5I0LA

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated arylsulfonamide carboxylate water-soluble inhibitor (dc27).
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i0lA00
2I47A 1K7QA 5I2ZA 1DTHA 2MZEA 1A85A 1KBCA 1JANA 2MZIA 2OW9A 1S4BP 1ZXVA 1PWUA 1JK3A 4DD8A 3P24A 4H84A 3HB2P 1ROSA 2SRTA 1JIZA 1XFVA 1UEAA 3EWJA 3F16A 1XFUA 3F18A 3HBUP 3KMCA 1ND1A 1FM1A 2POJA 1QIBA 3TT4A 4PKSA 3Q2GA 2QPJA 4XBHA 4HX3A 2YB9A 2DW1A 3TSKA 3DL1A 3KMEA 3P1VA 1CQRA 2Z2DA 5L7FA 3HY9A 1GKCA 4H1QA 2Y6CA 1XFYA 5B5PA 3N2VA 1KUHA 4GWNA 3MA2A 1BKCI 2FV9A 3F19A 5D2BA 3HBVP 4L6TA 4A3WA 2OXZA 5D1UA 5D3CA 3B8ZA 1GO8P 1CXVA 1JKYA 2OI0A 5CUHA 1PWQA 5LABA 1BUVM 1R1JA 2WO8A 2JIHA 1XFZA 1BKCA 4ZR5A 3N2UA 2O36A 4WKIA 1Y93A 1ZP5A 1QIAA 3OHLA 1Z3JA 5I4OA 3GBOA 1HFCA 3RTTA 5CXAA 3LGPA 1G9KA 3O2XA 1IABA 2JT5A 1O0QA 3EDIA 4R3VA 4GQLA 4H2EA 1UMSA 3EHYA 4PKRA 4H3XA 2DW2A 4L63A 2MLSA 1GO7P 1HFSA 1MNCA 2WOAA 3U1RA 2J83A 1AYKA 3KEKA 2W13A 1BUDA 4IJOA 1JAQA 1EUBA 3G5CA 2OVXA 3HY7A 5CZMA 3ZXHA 1JJ9A 2O3EA 2KRJA 4JQGA 1GE6A 1RMZA 966CA 1BM6A 5I12A 1ASTA 1QJJA 3AYUA 1KUFA 1L6JA 1C7KA 1BQQM 4A7BA 4FU4A 1YP1A 3CKIA 2TCLA 3G42A 4G9LA 1YOUA 1ZVXA 5D7WA 5BOYA 4ON1A 1R1IA 1ZS0A 3LUMA 1G4KA 5B5OA 1JAOA 4IN9A 5L79A 1ATLA 2X3CA 3B2ZA 1CK7A 1SU3A 2ERQA 1HOVA 1JAPA 2MZHA 4WKEA 1SRPA 1BKCE 1XFXA 1GKDA 4GR0A 1OS9A 3BA0A 1KAPP 1A86A 3LQ0A 3E8RA 1R1HA 4QKZA 3KECA 3LIRA 2Y6DA 1EAKA 2USNA 3KEJA 4GWMA 1XUDA 4IUWA 1D8MA 1Y0VA 2E2DA 4XM6A 456CA 1K7IA 830CA 1D7XA 1I1IP 3WV3A 1IAEA 2RJQA 3V96B 3WV2A 3LJGA 3KRYA 1WNIA 2CKIA 4WF6A 4AUOA 4JPAA 2V4BA 1KUGA 3DPEA 1KUIA 1JH1A 1OM8A 3K7LA 3KWVC 1OS2A 1B8YA 3EDZA 3F17A 1IADA 4GR3A 1O0TA 3F15A 1SMPA 1IACA 1IAGA 3TS4A 4JA1A 2DDFA 1PWVA 4EFSA 1G49A 2DW0A 1CGFA 1C8TA 1PWPA 2OW0A 4XM7A 2X3BA 2OVZA 3L0TA 3EDGA 1ZXCA 2J0TA 1GE5A 4DPEA 3F1AA 1SLNA 1BZSA 4HMAA 3I7GA 4GUYA 2XS3A 5D1SA 1BSWA 2X3AA 2ERPA 1MMRA 1OM7A 1R54A 1QICA 3WV1A 2DDYA 1G12A 1CGLA 2WO9A 3HYGA 3HDBA 2L0RA 4AYKA 1XURA 4ILWD 3OHOA 3USNA 3RTSA 4J4MA 3UVCA 1XUCA 3LJZA 4I03A 3O64A 1MMPA 2W14A 1CIZA 2OY2A 1AF0A 1UTTA 2HU6A 1UTZA 1CAQA 4XM8A 1D8FA 4XCTA 5BOTA 1PWWA 2OZRA 5I0LA 3L0VA 1B3DA 3EDHA 4AXQA 3TVCA 3LEAA 3DNGA 4AIGA 4WK7A 1AKLA 3K7NA 2D1OA 4GF1A 3LK8A 1I73A 4FXQA 2XS4A 3NX7A 1XFWA 3Q2HA 1UMTA 1K7GA 3EHXA 4FVLA 1GXDA 5I3MA 3LILA 1KUKA 1JIWP 2CLTA 2K9CA 2PJTA 1H71P 2W15A 1DMTA 2N8RA 3LJTA 1YQYA 2EROA 2X7MA 5D1TA 1QUAA 3KHIA 1Y8JA 1Q3AA 1MMQA 4DV8A 3AYKA 4GR8A 1EB6A 2JSDA 1ZTQA 4I35A 3AIGA 1USNA 5H8XA 3B92A 2RJPA 5I43A 1HV5A 1HTDA 4L19A 4JIJA 3HDAP 1GE7A 1SLMA 2AIGP 2FV5A 1OM6A 3VI1A 3DPFA 2JNPA 1QJIA 2OW2A 1C3IA 4DF9A 4PKWA 4G0DA 3LQBA 1OMJA 4WZVA 3LIKA 4H30A 5BPAA 3DSLA 1IAAA 3LMCA 1OO9A 1YCMA 3I7IA 3LKAA 3SHIA 3VTGA 2JT6A 3ZVSA 1J7NA 1G05A 4H82A 2AYKA 2MLRA 4FXYP 2W0DA 4PKUA 1BQOA 4CTHA 1MMBA 1D5JA 1R55A 2OY4A 5JMYA 1FLSA 1BIWA 2OXUA 2OW1A 3LE9A 4JP4A 2OXWA 3DWBA 3LUNA 4PKQA 2E3XA 2W12A 2K2GA 1RM8A 4PKTA 1SATA 1FBLA 2D1NA 3ELMA 4H49A 4Q1LA 1CGEA 2A8HA 4H76A 1HY7A 1I76A 3ZUKA 4PKVA 2YIGA
