5I0VA

Iron and copper-bound p19 from campylobacter jejuni under oxidizing conditions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
159
structure length
159
Chain Sequence
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-handling and Receptor Recognition by FetP and P19 from Uropathogenic Escherichia coli and Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni serotype o:23/36
molecule tags Metal transport
molecule keywords Protein P19
total genus 31
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5i0vA00
3NRPA 3LZOA 3LZLA 3NRQA 2O6EA 3LZRA 3PJLA 5I0YA 3LZNA 5I0VA 5I0XA 3LZPA 3PJNA 3LZQA 2O6FA 2O6DA 2O6CA 5I0WA
chains in the Genus database with same CATH superfamily
3HB3B 1IIIA 4LQFH 5FV2A 2D31A 4NPJA 1V3JA 3TGXA 1Q1JL 3AG4B 4G3YL 4KKAD 3SQBA 2ROXA 3OHXB 1AXTL 3SDXB 1R19A 5ECGA 3GRGA 3LN4A 1BREA 5LAPA 1XFPA 4M5YL 4XHJC 2ZCZA 4MXWH 1UD2A 2EIKB 1T2QH 2P5ED 1UM4L 5EOCJ 5BW7A 3ASWA 4Q7DA 1GS8A 2XICA 2ORBH 5JW3H 1FL6B 5T3ZL 3IJ9A 2YAEA 1MG2C 4S1QL 5E6SB 3SOTA 3REWB 4FTDA 1XH1A 1RK1A 3C6LD 3WS6C 4OZHB 2VC2B 5JIMA 3TXAA 3QJSB 1CXHA 1Q1PA 1INDH 4BZ1A 2BXZA 4W1TA 2DIJA 1TSHA 4UV4L 3QUZB 1NKOA 2C9UA 5F6HJ 4AH2B 3ARQA 3DETD 3H7BA 4G6KH 1DSWA 3T6QC 3EKCA 1EANA 4Z78A 4MCZB 4YK4C 2DH3A 4HV8B 3CXFA 5F9JA 2D7TL 1ETB1 3NZ8A 4NJAH 1KB5L 1O9ZA 4PJEB 4ZYKB 4E36A 4XNXH 3ZIYA 4ADJA 3P77B 1MRCH 1LWJA 1MRFH 2J1XA 4YDJA 3VFPB 1JL8A 3QWOA 1PIGA 5GSVA 3D52A 4XRCA 3EJUA 3GKWL 4IRZH 2IH8A 3CDGA 1MH5B 4X98B 1KFGA 4BE5A 1HOCA 3NG5A 1M05A 1AGDB 1MAMH 4IBZA 3ROOB 3X3FH 1MCNA 1SF3A 3ABMB 4OLXH 4RX4D 5T3XD 3QRGL 1KCBA 4MD5A 1CBVH 1DHKA 5IW6A 1GR7A 4G43B 3CN1A 5HHMB 3GMLA 1JV2A 3FZUD 1FRGH 5B3JE 3GXFA 1H3XA 4DP7X 4XWOD 3MLWL 1CURA 4YHOH 2QZQA 2VXSH 2MMXA 1UATA 4MD0A 4O2EB 1KB3A 1RL1A 2ADYA 2EDKA 3TN0A 4WI0B 1X5AA 2IGFH 2ISDA 3FB6B 1UZGA 1A3RL 4PJCF 3ZHDA 5D1QE 1N0XL 2PPCA 3ARGD 3C9NB 2EYTA 3VFOA 4KUCF 4NUPA 2D8KA 4J28A 2Y5QA 3WEMA 4GSQA 4OCYL 1URLA 3KEDA 3MRRA 4K3GA 2Y5TB 4XP1H 4ZDHB 3UPRA 3HPJA 2VERA 1E4JA 1W0WB 4KKLC 5IWLA 4MXVE 1A1OA 2ITEA 4UOW1 2I25N 2ICWA 4GNKB 1LJMA 5E8NA 3REWA 3RDTC 3VWKD 3V9CA 4M56A 1G7JB 2ERJC 2R2EB 4NQSA 2DQDL 4DK5A 3K5RA 4F37K 2B9BA 5BOPA 1FGNH 4HDIB 2RB8A 4O4YL 1G9NL 4XVTL 1RZJC 5C8JA 1P7QD 1NGWB 2Q10A 2YZ8A 3KPRB 4UNUA 4XTRD 5D1ZB 1IC5H 4YQXH 4Z78B 2GB2A 2Y07L 2D7PA 4RDQG 3LSOA 1AZRA 4KROC 1XR8A 5C6TL 4LSDA 1R5WB 2R1WA 2V5MA 4KXZI 4Y2DA 5I66A 4XPFH 1HSBB 1UZ8B 2AV1A 3GHBL 3PAYA 1CGSH 4ODXB 1BQ5A 2JJVA 2G3MA 3RVWC 3WSQL 5EZPA 4KK6C 1UXLA 1WAEA 4Q0XL 1DVQA 1KY7A 3Q48A 4NQDB 2VZUA 4NZRL 4TVUA 3MBEC 1BIIB 3TH4T 5JOFA 2VLKA 4IMKA 4OCMC 4AGMA 1UG9A 2BLFA 5F7DA 3ZE1B 4PS7A 2G2RA 2QJDA 3VFUB 1YQVH 1KTCA 5EU6D 4H8WL 3CN3A 1H5BA 3HC4L 2HTKC 5CINL 4JAMB 4AVKA 3ATFA 5IHBA 3LPGA 2CKBA 1ORSA 5FW6A 1BWMA 1U8NB 1JHLL 3GHEL 3TVMB 1KPRA 3RL2A 3ARBC 4OIFA 4GRWF 3LVEA 3WFEH 1MWAL 1YEWA 3ET9F 4U1MB 4HWZB 3HZVB 4TQ8A 1ZLSL 1BZ9A 4YDVA 3UAJA 2AJ3B 2ED8A 1U92A 4HLZG 3ZKSD 2IQAA 1P84K 3VFOB 1Y1UA 3LKRA 3O6FA 2LQRA 3QNYA 4UIMA 1OVZA 4ALAH 1QFWL 4JRYD 3VE0A 2CSPA 4LLUB 5BO1H 3D4GA 1NFDA 1MCPL 3GRBA 2J8HA 3I74A 5SX5K 4K8RH 4JKMA 4N22A 2FQFA 4HUUA 1CFNB 4AG4H 5AW2B 4J3WA 4E41A 1I75A 1U33A 3FT4A 