A;  4HMA A;  1GE5 A;  1BM6 A;  1G49 A;  1WNI A;  1ZVX A;  3L0T A;  3N2U A;  1Q3A A;  4GQL A;  1IAA A;  4JPA A;  2DDY A;  1CIZ A;  2OY2 A;  2E3X A;  4H49 A;  2FV9 A;  3LQB A;  2AYK A;  1JAQ A;  2ERP A;  2J0T A;  1JAN A;  4GF1 A;  3KRY A;  1R1J A;  1XFU A;  1JIW P;  2JSD A;  1B8Y A;  5JMY A;  456C A;  4XCT A;  1CGE A;  3DPF A;  3E8R A;  3LQ0 A;  4WK7 A;  2J83 A;  2OW1 A;  2W0D A;  1YOU A;  2W14 A;  3VTG A;  3Q2H A;  2AIG P;  2DDF A;  3AIG A;  1A85 A;  1IAB A;  1BKC E;  1CXV A;  2YUF A;  1D8F A;  4PKV A;  1S4B P;  1ZXV A;  4GR0 A;  4AYK A;  2JNP A;  3K7L A;  1BUV M;  1MMP A;  2JIH A;  4AUO A;  1OM6 A;  3LIR A;  3DTK A;  1USN A;  4IN9 A;  3O64 A;  1CK7 A;  3TS4 A;  1SLM A;  3V96 B;  1UEA A;  4PKU A;  3LUM A;  2O3E A;  1BQO A;  4ZR5 A;  1PWU A;  1AST A;  3DTE A;  2W13 A;  4JQG A;  1K7G A;  4PKQ A;  4G9L A;  1PWQ A;  3HY9 A;  3LEA A;  1B3D A;  2OXW A;  3GBO A;  1GE7 A;  3MA2 A;  4ILW D;  4I35 A;  4L19 A;  3HYG A;  5B5P A;  3F15 A;  1Z3J A;  2JT5 A;  1AYK A;  5D1U A;  1D5J A;  3ELM A;  1H71 P;  1IAG A;  2OVX A;  5BOY A;  5CZM A;  2Y6C A;  3KEJ A;  4JA1 A;  3KME A;  3SHI A;  4DV8 A;  3USN A;  3EHX A;  1JAP A;  3KEC A;  5D2B A;  1O0T A;  4G0D A;  3WV3 A;  1QUA A;  4GWM A;  1BKC I;  3O2X A;  1UMS A;  1GO8 P;  1BIW A;  3TVC A;  4H76 A;  2OW9 A;  1OM8 A;  5I0L A;  1HFC A;  1L6J A;  3KMC A;  1OS2 A;  1FM1 A;  1YQY A;  3P1V A;  1PWV A;  5CXA A;  2WO8 A;  2TCL A;  4HX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...