chains in the Genus database with same CATH superfamily
2I47A 1K7QA 5I2ZA 1DTHA 2MZEA 1A85A 1KBCA 1JANA 2MZIA 2OW9A 1S4BP 1ZXVA 1PWUA 1JK3A 4DD8A 3P24A 4H84A 3HB2P 1ROSA 2SRTA 1JIZA 1XFVA 1UEAA 3EWJA 3F16A 1XFUA 3F18A 3HBUP 3KMCA 1ND1A 1FM1A 2POJA 1QIBA 3TT4A 4PKSA 3Q2GA 2QPJA 4XBHA 4HX3A 2YB9A 2DW1A 3TSKA 3DL1A 3KMEA 3P1VA 1CQRA 2Z2DA 5L7FA 1XM5A 3HY9A 1GKCA 4H1QA 2Y6CA 1XFYA 5B5PA 3N2VA 1KUHA 4GWNA 3MA2A 1BKCI 2FV9A 3F19A 5D2BA 3HBVP 4L6TA 4A3WA 2OXZA 5D1UA 5D3CA 3B8ZA 1GO8P 1CXVA 1JKYA 2OI0A 5CUHA 1PWQA 5LABA 1BUVM 1R1JA 2WO8A 2JIHA 1XFZA 1BKCA 4ZR5A 3N2UA 2O36A 4WKIA 1Y93A 1ZP5A 1QIAA 3OHLA 1Z3JA 5I4OA 3GBOA 1HFCA 3RTTA 5CXAA 3LGPA 1G9KA 3O2XA 1IABA 2JT5A 1O0QA 3EDIA 4R3VA 4GQLA 4H2EA 1UMSA 3EHYA 4PKRA 4H3XA 2DW2A 4L63A 2MLSA 1GO7P 1HFSA 1MNCA 2WOAA 3U1RA 2J83A 1AYKA 3KEKA 2W13A 1BUDA 4IJOA 1JAQA 1EUBA 3G5CA 2OVXA 3HY7A 5CZMA 3ZXHA 1JJ9A 2O3EA 2KRJA 4JQGA 1GE6A 1RMZA 966CA 1BM6A 5I12A 1ASTA 1QJJA 3AYUA 1KUFA 4L7AA 1L6JA 1C7KA 1BQQM 4A7BA 4FU4A 1YP1A 3CKIA 2TCLA 3G42A 4G9LA 1YOUA 1ZVXA 5D7WA 5BOYA 4ON1A 1R1IA 1ZS0A 3LUMA 1G4KA 5B5OA 1JAOA 4IN9A 5L79A 1ATLA 2X3CA 3B2ZA 1CK7A 2YUFA 1SU3A 2ERQA 1HOVA 1JAPA 2MZHA 4WKEA 1SRPA 1BKCE 1XFXA 1GKDA 4GR0A 1OS9A 3BA0A 1KAPP 1A86A 3LQ0A 3E8RA 1R1HA 4QKZA 3KECA 3LIRA 2Y6DA 1EAKA 2USNA 3KEJA 4GWMA 1XUDA 4IUWA 1D8MA 1Y0VA 2E2DA 4XM6A 456CA 1K7IA 830CA 1D7XA 1I1IP 3WV3A 1IAEA 2RJQA 3V96B 3WV2A 3LJGA 3KRYA 1WNIA 2CKIA 4WF6A 4AUOA 4JPAA 2V4BA 1KUGA 3DPEA 1KUIA 1JH1A 1OM8A 3K7LA 3KWVC 1OS2A 1B8YA 3EDZA 3F17A 1IADA 4GR3A 1O0TA 3F15A 1SMPA 1IACA 1IAGA 3TS4A 4JA1A 2DDFA 1PWVA 4EFSA 1G49A 2DW0A 1CGFA 1C8TA 1PWPA 2OW0A 4XM7A 2X3BA 2OVZA 3L0TA 3EDGA 1ZXCA 2J0TA 1GE5A 4DPEA 3F1AA 1SLNA 1BZSA 4HMAA 3I7GA 4GUYA 2XS3A 5D1SA 1BSWA 2X3AA 2ERPA 1MMRA 1OM7A 1R54A 1QICA 3WV1A 2DDYA 1G12A 3DTEA 1CGLA 2WO9A 3HYGA 3HDBA 2L0RA 4AYKA 1XURA 4ILWD 3OHOA 3USNA 3RTSA 4J4MA 3UVCA 1XUCA 3LJZA 4I03A 3O64A 1MMPA 2W14A 1CIZA 2OY2A 1AF0A 1UTTA 2HU6A 1UTZA 1CAQA 1OZ9A 1D8FA 4XM8A 4XCTA 5BOTA 1PWWA 2OZRA 5I0LA 3L0VA 1B3DA 3EDHA 4AXQA 3TVCA 3LEAA 3DNGA 4AIGA 4WK7A 1AKLA 3K7NA 2D1OA 4GF1A 3LK8A 1I73A 4FXQA 2XS4A 3NX7A 1XFWA 3Q2HA 1UMTA 1K7GA 3EHXA 4FVLA 1GXDA 5I3MA 3LILA 1KUKA 1JIWP 2CLTA 1TVIA 2K9CA 2PJTA 1H71P 2W15A 1DMTA 2N8RA 3LJTA 1YQYA 2EROA 2X7MA 5D1TA 1QUAA 3KHIA 1Y8JA 1Q3AA 1MMQA 4DV8A 3AYKA 4GR8A 1EB6A 2JSDA 1ZTQA 4I35A 3AIGA 1USNA 5H8XA 3B92A 2RJPA 5I43A 1HV5A 1HTDA 4L19A 4JIJA 3HDAP 1GE7A 1SLMA 