1OAKL 2WINB 4K5PA 3PHSA 3QEQB 5CCHE 2OSWA 4D7BA 2E7HA 4WU5B 3DIVA 4HJEA 3KPRD 4MD4A 3UDWC 3NRQA 5A7EA 3U9PH 2AXFB 2DQCH 4NSKA 2JKRM 3KYAA 2G75B 1C8PA 2RACA 3NT0A 1AMYA 3T3PE 4BFJA 1CC3A 3DA0A 1DR9A 4F57H 3H54A 4RX4A 2X3BA 4U4IA 3O8XC 4OT1H 3AACA 1LO5B 2X4SA 4OV5B 1KG0B 1JZ7A 3DJZA 2VR5A 2H32H 1WZ1H 5I76A 1PS3A 1I8IB 4M6NH 3PJSB 5E9DE 5JOFB 5C0AE 1XTMA 4MB4A 3HZYB 4TQEL 4DOHB 4ODWA 2NR6A 1NC2B 3U4EA 5EF2A 5HYJB 3P9MB 4ZT1A 3OZLA 1M7DA 1MJJA 4KH2A 4OLVL 3CFDA 1FZJA 2WXQA 4YC2C 1I3RA 5EC1B 4AGOA 1IQDA 1YEJL 4OLYH 4EZJA 3BUTA 3JWDH 3HI5L 4YK4B 1L7IH 1KPRB 2Y2TA 3KWWB 1TO4A 1YEFH 5INDB 4PJ7A 4KZEL 2VW7A 1RIUL 2WBJD 1UJ3B 2J1KA 1P1VA 2EE9A 3APNA 2Y1VA 4CC4C 3MV8A 4ZUUA 3VX0A 5JUEL 5FDWB 3QORA 5DRNA 5BV7B 2O6DA 3L5XH 4Z7VB 2O6CA 4Y9GA 3TV3H 2WXJA 2FJUB 4M4RB 3IXTB 2IWGA 1UACH 3MJ9A 5DTFB 3Q5YA 1NGXB 2AZUA 3QDGD 1VFBB 3HLAB 3DX6A 4ONGH 2DIEA 3RB5A 4A68A 1G5AA 3QEGL 1BF5A 2NCEA 1EFXD 3QFDB 1GYAA 2EILB 3ARBD 3NCYP 1U8PB 1ZT4B 3DOSA 4A38A 2QPEB 1DANT 5CHNB 5FX3A 5TE7H 3EUDA 4WDIA 3TBYA 3IRCA 4BE6A 5FKAB 3BGFC 4AGQA 5JW3L 2NUTB 4ABQA 3NZUA 2GK0B 3VXRA 1OW0C 3S37X 2Y4SA 4AVHA 1ZIBA 1LLAA 4Q9QH 3D69B 4R2GC 3K6OA 5FYKD 4QR7A 2NY5L 1X9RA 5L2KA 1VA9A 1N6UA 5C7XH 4HUNB 1R5VA 3BQUD 1LO2L 2O5YH 4MCMA 3FHEA 4I2XE 1BFTA 5CJOL 3IMBA 4OUUB 2OMUB 2DQMA 2WTRA 3DVNB 3P9WB 1Q8MA 2BIIA 3VXNB 4LCYA 5GRVK 5B1JA 5D7IE 3HTLX 3PWPB 4PJ8D 1L0QA 1IX2A 2ZPKL 4KQ4L 3HS9A 2ODHA 5I1CL 1B4RA 1TYEB 1BVNT 1CFVH 4E9VA 3GF8A 4P5MB 3WFCH 2DQTH 3MJGX 1NUNB 2EH7L 5DD6A 2DF3A 1NC2D 2PO6C 5GJTH 3W39A 5C9KA 4OIIL 1JPST 3BKJH 5KOMC 4ZFOA 2CM6A 3BPNC 3WXWH 1J5IA 1MAML 3HBPA 3SOBL 3G7TA 3TEUA 4M93C 2FQGA 2R2CA 3K80A 4KK6D 3AREA 5ESVA 3ISRA 4F7MA 4ZBJA 3S3SA 1LYQA 3SYPA 1PZDA 5DEJA 2C5DC 2HCZX 1MWAB 4XP5L 2QV4A 1DFXA 3RBSA 3FRPB 1JWUA 5GGVH 3ZQWA 1YNTF 1XAUA 5ICYA 3V6OA 3TBCA 4HKZA 1LK3L 3B2VL 1L0XA 1GZHC 4PGZA 4LZKA 3CCHB 5DSCB 4HIXL 15C8L 2M83A 1A3RH 3SDDD 2K8MA 1F1DA 5A2AA 1ZHKA 5EBMB 4KKAC 2XIBA 1P2CA 5L6YH 4ONOA 3WI9A 3L3OC 3HAEA 2K7QA 3DV4B 3ARDC 5CSGA 3QO0A 2PMZA 1L5GB 1AJ7L 2B39A 1NA8A 3MV8E 4I1RA 1NCWH 4R97B 2R1XB 2VLRD 2VXUL 4N8VG 2MPAH 4Y88A 1K8DA 3TBWB 4FXGA 1KB9K 2N3JA 3FO0L 2LTQC 1V5JA 1W72H 1G6RB 1OTTD 2R0LH 3B2PA 4W4NA 2DYRB 4MLSA 4RDBA 4U6VH 4P3WA 1BECA 3AS1A 3SPIA 5D1QB 5JORA 3BPOC 5IREA 3JV5A 2ZKWA 2IOIA 3FFCD 4OZHE 4UNIA 1CG9A 5FK9A 1YUHA 3TBVB 4YQXL 1OPGH 3R06A 4JE4B 4M7ZB 2W9LA 4HEPG 4UQBA 4OFQA 4IQHA 3UMTA 3W9DA 2JKTM 1RY7B 3C09B 2X87A 3PUCA 2FHBA 4WEBL 3WHE1 4XXCA 3MUY1 2CD0A 3GHBH 4W9FC 5GS1B 2NY2D 4GRWE 3A67L 1NWOA 4KO5A 3STZA 3RILA 3ZO9A 1GGCH 1U95B 2O1AA 5IJBC 1I7ZB 4ZTOL 1H5BC 4QRPB 4NZRH 4P4RB 1F4HA 2YGVA 5DU7A 5F7FA 1SNRA 1CE6A 1BCIA 2CA4A 1J5CA 1FZKA 2R27A 1Q9KA 3M88A 5CSBA 1MRDH 4YO0A 3N42B 3O4LD 3MU3A 4IJ3C 3NZHH 5CINH 5E1QA 5F8RC 5DD0L 5FHBH 2G4EA 3WFEL 2H1LM 1CVSC 3VFNA 2NXZC 2O5XL 3MO1A 2CIIB 3IFNH 2AGJL 1ZWIB 4JPKL 1UUNA 1HYSD 2QPSA 3O9WA 3RVUD 2C9QA 1EAPB 3GSUA 2XVKA 3BVNA 4R8WL 2GEEA 5I6XB 4F58H 5J6HA 1QFWH 4KDVA 3O3DB 1HH6A 4EMZA 2W60A 4GKZB 4JFXB 1LWHA 5EIQA 5CSZA 3ULSA 4FYTA 3IJYB 2A6IA 4Z7VF 1TFHA 4OKDA 2IPKB 4PRNA 2XXFA 1NH6A 5J4MA 1M3IA 1U8OA 2XV2A 3CLFL 4PJFB 3RIAF 3RJDA 4L3EA 1QA9A 2HUHA 