2AIGP 2FV5A 1OM6A 3VI1A 3DPFA 2JNPA 1QJIA 2OW2A 1C3IA 4DF9A 3DTKA 4PKWA 4G0DA 3LQBA 1OMJA 4WZVA 3LIKA 4H30A 5BPAA 3DSLA 1IAAA 3LMCA 1OO9A 1YCMA 3I7IA 3LKAA 3SHIA 3VTGA 2JT6A 1XAXA 3ZVSA 1J7NA 1G05A 4H82A 2AYKA 2MLRA 4FXYP 2W0DA 4PKUA 1BQOA 4CTHA 1MMBA 1D5JA 3DTIA 1R55A 2OY4A 5JMYA 1FLSA 1BIWA 2OXUA 2OW1A 3LE9A 4JP4A 2OXWA 3DWBA 3LUNA 4PKQA 2E3XA 2W12A 2K2GA 1RM8A 4PKTA 1SATA 1FBLA 2D1NA 3ELMA 4H49A 4Q1LA 1CGEA 2A8HA 4H76A 1HY7A 1I76A 3ZUKA 4PKVA 2YIGA
chains in the Genus database with same CATH topology
2I47A 1K7QA 5I2ZA 1DTHA 2MZEA 1A85A 1KBCA 1JANA 2MZIA 2OW9A 1S4BP 1ZXVA 1PWUA 1JK3A 4DD8A 3P24A 4H84A 3HB2P 1ROSA 2SRTA 1JIZA 1XFVA 1UEAA 3EWJA 3F16A 1XFUA 3F18A 3HBUP 3KMCA 1ND1A 1FM1A 2POJA 1QIBA 3TT4A 4PKSA 3Q2GA 2QPJA 4XBHA 4HX3A 2YB9A 2DW1A 3TSKA 3DL1A 3KMEA 3P1VA 1CQRA 2Z2DA 5L7FA 3HY9A 1GKCA 4H1QA 2Y6CA 1XFYA 5B5PA 3N2VA 1KUHA 4GWNA 3MA2A 1BKCI 2FV9A 3F19A 5D2BA 3HBVP 4L6TA 4A3WA 2OXZA 5D1UA 5D3CA 3B8ZA 1GO8P 1CXVA 1JKYA 2OI0A 5CUHA 1PWQA 5LABA 1BUVM 1R1JA 2WO8A 2JIHA 1XFZA 1BKCA 4ZR5A 3N2UA 2O36A 4WKIA 1Y93A 1ZP5A 1QIAA 3OHLA 1Z3JA 5I4OA 3GBOA 1HFCA 3RTTA 5CXAA 3LGPA 1G9KA 3O2XA 1IABA 2JT5A 1O0QA 3EDIA 4R3VA 4GQLA 4H2EA 1UMSA 3EHYA 4PKRA 4H3XA 2DW2A 4L63A 2MLSA 1GO7P 1HFSA 1MNCA 2WOAA 3U1RA 2J83A 1AYKA 3KEKA 2W13A 1BUDA 4IJOA 1JAQA 1EUBA 3G5CA 2OVXA 3HY7A 5CZMA 3ZXHA 1JJ9A 2O3EA 2KRJA 4JQGA 1GE6A 1RMZA 966CA 1BM6A 5I12A 1ASTA 1QJJA 3AYUA 1KUFA 4L7AA 1L6JA 1C7KA 1BQQM 4A7BA 4FU4A 1YP1A 3CKIA 2TCLA 3G42A 4G9LA 1YOUA 1ZVXA 5D7WA 5BOYA 4ON1A 1R1IA 1ZS0A 3LUMA 1G4KA 5B5OA 1JAOA 4IN9A 5L79A 1ATLA 2X3CA 3B2ZA 1CK7A 2YUFA 1SU3A 2ERQA 1HOVA 1JAPA 2MZHA 4WKEA 1SRPA 1BKCE 1XFXA 1GKDA 4GR0A 1OS9A 3BA0A 1KAPP 1A86A 3LQ0A 3E8RA 1R1HA 4QKZA 3KECA 3LIRA 2Y6DA 1EAKA 2USNA 3KEJA 4GWMA 1XUDA 4IUWA 1D8MA 1Y0VA 2E2DA 4XM6A 456CA 1K7IA 830CA 1D7XA 1I1IP 3WV3A 1IAEA 2RJQA 3V96B 3WV2A 3LJGA 3KRYA 1WNIA 2CKIA 4WF6A 4AUOA 4JPAA 2V4BA 1KUGA 3DPEA 1KUIA 1JH1A 1OM8A 3K7LA 3KWVC 1OS2A 1B8YA 3EDZA 3F17A 1IADA 4GR3A 1O0TA 3F15A 1SMPA 1IACA 1IAGA 3TS4A 4JA1A 2DDFA 1PWVA 4EFSA 1G49A 2DW0A 1CGFA 1C8TA 1PWPA 2OW0A 4XM7A 2X3BA 2OVZA 3L0TA 3EDGA 1ZXCA 2J0TA 1GE5A 4DPEA 3F1AA 1SLNA 1BZSA 4HMAA 3I7GA 4GUYA 2XS3A 5D1SA 1BSWA 2X3AA 2ERPA 1MMRA 1OM7A 1R54A 1QICA 3WV1A 2DDYA 1G12A 3DTEA 1CGLA 2WO9A 3HYGA 3HDBA 2L0RA 4AYKA 1XURA 4ILWD 3OHOA 3USNA 3RTSA 4J4MA 3UVCA 1XUCA 3LJZA 4I03A 3O64A 1MMPA 2W14A 1CIZA 2OY2A 1AF0A 1UTTA 2HU6A 1UTZA 1CAQA 4XM8A 1D8FA 4XCTA 5BOTA 1PWWA 2OZRA 5I0LA 3L0VA 1B3DA 3EDHA 4AXQA 3TVCA 3LEAA 3DNGA 4AIGA 4WK7A 1AKLA 3K7NA 2D1OA 4GF1A 3LK8A 1I73A 4FXQA 2XS4A 3NX7A 1XFWA 3Q2HA 1UMTA 1K7GA 3EHXA 4FVLA 1GXDA 5I3MA 3LILA 1KUKA 1JIWP 2CLTA 2K9CA 2PJTA 1H71P 2W15A 1DMTA 2N8RA 3LJTA 1YQYA 2EROA 2X7MA 5D1TA 1QUAA 3KHIA 1Y8JA 1Q3AA 1MMQA 4DV8A 3AYKA 4GR8A 1EB6A 2JSDA 1ZTQA 4I35A 3AIGA 1USNA 5H8XA 3B92A 2RJPA 5I43A 1HV5A 1HTDA 4L19A 4JIJA 3HDAP 1GE7A 1SLMA 2AIGP 2FV5A 1OM6A 3VI1A 3DPFA 2JNPA 1QJIA 2OW2A 1C3IA 4DF9A 3DTKA 4PKWA 4G0DA 3LQBA 1OMJA 4WZVA 3LIKA 4H30A 5BPAA 3DSLA 1IAAA 3LMCA 1OO9A 1YCMA 3I7IA 3LKAA 3SHIA 3VTGA 2JT6A 3ZVSA 1J7NA 1G05A 4H82A 2AYKA 2MLRA 4FXYP 2W0DA 4PKUA 1BQOA 4CTHA 1MMBA 1D5JA 3DTIA 1R55A 2OY4A 5JMYA 1FLSA 1BIWA 2OXUA 2OW1A 3LE9A 4JP4A 2OXWA 3DWBA 3LUNA 4PKQA 2E3XA 2W12A 2K2GA 1RM8A 4PKTA 1SATA 1FBLA 2D1NA 3ELMA 4H49A 4Q1LA 1CGEA 2A8HA 4H76A 1HY7A 1I76A 3ZUKA 4PKVA 2YIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I47 A;  1K7Q A;  5I2Z A;  1DTH A;  2MZE A;  1A85 A;  1KBC A;  1JAN A;  2MZI A;  2OW9 A;  1S4B P;  1ZXV A;  1PWU A;  1JK3 A;  4DD8 A;  3P24 A;  4H84 A;  3HB2 P;  1ROS A;  2SRT A;  1JIZ A;  1XFV A;  1UEA A;  3EWJ A;  3F16 A;  1XFU A;  3F18 A;  3HBU P;  3KMC A;  1ND1 A;  1FM1 A;  2POJ A;  1QIB A;  3TT4 A;  4PKS A;  3Q2G A;  2QPJ A;  4XBH A;  4HX3 A;  2YB9 A;  2DW1 A;  3TSK A;  3DL1 A;  3KME A;  3P1V A;  1CQR A;  2Z2D A;  5L7F A;  3HY9 A;  1GKC A;  4H1Q A;  2Y6C A;  1XFY A;  5B5P A;  3N2V A;  1KUH A;  4GWN A;  3MA2 A;  1BKC I;  2FV9 A;  3F19 A;  5D2B A;  3HBV P;  4L6T A;  4A3W A;  2OXZ A;  5D1U A;  5D3C A;  3B8Z A;  1GO8 P;  1CXV A;  1JKY A;  2OI0 A;  5CUH A;  1PWQ A;  5LAB A;  1BUV M;  1R1J A;  2WO8 A;  2JIH A;  1XFZ A;  1BKC A;  4ZR5 A;  3N2U A;  2O36 A;  4WKI A;  1Y93 A;  1ZP5 A;  1QIA A;  3OHL A;  1Z3J A;  5I4O A;  3GBO A;  1HFC A;  3RTT A;  5CXA A;  3LGP A;  1G9K A;  3O2X A;  1IAB A;  2JT5 A;  1O0Q A;  3EDI A;  4R3V A;  4GQL A;  4H2E A;  1UMS A;  3EHY A;  4PKR A;  4H3X A;  2DW2 A;  4L63 A;  2MLS A;  1GO7 P;  1HFS A;  1MNC A;  2WOA A;  3U1R A;  2J83 A;  1AYK A;  3KEK A;  2W13 A;  1BUD A;  4IJO A;  1JAQ A;  1EUB A;  3G5C A;  2OVX A;  3HY7 A;  5CZM A;  3ZXH A;  1JJ9 A;  2O3E A;  2KRJ A;  4JQG A;  1GE6 A;  1RMZ A;  966C A;  1BM6 A;  5I12 A;  1AST A;  1QJJ A;  3AYU A;  1KUF A;  1L6J A;  1C7K A;  1BQQ M;  4A7B A;  4FU4 A;  1YP1 A;  3CKI A;  2TCL A;  3G42 A;  4G9L A;  1YOU A;  1ZVX A;  5D7W A;  5BOY A;  4ON1 A;  1R1I A;  1ZS0 A;  3LUM A;  1G4K A;  5B5O A;  1JAO A;  4IN9 A;  5L79 A;  1ATL A;  2X3C A;  3B2Z A;  1CK7 A;  1SU3 A;  2ERQ A;  1HOV A;  1JAP A;  2MZH A;  4WKE A;  1SRP A;  1BKC E;  1XFX A;  1GKD A;  4GR0 A;  1OS9 A;  3BA0 A;  1KAP P;  1A86 A;  3LQ0 A;  3E8R A;  1R1H A;  4QKZ A;  3KEC A;  3LIR A;  2Y6D A;  1EAK A;  2USN A;  3KEJ A;  4GWM A;  1XUD A;  4IUW A;  1D8M A;  1Y0V A;  2E2D A;  4XM6 A;  456C A;  1K7I A;  830C A;  1D7X A;  1I1I P;  3WV3 A;  1IAE A;  2RJQ A;  3V96 B;  3WV2 A;  3LJG A;  3KRY A;  1WNI A;  2CKI