3OMZA 1IEBA 3K2UL 5EEUA 1HHJA 1HZHH 4HA1A 4X7SH 3FCTA 3ZXAC 2BHUA 1KGCE 4X4ME 5D1QA 5JORB 1D9KC 3SE4C 3V52H 2WY3B 2IGTA 3QDHA 4KXBA 2VR8A 1BQHB 1SXBA 1KUMA 5JA9A 4AC2A 4XCCL 3TO4D 4UZGA 3KCPA 2XPGA 3KPPB 1HVXA 4ZW5A 4TSCL 1MCOL 1HAWA 3MLSH 4PRHE 4GG6E 2BS71 5T1KB 2DQFB 3BPLB 2VL5B 3N43F 2WLJA 4Q2ZB 4KK5C 4LLDB 5I8CB 2DM3A 4N2NA 5CU9A 5DD1L 4NQCD 2D3VA 3WKML 5BS0B 3L3IA 5B3JF 1MRFL 4PRID 3STLB 2ZXAA 3TF4A 4N0YH 4ZQKA 3RGHA 1ONQA 2ZF8A 3GMMA 4YBLC 1UH4A 3ZE0B 4D0DA 2KL6A 2KDYA 2JIXA 4I1NB 3P69A 3IBEA 3BW9A 4OLVH 1ERNA 4PBDA 1VCBC 1FP5A 1CBVL 2Z8WC 2XCMC 5IB5A 5JHDB 4P2RE 4HIQA 5DXWA 4A7QA 4GXUM 5LCVH 1ZHNA 1T5XB 2J8UE 2F8VA 3FTYA 1R24B 3R1GH 1FPTL 1NLBL 3CFTA 3L5HA 3RZCD 3GQFA 5IB5B 5JHDA 2YD7A 1SF5A 4IOSA 4N5ED 4N0CC 4KVPA 3ZMRA 3SQBB 1NJ9B 1S46A 3WUZA 2VM4A 1DJSA 1NCBL 3IJYA 3MNMA 5HJ3B 4KRNA 5B38A 1U2CA 4NO2A 3TT3H 2CDFA 1QYGL 4M9PA 4PRDA 1SEQL 4IHBA 4M1GH 5EF1A 4FXTA 4PRPD 3EGSB 3RUGE 2VR6A 2HLFD 2ZAGA 4BKTC 1UFUA 3BN9D 1AGFA 3LXAA 1V8HA 4GKNB 4BFFA 3S88H 2COQA 4PRDB 3NABH 1I9JH 4IDJH 4EVNA 2Z64C 2XWJA 3BZFA 1PZ3A 4QJ5B 3P54A 3ATEA 2NRDA 4Z0BL 2W0FB 1A25A 4NKOB 4FKKA 3HNSH 4WGVB 3TONA 3BQVA 2QV2A 4JREC 1J1OL 4Y89A 1IZKA 4X8JA 2BP8A 4PJXF 3A47A 2WXMA 1AIFA 3WGVB 4FMKA 2EZ0D 3QQ9C 4FQLL 5G4NA 4XH2B 5GISL 4NN5B 4NKOA 1O7DC 2YKLH 1TUPA 4FHBD 4TSAH 4AQ1B 3RWGB 2VIRA 5FO7B 3FQRA 4NZJA 4BINA 2DJMA 4WUUE 4EPSA 5DVNA 2BNRA 1FFRA 3LKSA 4D0CA 3C6LA 4KQ4H 2MNUA 3FFDA 2FECL 1X9UA 1Q9WA 1BYPA 3RTQB 2HRPL 4ZG1A 4QF1A 4LVNB 1G7PA 2VDNL 2DRUA 3MBWA 3QIBA 1XCTB 2QKIB 1QSFD 1BVZA 2WZ6A 3C6LB 5GJTL 1JFQH 1RZKC 1MH5A 1U8QA 4TTDD 4X98A 3T1WA 3ARPA 2J8UF 3T0BA 3PS6A 3GSNB 2EDMA 1QPKA 2G3NA 4N2FA 3SJVE 2W92A 2F1EA 2UX7A 4UT7L 4XNYH 2G5BB 2WSDA 3IDMB 1QWNA 4FE9A 2QEJA 4PYHA 2DLHA 4ELMB 4OCXH 3L4YA 4R83A 3II2A 2Q86A 3WHXB 4TNVK 2P44B 3P73A 4N3UA 1H5BB 5IQ7L 2OJEA 1CFMA 2XQYG 4WI0A 5F88B 2HT4C 3HB3D 1OSZB 4HWUA 4XPGL 3VRLF 4AIOA 1DBJL 43C9A 1IKOP 3BQUB 2WQRA 5JOPD 4NGHL 4WUUD 2YSSB 1KCLA 1OWWA 2DBLH 4OLZH 3ZE2F 5IOPB 4FLHA 4AENB 5DVPA 4BK4A 4M6OL 1NCWL 2E86A 3HIZA 2MCPH 1DANU 1FA4A 2QVMA 2PETA 3PWLA 5AW6B 4CADA 3QDAA 3C2AH 4ZS6C 2NXZB 4LSQL 1ETZB 3IXAB 4L8SA 4OFKA 1QR1B 3IK2A 3FSWA 1OKEA 2HLFC 4YHZH 3WFHB 1IKNC 4G5ZL 1N5AA 3ABLB 5K9KB 4Z3GA 4NO5A 2GJJA 4RGOL 4FG6C 1MXDA 1OAYL 3QDGA 5E2VH 2WXKA 1T20B 3KPSB 5DHYA 3D6GA 2ETWA 2QDWA 3H7BB 1QWHA 1SMAA 5C0CE 1ZS8B 2HLAA 4X5RA 3QZOA 2J56A 2VXQH 3O0RL 4HAGA 4NUJB 4OT1L 3UJJL 4QJ4B 3HG1D 4LNRA 4FQIH 5LNEA 3IMWA 3DSFL 4P2OD 2XG5B 2IOOA 3E7JA 5FFGA 2AV1B 4FNUA 4K94L 4DAGL 3H6JA 3N1MC 3OKOA 3VM5A 2DEXX 5SV4A 3D39D 3V0JA 5GHWH 4HSCX 4JCLA 1TMCB 2XBDA 3AM8A 3B3BA 4QEGA 3CJJA 4J5VA 2Q3XA 2X4RA 1MCBA 3ZDZB 5CEYB 3MRMB 4UV7L 5CKAA 2IADA 2QPUA 3KDMB 4KGLA 4YDKL 1FBIH 5JYLA 1DDHA 3OR6B 2VQTA 3PJSA 4XCFH 3QK0A 4P3CL 4YZWA 4U1IA 5L2JA 3QRBA 2FLBT 1XV8A 2VZOA 4F33B 1Z7JA 2CK0H 3MX0A 4KRMB 2W91A 2XV3A 2VQUA 5FUCC 4C4BA 4DP2X 4URKA 5SWZB 5DJ0A 4KDTC 4K15A 1YO4A 3LH9A 3UTPD 1RPQA 2DS4A 2CJSA 3VX1A 1BD2B 4I18C 1BBDH 3S48A 2WLZA 5DHVA 3OGCB 1ND0B 1UYWH 3MRQB 1ID2A 1PAMA 3EHBC 2B5IB 1PW3A 3KR3H 4Y4FD 4OZHF 3ESUF 3B2XA 3M6DA 3NGBB 1I4FB 2VW6A 2VDMB 1P1ZB 4FCAA 1QEWB 5EORL 1SYSB 3TZVA 