A;  4WF6 A;  4AUO A;  4JPA A;  2V4B A;  1KUG A;  3DPE A;  1KUI A;  1JH1 A;  1OM8 A;  3K7L A;  3KWV C;  1OS2 A;  1B8Y A;  3EDZ A;  3F17 A;  1IAD A;  4GR3 A;  1O0T A;  3F15 A;  1SMP A;  1IAC A;  1IAG A;  3TS4 A;  4JA1 A;  2DDF A;  1PWV A;  4EFS A;  1G49 A;  2DW0 A;  1CGF A;  1C8T A;  1PWP A;  2OW0 A;  4XM7 A;  2X3B A;  2OVZ A;  3L0T A;  3EDG A;  1ZXC A;  2J0T A;  1GE5 A;  4DPE A;  3F1A A;  1SLN A;  1BZS A;  4HMA A;  3I7G A;  4GUY A;  2XS3 A;  5D1S A;  1BSW A;  2X3A A;  2ERP A;  1MMR A;  1OM7 A;  1R54 A;  1QIC A;  3WV1 A;  2DDY A;  1G12 A;  1CGL A;  2WO9 A;  3HYG A;  3HDB A;  2L0R A;  4AYK A;  1XUR A;  4ILW D;  3OHO A;  3USN A;  3RTS A;  4J4M A;  3UVC A;  1XUC A;  3LJZ A;  4I03 A;  3O64 A;  1MMP A;  2W14 A;  1CIZ A;  2OY2 A;  1AF0 A;  1UTT A;  2HU6 A;  1UTZ A;  1CAQ A;  4XM8 A;  1D8F A;  4XCT A;  5BOT A;  1PWW A;  2OZR A;  5I0L A;  3L0V A;  1B3D A;  3EDH A;  4AXQ A;  3TVC A;  3LEA A;  3DNG A;  4AIG A;  4WK7 A;  1AKL A;  3K7N A;  2D1O A;  4GF1 A;  3LK8 A;  1I73 A;  4FXQ A;  2XS4 A;  3NX7 A;  1XFW A;  3Q2H A;  1UMT A;  1K7G A;  3EHX A;  4FVL A;  1GXD A;  5I3M A;  3LIL A;  1KUK A;  1JIW P;  2CLT A;  2K9C A;  2PJT A;  1H71 P;  2W15 A;  1DMT A;  2N8R A;  3LJT A;  1YQY A;  2ERO A;  2X7M A;  5D1T A;  1QUA A;  3KHI A;  1Y8J A;  1Q3A A;  1MMQ A;  4DV8 A;  3AYK A;  4GR8 A;  1EB6 A;  2JSD A;  1ZTQ A;  4I35 A;  3AIG A;  1USN A;  5H8X A;  3B92 A;  2RJP A;  5I43 A;  1HV5 A;  1HTD A;  4L19 A;  4JIJ A;  3HDA P;  1GE7 A;  1SLM A;  2AIG P;  2FV5 A;  1OM6 A;  3VI1 A;  3DPF A;  2JNP A;  1QJI A;  2OW2 A;  1C3I A;  4DF9 A;  4PKW A;  4G0D A;  3LQB A;  1OMJ A;  4WZV A;  3LIK A;  4H30 A;  5BPA A;  3DSL A;  1IAA A;  3LMC A;  1OO9 A;  1YCM A;  3I7I A;  3LKA A;  3SHI A;  3VTG A;  2JT6 A;  3ZVS A;  1J7N A;  1G05 A;  4H82 A;  2AYK A;  2MLR A;  4FXY P;  2W0D A;  4PKU A;  1BQO A;  4CTH A;  1MMB A;  1D5J A;  1R55 A;  2OY4 A;  5JMY A;  1FLS A;  1BIW A;  2OXU A;  2OW1 A;  3LE9 A;  4JP4 A;  2OXW A;  3DWB A;  3LUN A;  4PKQ A;  2E3X A;  2W12 A;  2K2G A;  1RM8 A;  4PKT A;  1SAT A;  1FBL A;  2D1N A;  3ELM A;  4H49 A;  4Q1L A;  1CGE A;  2A8H A;  4H76 A;  1HY7 A;  1I76 A;  3ZUK A;  4PKV A;  2YIG A; 
#chains in the Genus database with same CATH topology
 2I47 A;  1K7Q A;  5I2Z A;  1DTH A;  2MZE A;  1A85 A;  1KBC A;  1JAN A;  2MZI A;  2OW9 A;  1S4B P;  1ZXV A;  1PWU A;  1JK3 A;  4DD8 A;  3P24 A;  4H84 A;  3HB2 P;  1ROS A;  2SRT A;  1JIZ A;  1XFV A;  1UEA A;  3EWJ A;  3F16 A;  1XFU A;  3F18 A;  3HBU P;  3KMC A;  1ND1 A;  1FM1 A;  2POJ A;  1QIB A;  3TT4 A;  4PKS A;  3Q2G A;  2QPJ A;  4XBH A;  4HX3 A;  2YB9 A;  2DW1 A;  3TSK A;  3DL1 A;  3KME A;  3P1V A;  1CQR A;  2Z2D A;  5L7F A;  1XM5 A;  3HY9 A;  1GKC A;  4H1Q A;  