4MJ6A 2GYSA 5C0BD 2H6UA 4FQPA 1KLGA 4KJQC 2EUXA 3ZE1E 3D18B 5TDPB 1ZS8A 1U30A 3MLVH 4PJ5A 4FX5A 3EYVA 4AV5A 3U1QA 3S98A 1MPAL 1UENA 2YLKA 5E23A 3P77A 1A1MB 2A9AA 2EQDA 3Q2WA 5MENB 2CRYA 3UTSA 2BHFA 2VAAA 4F7CA 4F2MA 4B27A 3QIUA 5C07D 2YUWA 2VABB 3B2UD 4NWTL 3G6AA 5HHXL 5HYSB 3DXAA 2NX5D 1QW9A 5I5MA 1P7HL 3L17A 2YD6A 5DZJA 5D7SL 1VZGA 4QXUH 4Z3EA 1U8JA 3DVIA 3ALXA 4LGPB 2CJUH 3P4OA 4PV8B 2IWFA 3LZLA 2DWDB 4P5RA 2ZWZA 5AB1A 1AR2A 4JN1L 2G0KA 4NQDD 2NZ9C 1W15A 4TUKL 4EO5A 2EICA 3BGMB 4HC1H 5DD6B 4K9JA 2BWIA 3DMMC 2GQHA 1FPTH 4XP5H 4ZXBC 4FS0A 5J56B 4UQEA 1BMWA 4F9PC 2Y36L 5GGVL 4PPTA 2YPKA 1BQKA 1IEAB 1YEGH 3O81A 4MMXA 3TZVD 4L1HA 2H9GB 4XMKL 4OGYL 2HLEB 3GD1C 3QUYD 3FQTB 4E9WA 4Q56A 4GI9A 2NY1C 1QEXA 2Q7YB 7CGTA 4DP4X 5D6CA 4MMXB 2BMKB 3ZKXC 5I1KL 5I1IL 4ANUA 2ZZUT 5KBDA 3BUIA 4J4PA 1QG3A 2P43B 4DNLA 5HYJE 2CR6A 1U8MB 3UYPA 3QEHB 4Z0XB 5C92A 1OAUL 5E95B 3D4CA 1YECH 4AX3A 5IB3B 3GMQB 1TQCB 4PB9L 4OM0L 5LQBL 2AANA 4H0IA 4WV1B 4ZMNA 2E56A 3MNZB 4PJFE 4RRPA 3FQYA 3V4UL 3FT4B 1T0NA 3DX8B 3OAWA 2MQGA 3M45A 2B2XH 2WKLA 2DWSA 3OQ3B 4HISA 4WFHD 4MAYA 3AGWA 3D09A 4FG0A 3UZVA 2UWEE 5I17B 4K5NA 4A7VA 4QHKI 4TOYH 4GMTL 5KYYA 4MX7A 1FNSH 2DB8A 4L0YA 2AXJA 4XVUC 3UBHA 1OOWA 3GNMH 1T4WA 4Z8FL 4J3OF 3RP1A 1SHXA 4JG1H 4JN2B 1KYOK 4NO0B 2P5WA 4TTDC 2P24A 4H2CA 2DKSA 3BPCB 5FK9B 4PVBA 1YEDB 2PXYB 3D2UB 3ILPB 2FIKB 3RB7A 4AYID 1HZKA 1P7BA 1L9QA 5G55A 3FUEA 4HK3J 3BKMH 5M94B 3OPUA 4PJHE 1E3ZA 2ZUTA 3WNJA 1NM9A 4P06A 3K0YA 3S35L 1XDTT 2OYMA 1OW0A 2DIAA 2AQ1A 3CFKA 2H3NA 2VAJA 4JW3A 1XB8A 3BPNB 4KMQA 5C0AD 5FB8B 1I3UA 2YOCA 2F08A 3LKQA 5EUOF 1PZ5B 4CBZA 3L7FA 6PCYA 1NFAA 1RZ8A 2YC1A 1ADQL 5FUOL 1HJBC 5FM8A 5FGBC 3S34L 1XIWD 4ZFZA 1RLBA 4F8TA 5AW5B 3VNZA 4PGDB 4D9QE 3IDUA 1G1CA 5INDA 1XGUA 3HUJA 4LARH 5KBNC 1KCRL 3ATAA 3QE5A 3UO1H 4GBXC 5KEZA 5IQ7H 4HKZB 4DP6X 1S3RA 2YAFA 3GPEA 4PTTB 1Q4NX 4KI5F 1Q72L 1SMOA 3DNKA 1UGNA 4ZS6D 1LP9B 2LU5A 4PRAA 1TVBB 4OJYA 5GS0H 3BWAA 5HYSG 4KZDH 1A7NL 2DBLL 3I9PA 4OLZL 2MKLC 4EI6B 5JIPA 1BAGA 2DMKA 1D6VH 2E75C 2XACC 1DBBH 3WJJC 5A2CA 1L5GA 3D06A 4GIPD 4LMQE 3TLRA 3V5KB 2LE9A 5DGRA 4JY5L 3T08A 2NW2B 3DX3A 3SGJA 4DHLA 6PAZA 3E1ZA 5I1AB 1FFTB 3WKQA 3ULVD 2GSMB 4CGUB 2EVGA 1Y18B 3FH7A 5DMYA 3DOHA 5CCKH 3W82A 3SODB 1ASQA 5GS3A 1OAYH 2F53E 4NXSA 1QI5A 3MJ7B 2AEPH 4R5TA 1KCSL 5IQ9A 5EA0H 3CZFA 3RYMA 4LLAA 2BRRH 2Z31A 5F3BB 1Q0XH 3V4PA 3S3BB 2GK0A 3VXRB 2GIXA 2EKSB 3MREB 3NK3A 3TX4A 4K94H 2XIDA 4DAGH 1MCFA 3ORJA 3NPSC 3KNBB 3Q1EA 4XCNB 4XXCC 1OANA 2V3FA 1TJMA 4XPTH 5I1JH 2GY7B 2VNCA 3JVGC 1TEYA 1MSPA 4OZIB 4HIJA 3UTQA 3MV7D 5FM5M 2FK9A 1ZANH 3QDJA 4L8BA 2G5RA 4AQ8A 1FBIL 4ZNEE 1EEYB 2ZSWA 5L4JA 2YUXA 2ATAA 4ZMXA 3RPKA 4P3CH 5B4MC 3W0WD 4NZ8A 5JLZA 1RV6X 3QI9B 4FP8L 4LASH 1IGTA 5KG9B 5H4YA 3ZY7A 1MNNA 3FPYA 4X0KB 1DSFH 3X13B 5DTFA 1A3LH 4KK9D 4N8PA 1N6QH 4MWFA 1U8IA 3DX9A 1O75A 4Z7UA 2DWXA 5I6XC 5J8OA 1J48A 2NDGA 5JHLL 3ARRA 4LCIL 1CGXA 3ETSA 4EZKA 1AYRA 4P59L 5E2WH 5EN3A 2VSMB 1O7VA 3ULUF 3K46A 3ARBA 5B7FA 3DVGA 5FECB 2XWZA 1ITBB 3FMGH 1BVKA 1JTTA 3I84A 4NRZB 1QBLL 4YS4A 5CR8A 1RZJH 5CIPH 1KBVA 3GWJA 3D33A 2GSGA 3ZKND 3QO0B 4FNTA 3H6AA 3UTZB 3DMMB 1F6LL 3KR3L 2XRAH 1CI3M 2C3HA 4EQ3A 3MLYH 2N7SA 4GAGL 3KGRA 3U2SB 2FSEB 1SYVB 4ODSL 4YX2L 1OHQA 3FT3B 2Z92A 4U6XB 5F44A 4OQTA 2UX6A 1IZJA 2OMUA 3B4NA 3UJIH 4WGKA 1XGQA 3EYSH 1EZUA 1B9KA 3U6RA 3TTSA 1CG9B 3V4PB 2F54D 3QAZC 1IGML 1ETA1 1M71A 4M02A 4OI9A 5KVGE 3V6FA 4HS6A 1TZHA 2NY6B 3KWTA 4QAWA 3H9ZA 4LQ1A 5G5DA 4XBMA 5C09E 3NYKA 1GXEA 3NTCH 3H3KA 3VDBA 2FH8A 4I89A 1L7TH 2V7HA 4FOMA 4FLQA 2V5TA 2VDKB 2CPCA 2NX5B 5CO1A 5D55A 4AV0A 4KNUA 1HE8A 3GS4A 3FT1A 3WNLA 4LPTA 2WKGA 3BW9B 1JYXA 4UINL 5T1JA 4FGMA 3H4HA 4N9GA 4XR8C 3X1BA 4G8GA 1VPOH 3KYMB 5KVFH 5HHQA 1MHHA 2IXQB 4RGNB 4QF1B 4XNYL 5GGTA 4HWNA 4BSJA 2AJZB 2NNFA 3KPTA 4AEHL 5AG9A 3WJMB 3L3GB 1R47A 4QRRD 4XAKD 3MRNA 4QLRA 2DD8H 2NDFA 1L9RA 2CLVA 3KBHE 5ISZB 5CXPA 5TH2A 1FH2A 2WCSA 5CGTA 4S2SB 4F7TB 4MJ5B 3QEUB 1RAMA 4DZ8A 5KJ4A 3O9WB 4PWGA 1KN2L 2DY2A 3UP1A 3EH5B 4LGRB 4Q6IB 4XPGH 5TH2B 4N6QA 4C56D 4JPIB 3UJTL 3F7YB 2VDPB 1LDSA 4YSTA 2APBA 3C8KB 5IFHH 4A63A 1W16A 4FFWC 4CC4A 5KN5A 1E4KA 3HR5B 2MCPL 3ECWA 1NCIA 3D48R 3K2IA 4UU9A 5TK2A 3GXIA 4AEIL 4LHJB 4LSQH 4CVXB 1UD3A 4LHQB 3EOAB 4L5FH 1WBXA 3FB5A 2I32A 4JRWA 2V37A 4LPXA 4GBXB 2V3EA 3ENEA 1T6VN 2Z4TA 4IKLA 1PYWA 3U6RB 4JREB 4JHBA 4RGMB 2Q8AL 4OCWL 3N44F 4P2CG 5BRPA 3OZ9L 5E51A 4KTEH 1S7VA 2Z31D 4FTVE 1D5BA 5SWSA 3CU1A 3CE1A 3OM3B 4P5TA 5DLLA 5HYEA 4JFHE 3U1SL 2OM5A 4BK5A 1ZLVK 1U93A 4PRHD 4Z6AT 1AG6A 2Q76B 3ZDXB 4B9IA 2P7TB 4D9RE 3BCFA 4GKSA 4Z95H 4N2KA 4C56E 3WU1A 4IRSC 4IRSD 3BKML 5JPMB 1Z0MA 3AWFA 3WS6A 1EHKB 5D71L 5SV3A 4PV9A 1JUFA 2P28B 4Y7MA 4ZXBA 4XMLH 4N8CL 3CSYA 4AY0A 3GTNA 3BRFA 2ZKMX 1UJ3C 4LRIA 2MFNA 4RFNC 2CLVB 3DIDA 4U6HA 5HGDA 5AFAA 5LWYH 4NRYA 5HDBE 5DYOB 2CO4A 1EHAA 2DN7A 1HESA 3MRMA 3MCYA 3OKNB 4KI5C 1MKFA 3GEWB 3T4YA 4Q6IA 1CGWA 2WNXA 2G9HA 1WISA 2CLRA 2K8QA 2P52A 2NUPA 4L4VE 5LBSA 3VQLA 3SYAA 3T4YB 4IGBC 4LHUD 3CVHA 3QH3A 5I2IB 2CH8A 1FQ9C 5DJ6A 4JFHD 3ZT5A 1JGDB 2P80D 1KCKA 1MW2A 1D5IL 3B34A 3MRRB 2WBJC 2YGOA 5LG1A 1FLRH 1HYRC 3NCYS 3P30H 3SKNB 1JERA 4PJBB 4I0PC 4G42B 2J73A 1UD4A 4AIZA 2AEPL 1EGJA 5IESL 2X4OB 3ZQ9A 4MCYB 5DYFA 5IHZA 1NGWA 3QZWG 1WBYB 2ATKB 1HT6A 2NT0A 1MVYA 3BSZL 3I2CL 1NZRA 2FCBA 3EF4A 4LMQI 5HY9B 1NDMA 4U2YA 2Z4QB 4KOBA 3VXUD 4MZIA 2DEYX 1I3GL 3U9UA 1DP0A 5I1HH 4LPUA 5MHSE 1G4MA 3V4PL 4BZ1H 3BVWA 4JFSA 5TDNA 4A2EA 4L4VD 3L4WA 3UC0H 5HI4C 2BY2A 3RURA 3TP4A 1A1MA 1JGUL 2FEDD 1CXLA 2A3TA 2BIMA 1JHTB 4W9HC 4CU7A 4N2AA 5GGSB 2VOTA 3QO1A 1S9VB 1ZANL 2NNAB 3O6KL 5FHAH 2VDMH 4YE0A 3UZQA 5E4EC 1DBKH 5EN2B 4G6MH 4QHNB 2BY1A 5AW8B 3P4MA 5DJ2B 4BXSV 4DK3A 1H3TA 4FP8H 2HSIA 4WK0B 5B3SB 3DDFA 1MFAL 1KENL 4MCZA 3LNHA 5FYLD 4LKCA 4NM4L 2EXWD 1MLCB 4L3AA 4NZDA 2DWDA 3MBXH 3EGSA 1E9PB 5GGTH 3SDXA 3HNTL 5D6DC 5LAXA 4PY7A 2A74B 5EO0B 1JF6A 4HK0A 4EVNB 1HQRA 4I18B 3GBDA 3ISYA 2F8XC 3TN0C 1U3NA 5HPMB 3QDMA 3AMLA 2UY6A 3PL6D 3WY3A 4KVNL 1P5UB 3E80A 1A7PH 2MCG1 4HCRA 3WIHA 3CLEL 4OM0H 3N50A 4LHUG 3EF7A 4RSYA 1NBZB 3SPCA 5LQBH 1KBBA 2FNBA 3BN9C 1PZBA 2VLRB 3H56A 4FG2A 1G9EA 2OK0L 1X5HA 1M1SA 3DJSA 1JCVA 1P5UA 4HJ1A 4N1CA 2N4IA 2OMZB 2BOCA 3D39E 3NOIA 5TQ2L 3QUMB 3L8QA 4FN0A 2PPFA 4NC1E 1CZ8H 4GO8A 3KPLA 2JXMB 3HLKA 5TGBA 4ISVB 2R29H 3OJ2C 2XWEA 1Q9WB 3IJEB 2HLAB 1T0OA 3HVNA 5LCVA 1BJ8A 3AWEA 3ZDYF 