2Y6C A;  1XFY A;  5B5P A;  3N2V A;  1KUH A;  4GWN A;  3MA2 A;  1BKC I;  2FV9 A;  3F19 A;  5D2B A;  3HBV P;  4L6T A;  4A3W A;  2OXZ A;  5D1U A;  5D3C A;  3B8Z A;  1GO8 P;  1CXV A;  1JKY A;  2OI0 A;  5CUH A;  1PWQ A;  5LAB A;  1BUV M;  1R1J A;  2WO8 A;  2JIH A;  1XFZ A;  1BKC A;  4ZR5 A;  3N2U A;  2O36 A;  4WKI A;  1Y93 A;  1ZP5 A;  1QIA A;  3OHL A;  1Z3J A;  5I4O A;  3GBO A;  1HFC A;  3RTT A;  5CXA A;  3LGP A;  1G9K A;  3O2X A;  1IAB A;  2JT5 A;  1O0Q A;  3EDI A;  4R3V A;  4GQL A;  4H2E A;  1UMS A;  3EHY A;  4PKR A;  4H3X A;  2DW2 A;  4L63 A;  2MLS A;  1GO7 P;  1HFS A;  1MNC A;  2WOA A;  3U1R A;  2J83 A;  1AYK A;  3KEK A;  2W13 A;  1BUD A;  4IJO A;  1JAQ A;  1EUB A;  3G5C A;  2OVX A;  3HY7 A;  5CZM A;  3ZXH A;  1JJ9 A;  2O3E A;  2KRJ A;  4JQG A;  1GE6 A;  1RMZ A;  966C A;  1BM6 A;  5I12 A;  1AST A;  1QJJ A;  3AYU A;  1KUF A;  4L7A A;  1L6J A;  1C7K A;  1BQQ M;  4A7B A;  4FU4 A;  1YP1 A;  3CKI A;  2TCL A;  3G42 A;  4G9L A;  1YOU A;  1ZVX A;  5D7W A;  5BOY A;  4ON1 A;  1R1I A;  1ZS0 A;  3LUM A;  1G4K A;  5B5O A;  1JAO A;  4IN9 A;  5L79 A;  1ATL A;  2X3C A;  3B2Z A;  1CK7 A;  2YUF A;  1SU3 A;  2ERQ A;  1HOV A;  1JAP A;  2MZH A;  4WKE A;  1SRP A;  1BKC E;  1XFX A;  1GKD A;  4GR0 A;  1OS9 A;  3BA0 A;  1KAP P;  1A86 A;  3LQ0 A;  3E8R A;  1R1H A;  4QKZ A;  3KEC A;  3LIR A;  2Y6D A;  1EAK A;  2USN A;  3KEJ A;  4GWM A;  1XUD A;  4IUW A;  1D8M A;  1Y0V A;  2E2D A;  4XM6 A;  456C A;  1K7I A;  830C A;  1D7X A;  1I1I P;  3WV3 A;  1IAE A;  2RJQ A;  3V96 B;  3WV2 A;  3LJG A;  3KRY A;  1WNI A;  2CKI A;  4WF6 A;  4AUO A;  4JPA A;  2V4B A;  1KUG A;  3DPE A;  1KUI A;  1JH1 A;  1OM8 A;  3K7L A;  3KWV C;  1OS2 A;  1B8Y A;  3EDZ A;  3F17 A;  1IAD A;  4GR3 A;  1O0T A;  3F15 A;  1SMP A;  1IAC A;  1IAG A;  3TS4 A;  4JA1 A;  2DDF A;  1PWV A;  4EFS A;  1G49 A;  2DW0 A;  1CGF A;  1C8T A;  1PWP A;  2OW0 A;  4XM7 A;  2X3B A;  2OVZ A;  3L0T A;  3EDG A;  1ZXC A;  2J0T A;  1GE5 A;  4DPE A;  3F1A A;  1SLN A;  1BZS A;  4HMA A;  3I7G A;  4GUY A;  2XS3 A;  5D1S A;  1BSW A;  2X3A A;  2ERP A;  1MMR A;  1OM7 A;  1R54 A;  1QIC A;  3WV1 A;  2DDY A;  1G12 A;  3DTE A;  1CGL A;  2WO9 A;  3HYG A;  3HDB A;  2L0R A;  4AYK A;  1XUR A;  4ILW D;  3OHO A;  3USN A;  3RTS A;  4J4M A;  3UVC A;  1XUC A;  3LJZ A;  4I03 A;  3O64 A;  1MMP A;  2W14 A;  1CIZ A;  2OY2 A;  1AF0 A;  1UTT A;  2HU6 A;  1UTZ A;  1CAQ A;  1OZ9 A;  1D8F A;  4XM8 A;  4XCT A;  5BOT A;  1PWW A;  2OZR A;  5I0L A;  3L0V A;  1B3D A;  3EDH A;  4AXQ A;  3TVC A;  3LEA A;  3DNG A;  4AIG A;  4WK7 A;  1AKL A;  3K7N A;  2D1O A;  4GF1 A;  3LK8 A;  1I73 A;  4FXQ A;  2XS4 A;  3NX7 A;  1XFW A;  3Q2H A;  1UMT A;  1K7G A;  3EHX A;  4FVL A;  1GXD A;  5I3M A;  3LIL A;  1KUK