3SPJA 5AW4B 4ZFGH 3U9UB 4FAAB 1QABA 3BAJA 3VSVA 3AXHA 3FT2B 3D34A 1L4IA 3KLKA 5INCB 1KPVA 1N5AB 2BM3A 1XCQB 3H8NA 3VDAA 5JQ6H 2IDUA 1G7IA 4ES8A 3OB8A 3B7UX 4JO3L 4MZ2A 4AKPA 5IMKB 1H3UA 3UAFA 4K7FA 3VJ6B 1BZDA 3US9A 5GZNA 1YAZA 2V2XB 1JF5A 1XF3B 4HGKC 5I1EL 4HGMA 3NIDB 2EDFA 5DZOA 2B1AH 4U1LA 2AJSL 4ODUA 3O6LL 1MQKL 5F9OL 1RCYA 4JFEA 3H0TA 2ICEC 4JFED 5FDYA 3BIAX 3VFSB 1A21A 4ZNCD 4YSEA 2AQNA 3LKQB 4UOZA 3HBZA 1HILA 4N0CD 3ZN6A 4WW1A 1CGVA 2X2IA 3LRKA 4Q8BA 3FULA 3AJ7A 3BD5A 1S9YB 4N2MA 3TS8A 2UY6B 3QJOA 4PJGE 5ICZA 4HUWA 3A6BH 1X44A 1JS4A 2JB6A 3P0YL 4MJIE 1R0AH 2ZKHH 1YAIA 2X38A 3CN4A 3CFUA 1AIZA 2YFOA 5E0FA 1A1OB 1IBGH 3TCTA 4FA7B 4XWOC 5JW4N 1IJ9A 3W9EA 3H85A 2CO6A 3QG6A 4AEIH 1D9KB 1LEKB 2ZCKL 3E0GA 5TJWK 3TN0D 4NP9A 2CDEA 3QJQB 4M7JL 1FNLA 1XGTA 1BD2A 4MA7L 4L1DA 4LCUA 1FC1A 1GZQB 2RCSH 2XETA 1F4YH 1KLFB 4FULA 4H20L 1RHHA 1KCSH 1T0MA 1G43A 2GJRA 3F64A 4PWKA 4RMVA 2CDEB 3EXJA 3OKLA 2PTUA 4KTEL 3HMXA 2FEEL 5CS7A 3QR0A 1EEUA 5CKGA 4DKDC 1VRSA 1TEGA 4E9LA 5GXBB 2WGXA 4BHUI 3FU5A 4JN2A 3EDJA 4OF7A 1RK1B 1TYJA 4NQUA 1NOAA 2WUBH 2WBJB 3JT0A 4F92B 2Y1AA 1OM9A 1T1ZA 4PLJD 2VC2H 3OXSB 1P0SE 2CR0A 2PXYC 2NQCA 1MREH 3KXFB 3QAQA 1IFHL 3AY4A 5IVXF 3TV8A 1X9LA 4X80H 3MRGB 4HJGB 4G8FA 3K71B 5H35B 1H8NA 1KXQE 4WY7L 2E0PA 3N04A 3QJFA 4PJ7E 1HHHA 5C08B 1E9OA 2ALAA 1YNLL 4NN6C 1F90H 1I1RA 1K9TA 2DYPD 5T3XH 4TPRL 4YIQB 4O2CB 5DJ0B 2WQUA 4R4ND 1L9TA 1AACA 3AU0A 5C0IA 3S35X 7FABH 2A9ML 2N59A 2YRPA 5DUPH 4ODHL 4Y1AE 1DSFL 3D1MC 3ZDXE 3MV01 2GEQA 1N6QL 3W38A 4OCSH 2NW3A 1KXQA 3IRPX 4TULH 3DHMA 3OHMB 1KFAL 4JVPA 3O6FB 4L29B 3NCMA 3T0ED 3T0EC 4YHLL 4LCIH 2MTPA 4QXGL 3L3KA 1O6TA 2DAVA 4HIEB 4LSVH 1TU2B 3N1FC 5GRUH 1NFKA 3EH1A 2D0GA 2N1TE 1G7HB 2Z65C 3PL6A 4JZOA 4G8IB 1TZ8A 5D1XC 2DMGA 2J43A 3O45A 1CIUA 1VB9A 4M48H 5TQ0H 5GS0D 1MFEL 1F86A 1KJVB 5E7BA 5I30H 3ARGC 1Q1JH 2BVEA 5BQDA 1KBGH 5E08H 5IEKB 4LEBA 3TOPA 3GMNA 4JG0H 1U8HB 1KCUL 2AQRA 1E2VA 2ENPA 1KJVA 2B3IA 2JJSA 3GJFA 1A5FL 4GQRA 3BIBX 4KKRA 5E6ZA 2RFXA 3RGVA 1RUKL 3L9EA 5B7EA 3JWOH 4NOFA 3SKJL 2OMTB 4JE0A 3NAAL 4YHYB 3NDZE 3GRWL 1B2WH 2N56A 1B0GA 2JTDA 2EKSA 1I3GH 1VFOA 5LKNA 1U8PA 2BIOA 3DOSB 3P3YA 2UWEB 4OD1H 5FCUH 5CD3B 1V7MH 4WWID 2EAEA 4WTZG 1OF2A 3AY4C 2H1PL 4JJHA 1GCFA 2G0LA 2VR4A 3VTAA 2BS8A 3VFTB 5HHOE 4DKAA 4GEJA 1IBFA 5DZNA 4FERA 3GIVB 1RURH 1XB6A 5KVFL 2HVJA 4W68A 1DBKL 3QXTA 1CLCA 1JNLL 3RNQA 3B7TA 4U6YB 1EV2E 1OTSD 1U8CA 4LDLB 3V79C 3L2NA 2C9VA 1PNCA 1KN4L 4NM4H 1VSCA 1H19A 3NACL 3G5VB 5F7EL 3GXMA 2QSVA 2FJGB 5DRWA 5EOCL 1TIUA 3FOMB 1ADQA 3ARUA 4ZUTB 5E5UB 3X11B 5A6MA 1F4WH 7PCYA 4AI7A 4RAUA 2QGDA 2X89D 5IM7B 4DO4A 4V2BA 1RIVH 4V1DE 1PJ9A 1J88A 1U3HC 4M4RA 4B7LA 1DBMH 2ZTBA 1LGVA 3LQAH 2X9XA 3FUFA 4JRXA 1EFXB 4C55A 4BIKA 2X4TB 3G5YA 2PPAA 2ESVA 5ADPH 2R4RL 2C34A 2P46B 1A9EB 4PRNB 2EE0A 3UZVB 3ECBB 3NIFB 4CU6A 3VI4E 4UIMB 3VW3L 5FYKH 3U0TB 5JW5B 3WFZA 1LL1A 5HD8D 5DI8A 1Y18A 5L2KB 4U7SA 1N7MH 4PJ9D 4BZ2H 4KH9A 4A6YH 3OZ9H 4GS7B 2V5YA 4WFFE 4UM9B 4XP1L 3OJDB 3W0WB 4P8QA 4PJAB 1I31A 3TEXA 5DK0A 1LMKA 2VUKA 3OQRA 4XNUL 2WD0A 2XPGB 4E5XA 3US1A 4QRPE 1S7TA 3KPQB 4F3FA 5ITFB 4PY8I 2ZX9A 4AGLA 4BFIA 4JPSA 4FTVA 4YSPA 5ENWA 1K4CB 1BQRA 3PFQA 2E6JA 4GUPB 3F62A 4OU3A 4V1DD 1F6FB 2CBOA 3D5OF 3FFCE 2DDQL 4PTUA 2BVOA 5KSAB 4AYFB 4FXGB 4ONFL 1SLWA 3JZYA 4TNFA 2X7LB 5D71H 4DUVA 4NZFA 1UXWA 4M5ZH 2P8PA 3O2WL 1G6RH 5GGQH 1OTUC 5D5ME 3D51A 4OV5A 2XTJE 4AK1A 3BKYH 5I1EH 4ZSOB 1A02N 1HH9B 1WFOA 1KELL 1FAIH 3EO9L 4BH7B 4HQQL 1ES0A 1GRWA 1I8LA 1KCWA 3FU3A 2YEVB 1QZ1A 1WWCA 2W9DL 5FGCE 4PREB 3FTGA 2OZNA 1NMCB 1X5ZA 5BRZD 3SEPA 5AB2A 1NC2A 2CBTA 3U4EB 5IHHA 3IMTA 4S2SA 2XN9B 2ENJA 1KIPB 2W8CA 4PJAF 3U48A 1ZVSA 2EXYC 2OMBA 3E9TA 1TNMA 3TJHC 3ZTNH 1P2CB 2NXYB 1E8ZA 4PQXA 4L4TA 3EHBB 4H8WH 2DOCA 2VDOB 4NUQA 1JN6A 3A6BL 5KUKA 4ZOBA 1USQA 4L8DB 4JEGB 3QZBA 5T33H 4N68A 4WTXA 1S7XA 4JRYB 4IOSD 3HW7A 3O6MH 3WBDA 2BS9A 4GPVA 4WQOA 2HZHA 3IT8D 4MNGB 5IK3B 3IE4A 5L2KD 4Q14A 3SPGA 4PRHB 4FA6A 3LKPB 1J05A 3EJPA 1IAII 1KF9B 5E4OA 4ZAKA 4OFDA 3VACA 4M5YH 4RGMC 3BVNB 4ZOAA 1U91A 2PCPB 1UB5B 2BDNL 2ZQKA 5F21B 3SD2A 1PLAA 4IOIB 3VFRA 2J2ZB 2V0AA 4A55A 4DH2A 4LAQH 5DO8A 1WAAE 4DIXA 4MB1A 4K3JH 1UADC 2YPVA 3ULUD 3KCPB 2J2ZA 4IS6B 3V4PH 1FCGA 2VC2L 1WCQA 2Z92B 4U6XA 1NDGA 2H6OA 4PJHB 3WJLC 1BG9A 2VLKD 3L1GA 5HHNA 4LEOB 4OF6A 1YUKB 5GZOA 2Y7OA 5BZZA 1NPUA 2BZCA 4PJIF 3NSDA 1M7UA 2D9CA 5ABZA 1PX4A 3FO1A 4XPBL 1YSOA 3MBWB 4E41E 2PWFA 1KSRA 4TPRH 5E8OB 3ZMEA 2NYYC 4U1SB 5FGRA 3T04D 4HU2A 2WXNA 2E7BA 2NSMA 4KY2A 3B43A 5SX4I 1JHTA 1MFBL 3ZTJG 1JNJA 1S6NA 1S7RB 2FO8A 2DLFH 5HGDB 1MRCL 1X5LA 2YAOA 4U1SA 1J1PL 2E46A 4J8RB 3I50H 5GGTL 1KFAH 1DZ0A 5I8EA 4JK0D 3CVIH 1FZOA 3B8YA 3QIBC 5EO9A 3D0AA 4F7MB 1MHCA 1L7IL 1XCXA 4JL2A 4JLRB 3BH8A 4JRXD 5DFAA 2BY3A 1FV1A 2R7EB 4YUEL 4DKEL 5KWYC 2WB1A 3AWGA 2VDQB 2OXHB 1MHCB 2GJPA 2N7BA 9CGTA 1SBSL 2JVUA 2B20A 2IGFL 5HPMA 3ZUCA 3SZKC 2XVLA 4L4TE 5IROC 4BFNA 2FR4B 4ZAKB 3DK2A 5LGYA 4L1TA 5TQ2H 2QVFB 5SX5H 3PQYE 4M43L 1NBZA 3KXFD 2BW5A 4C4KT 1CXFA 1OAXH 1Z9PA 1OAQH 2W81C 4EIBA 1E40A 2JKJA 2RJMA 3JBG7 1DZBA 2J4WH 1ACYH 4FFVD 4OD1L 1X6NA 1PPIA 3MAWA 2QTEA 4TMPA 2NY5H 1IBYA 1P5VA 3MYJB 3O6FD 4MRBA 5JQ6L 1SVCP 4OZFH 3GUFA 2CNZA 1U21A 5DC2A 3S97C 4L2LA 1WIPA 2BNRB 4BK5C 3MBED 2VXVH 4D9RD 4XO8A 2X9YA 4RWHA 4NQEE 2YUZA 1A4KB 3K4AA 2GTZA 2BCKB 4MDIB 3RTQA 1DJHA 4KBPA 4ODXA 1E4WL 4XVSL 4F7TA 4NKIH 5DEGA 4Y4KD 3ALPA 1YNTB 2HVBA 3QHZL 4GKSB 4JPIA 1N67A 4LNVA 3VFVA 1FL5B 4Z76A 2VLLA 4V2CB 4OIIH 2AFNA 3V4VB 2TSBA 4FNPA 5F0PB 4BD4A 5AVWB 1J0YA 1D2OA 4G80B 1LTXA 4WI5A 4W93A 1NSNL 2ATPA 1OHZA 2IDFA 2P26A 1SEBB 1Z5YD 1KGXA 1J9SA 5HDBB 4XP6L 2W80C 5C09A 3WN5C 1HYSC 3F6LA 4N0FA 3Q6GH 3BUBA 2OP4L 3ZK0A 3H3PL 3SGDH 2EADA 4R5XA 2FVNA 2ESVE 3KYOB 1NAMA 3DXAD 1NTDA 1UWFA 2PF6A 3JTSA 3WL9A 3T8XA 3QZLA 3EYQC 3VE0B 1UB6A 1EVTC 3IDGB 1J9RA 2WLYA 3BDBA 5T1LB 1F4YL 2WYHA 4HZAA 4ZD3H 1QEWA 1SOKA 2AQ2A 3IJSA 1KULA 1FSKB 4ZAKD 1TJXA 3BAIA 3VWKC 4L8CB 2BP0A 4JHVA 3GC3A 4PB0L 1D9KA 1Z9OA 3Q1SL 4UAHA 1M56B 5E1AA 5EOTB 3ESOA 4Y9EA 1KV7A 4S0SD 4Y4KA 3QRLA 4LPCA 2YQGA 4FMVA 2ZXQA 4PJDE 4JANB 4WCYH 3TU6A 3APCA 2MCMA 4MGXA 2IPTH 2Q6WA 5GGUA 3ZDZE 1F02I 3VXTA 1JUFB 3MHZA 1IFHH 4IBTA 1RXLA 3NQKA 1NIEA 3BUYA 2NY3C 2YAMA 3U9PL 5IMOA 3OVUB 1OP5H 2EVHA 5DA0B 5LGJA 3L3JA 3VA2C 3VFPA 3WEBA 5M95B 5J12B 1UGKA 5ABDE 1A1NA 1Z9LA 3FQUA 3E6FB 3LJ3A 4U6HB 5K9KA 4U1NB 3DURB 4PR5B 3K91A 