A;  1JIW P;  2CLT A;  1TVI A;  2K9C A;  2PJT A;  1H71 P;  2W15 A;  1DMT A;  2N8R A;  3LJT A;  1YQY A;  2ERO A;  2X7M A;  5D1T A;  1QUA A;  3KHI A;  1Y8J A;  1Q3A A;  1MMQ A;  4DV8 A;  3AYK A;  4GR8 A;  1EB6 A;  2JSD A;  1ZTQ A;  4I35 A;  3AIG A;  1USN A;  5H8X A;  3B92 A;  2RJP A;  5I43 A;  1HV5 A;  1HTD A;  4L19 A;  4JIJ A;  3HDA P;  1GE7 A;  1SLM A;  2AIG P;  2FV5 A;  1OM6 A;  3VI1 A;  3DPF A;  2JNP A;  1QJI A;  2OW2 A;  1C3I A;  4DF9 A;  3DTK A;  4PKW A;  4G0D A;  3LQB A;  1OMJ A;  4WZV A;  3LIK A;  4H30 A;  5BPA A;  3DSL A;  1IAA A;  3LMC A;  1OO9 A;  1YCM A;  3I7I A;  3LKA A;  3SHI A;  3VTG A;  2JT6 A;  1XAX A;  3ZVS A;  1J7N A;  1G05 A;  4H82 A;  2AYK A;  2MLR A;  4FXY P;  2W0D A;  4PKU A;  1BQO A;  4CTH A;  1MMB A;  1D5J A;  3DTI A;  1R55 A;  2OY4 A;  5JMY A;  1FLS A;  1BIW A;  2OXU A;  2OW1 A;  3LE9 A;  4JP4 A;  2OXW A;  3DWB A;  3LUN A;  4PKQ A;  2E3X A;  2W12 A;  2K2G A;  1RM8 A;  4PKT A;  1SAT A;  1FBL A;  2D1N A;  3ELM A;  4H49 A;  4Q1L A;  1CGE A;  2A8H A;  4H76 A;  1HY7 A;  1I76 A;  3ZUK A;  4PKV A;  2YIG A; 
#chains in the Genus database with same CATH homology
 2I47 A;  1K7Q A;  5I2Z A;  1DTH A;  2MZE A;  1A85 A;  1KBC A;  1JAN A;  2MZI A;  2OW9 A;  1S4B P;  1ZXV A;  1PWU A;  1JK3 A;  4DD8 A;  3P24 A;  4H84 A;  3HB2 P;  1ROS A;  2SRT A;  1JIZ A;  1XFV A;  1UEA A;  3EWJ A;  3F16 A;  1XFU A;  3F18 A;  3HBU P;  3KMC A;  1ND1 A;  1FM1 A;  2POJ A;  1QIB A;  3TT4 A;  4PKS A;  3Q2G A;  2QPJ A;  4XBH A;  4HX3 A;  2YB9 A;  2DW1 A;  3TSK A;  3DL1 A;  3KME A;  3P1V A;  1CQR A;  2Z2D A;  5L7F A;  3HY9 A;  1GKC A;  4H1Q A;  2Y6C A;  1XFY A;  5B5P A;  3N2V A;  1KUH A;  4GWN A;  3MA2 A;  1BKC I;  2FV9 A;  3F19 A;  5D2B A;  3HBV P;  4L6T A;  4A3W A;  2OXZ A;  5D1U A;  5D3C A;  3B8Z A;  1GO8 P;  1CXV A;  1JKY A;  2OI0 A;  5CUH A;  1PWQ A;  5LAB A;  1BUV M;  1R1J A;  2WO8 A;  2JIH A;  1XFZ A;  1BKC A;  4ZR5 A;  3N2U A;  2O36 A;  4WKI A;  1Y93 A;  1ZP5 A;  1QIA A;  3OHL A;  1Z3J A;  5I4O A;  3GBO A;  1HFC A;  3RTT A;  5CXA A;  3LGP A;  1G9K A;  3O2X A;  1IAB A;  2JT5 A;  1O0Q A;  3EDI A;  4R3V A;  4GQL A;  4H2E A;  1UMS A;  3EHY A;  4PKR A;  4H3X A;  2DW2 A;  4L63 A;  2MLS A;  1GO7 P;  1HFS A;  1MNC A;  2WOA A;  3U1R A;  2J83 A;  1AYK A;  3KEK A;  2W13 A;  1BUD A;  4IJO A;  1JAQ A;  1EUB A;  3G5C A;  2OVX A;  3HY7 A;  5CZM A;  3ZXH A;  1JJ9 A;  2O3E A;  2KRJ A;  4JQG A;  1GE6 A;  1RMZ A;  966C A;  1BM6 A;  5I12 A;  1AST A;  1QJJ A;  3AYU A;  1KUF A;  4L7A A;  1L6J A;  1C7K A;  1BQQ M;  4A7B A;  4FU4 A;  1YP1 A;  3CKI A;  2TCL A;  3G42 A;  4G9L A;  1YOU A;  1ZVX A;  5D7W A;  5BOY A;  4ON1 A;  1R1I A;  1ZS0 A;  3LUM A;  1G4K A;  5B5O A;  1JAO A;  4IN9 A;  5L79 A;  1ATL A;  2X3C A;  3B2Z A;  1CK7 A;  2YUF A;  1SU3 A;  2ERQ A;  1HOV A;  1JAP A;  2MZH A;  4WKE A;  1SRP A;  1BKC E;  1XFX A;  1GKD A;  4GR0 A;  1OS9 A;  3BA0 A;  1KAP P;  1A86 A;  3LQ0 A;  3E8R A;  1R1H A;  4QKZ A;  3KEC A;  3LIR A;  2Y6D A;  1EAK A;  2USN A;  3KEJ A;  4GWM A;  1XUD A;  4IUW A;  1D8M A;  1Y0V A;  2E2D A;  4XM6 A;  456C A;  1K7I A;  830C A;  1D7X A;  1I1I P;  3WV3 A;  1IAE A;  2RJQ A;  3V96 B;  3WV2 A;  3LJG A;  3KRY A;  1WNI A;  2CKI A;  4WF6 A;  4AUO A;  4JPA A;  2V4B A;  1KUG A;  3DPE A;  1KUI A;  1JH1 A;  1OM8 A;  3K7L A;  3KWV C;  1OS2 A;  1B8Y A;  3EDZ A;  3F17 A;  1IAD A;  4GR3 A;  1O0T A;  3F15 A;  1SMP A;  1IAC A;  1IAG A;  3TS4 A;  4JA1 A;  2DDF A;  1PWV A;  4EFS A;  1G49 A;  2DW0 A;  1CGF A;  1C8T A;  1PWP A;  2OW0 A;  4XM7 A;  2X3B A;  2OVZ A;  3L0T A;  3EDG A;  1ZXC A;  2J0T A;  1GE5 A;  4DPE A;  3F1A A;  1SLN A;  1BZS A;  4HMA A;  3I7G A;  4GUY A;  2XS3 A;  5D1S A;  1BSW A;  2X3A A;  2ERP A;  1MMR A;  1OM7 A;  1R54 A;  1QIC A;  3WV1 A;  2DDY A;  1G12 A;  3DTE A;  1CGL A;  2WO9 A;  3HYG A;  3HDB A;  2L0R A;  4AYK A;  1XUR A;  4ILW D;  3OHO A;  3USN A;  3RTS A;  4J4M A;  3UVC A;  1XUC A;  3LJZ A;  4I03 A;  3O64 A;  1MMP A;  2W14 A;  1CIZ A;  2OY2 A;  1AF0 A;  1UTT A;  2HU6 A;  1UTZ A;  1CAQ A;  4XM8 A;  1D8F A;  4XCT A;  5BOT A;  1PWW A;  2OZR A;  5I0L A;  3L0V A;  1B3D A;  3EDH A;  4AXQ A;  3TVC A;  3LEA A;  3DNG A;  4AIG A;  4WK7 A;  1AKL A;  3K7N A;  2D1O A;  4GF1 A;  3LK8 A;  1I73 A;  4FXQ A;  2XS4 A;  3NX7 A;  1XFW A;  3Q2H A;  1UMT A;  1K7G A;  3EHX A;  4FVL A;  1GXD A;  5I3M A;  3LIL A;  1KUK A;  1JIW P;  2CLT A;  2K9C A;  2PJT A;  1H71 P;  2W15 A;  1DMT A;  2N8R A;  3LJT A;  1YQY A;  2ERO A;  2X7M A;  5D1T A;  1QUA A;  3KHI A;  1Y8J A;  1Q3A A;  1MMQ A;  4DV8 A;  3AYK A;  4GR8 A;  1EB6 A;  2JSD A;  1ZTQ A;  4I35 A;  3AIG A;  1USN A;  5H8X A;  3B92 A;  2RJP A;  5I43 A;  1HV5 A;  1HTD A;  4L19 A;  4JIJ A;  3HDA P;  1GE7 A;  1SLM A;  2AIG P;  2FV5 A;  1OM6 A;  3VI1 A;  3DPF A;  2JNP A;  1QJI A;  2OW2 A;  1C3I A;  4DF9 A;  3DTK A;  4PKW A;  4G0D A;  3LQB A;  1OMJ A;  4WZV A;  3LIK A;  4H30 A;  5BPA A;  3DSL A;  1IAA A;  3LMC A;  1OO9 A;  1YCM A;  3I7I A;  3LKA A;  3SHI A;  3VTG A;  2JT6 A;  3ZVS A;  1J7N A;  1G05 A;  4H82 A;  2AYK A;  2MLR A;  4FXY P;  2W0D A;  4PKU A;  1BQO A;  4CTH A;  1MMB A;  1D5J A;  3DTI A;  1R55 A;  2OY4 A;  5JMY A;  1FLS A;  1BIW A;  2OXU A;  2OW1 A;  3LE9 A;  4JP4 A;  2OXW A;  3DWB A;  3LUN A;  4PKQ A;  2E3X A;  2W12 A;  2K2G A;  1RM8 A;  4PKT A;  1SAT A;  1FBL A;  2D1N A;  3ELM A;  4H49 A;  4Q1L A;  1CGE A;  2A8H A;  4H76 A;  1HY7 A;  1I76 A;  3ZUK A;  4PKV A;  2YIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...