3BC9A 3BI9X 5BMFH 4ACPA 3UTSD 4G9DA 4UT6H 2QLVB 1EK3A 1WZ1L 3IFPB 1BEYL 1FHNA 2HJFB 3KPSD 4HQQH 5DQ9A 3QDME 3OTTA 4B41A 5DLMH 2A9BA 5FO8B 1A7RL 2XN9D 2F5BH 2IADB 4L23A 4U0RC 1DBAL 4HIIB 3SY6A 2XG5A 2OMVB 3W2DL 1BYNA 4ODVH 3FUIA 4GUQA 1FI8C 3Q9PA 4MAYD 5AQ0A 1S9XA 1CE1L 3LMJL 1FZJB 3ASOB 1MCIA 2R39A 5EC1A 4AE1A 3IE9A 4HKXB 3IDXH 1R1CA 2OMVA 4OFYD 3JWDL 1N4XH 4HGWA 1R33A 1SHWA 3PDOB 1HC1A 2CXKA 4MD5B 5HDOA 2YJLA 5B22A 1PL3A 1EWHA 2VO5A 5J5EA 1G9MC 3DUUB 1VACA 3KH4A 2ADGA 5ANME 4G8EA 2AXGA 1XO8A 3UYRL 3O6ML 1S7UA 1KBGL 3EJZC 4JY4B 2WQWA 1IMHC 3G08A 3QJUB 2PP8A 1KJ3L 2WIIB 4F58L 3D0LA 4QYOB 1CWVA 1U3HA 2ADGB 3QISA 3EJJX 3FFCA 2I07A 5HGBA 4XCYA 3EG9B 3OHXA 2A73B 4F20A 2CGZA 1W0VB 1GMEA 4HDIA 1ET7A 1RUKH 3NCCB 3CHPA 2JKSA 2V3DA 3MRPA 4BKSC 1AGFB 3VUAA 4MAYB 1GMIA 2P5EA 2IPUK 3DK0A 4H0HB 4XN2A 5ERWA 2PCXA 3MUZ1 3Q7JA 3IS0X 1Z5LA 3I9GL 4FFYH 2R4SH 4PJGB 2WGNB 5JW4M 3F7QA 4NHCH 5SWSE 1NM4A 1U3YA 5F0MB 4RIRA 5JYMA 4XNZC 2F7PA 5F1NB 5LBVA 4BFEA 1F56A 5HI3C 2IAMC 5DGQA 1CN4A 5GIRA 1H8SA 3HOGA 1O9VA 3QUMA 4EE2A 5LJYH 3I3EA 5TDOB 2NXYD 1G1YA 1P9MA 2F19L 2WANA 1O7SA 3N9GH 3BD4A 3VGBA 5LNGA 3QIUB 4XE5B 2NT1A 1MCOH 2VDKL 3H42L 1DUZA 4YDZA 3U7AA 2K78A 1B4JH 4NKMB 2AV7B 3NIDE 5BRZB 2NSXA 5C0CA 3FCBA 2HRLA 3ZZLA 5JHDD 5CLXA 1KY6A 1QNZH 4FNLL 1JZ2A 3R0NA 3IPEA 3VQMA 3VRJA 1DVTA 1XGRA 4NI3A 4HKBB 4NO3A 4XHQA 2CKBB 5EOCH 3TESA 3LPFA 2OSXA 1QI3A 5CNHA 2EUZA 3D05A 3NA4A 1F4WL 1ZLVH 4UTBH 1ECYA 4FFYA 3NBNA 4PHZA 4X5QA 5E6UB 4W9GC 4OZGB 4AYBA 3ZT7A 4XN8A 3BFOA 1IARB 1YN6A 4L3ED 5ICZB 2BINA 4ODUB 1PLGH 1NLBH 4HJ0C 3O2DA 4OZGA 4PJ8A 2G60H 1JF1B 4G82A 3FJTA 1MF2L 2A6KA 3BWAB 3PL6C 5B1JC 4JZNA 5IOKA 5D8JH 4ZMWA 4MJIA 3VW3H 3NFNB 4WJKB 1L6XA 2PWDA 1IGCL 2EH8H 4YJZL 3P02A 2ZOUA 4JFFA 4PIRF 2J55A 2YPKB 1CTNA 5F1IB 5IB3A 4H26B 4MJIB 1SEQH 3E6HB 4M1GL 3ZHNA 1FVDA 1AD9A 5JIQA 4WKZB 3RDJA 2TRYA 2PYEE 3AT9A 5C97A 3OR7B 2ZCLH 3D08A 2AJYL 1ZD6A 3S88L 3HE7B 2CHDA 3OG4B 3W9EB 4XOCA 4E9QA 2FX8L 4TVPH 3OG6B 1EGJH 1MDAA 3L13A 2OKMA 1THCA 1NCGA 4PCTA 1NGYA 1GYUA 2O4EA 4WU5A 4Y4HC 2IH3B 4FEIA 3O2DH 3FSZA 3MJWA 4M5ZL 1EZVY 1JZ5A 5JXAH 3VI3F 1LP9E 1BVLA 3SGKC 1YEDA 2PXYA 3D2UA 5CF3A 4GJTB 4RFNB 1A6VL 1OCCB 5EUKA 5HHPA 3WO4C 2WTPA 3OBAA 3LB6C 4XN1A 3NGBC 3OB0K 4Z3IA 5F7UA 4N2IA 5KSVA 1SOSA 2BNUB 4UNVA 3FUMA 4LBEB 4JQXA 1PGRB 2J6EA 2VSDA 4FABH 4CMMA 3QZPA 5K59F 4GQZA 2P24B 5K33A 5CEYA 1BG1A 3ECVA 3LEXA 4PJXA 3HI1A 5DS8B 3RTLA 3VXPA 1MRDL 3F2LA 4PGDA 3S3DB 3VRIB 2IFGA 4NQDA 2SODB 3FK3A 4UT7H 3ESPA 5ISZD 1MW3A 3MRBA 5D7JD 1TTUA 1TT6A 2LFGA 1VFBA 2ZE0A 2FATH 1HAUA 3Q2NA 4YDIL 3MXWL 4PY8J 3G5YB 2XN0A 4ZX5A 4AITA 4OCXL 4QCIB 1E5BA 4JAMA 3RFRA 2ICWI 3MNVA 3O8XA 1T0MB 4O02A 2HN7B 2CJTA 2PP7A 1I7TB 3D39B 2PTVA 4E42B 4H26A 2TSAA 4O9HL 2GJZB 2LABA 5GSRA 3BWZA 5D93B 2HN7A 1F6AB 4F2EA 3ROLB 4PB0H 5KAQF 1Q9LB 3O3UN 3Q1SH 2N0KA 3GMRA 2BSTB 1IEBB 2DL2A 1F5WA 3VM7A 3SCMD 1FVCA 3WUWG 2OMTA 5IJVB 4J3VA 2GTWB 4DGYH 3GSRA 2W1NA 3CFBB 4K3JL 1WFUA 1M6OB 3C2AL 1BQUA 4XC3H 3SDDB 3O3BB 1KLGB 4HUVB 4X7TB 3PV6B 2AEQL 2IBZX 4GAFB 2R51A 1U41A 1RD6A 4M1DH 2KKQA 1GHFL 2DQFA 4DFIA 1EHXA 5ACLA 4JPQA 4R7NB 3WIIL 1H9DA 4DO6A 3UABA 2C3GA 5BUAA 5E24E 2DJUA 2OW7A 3G5WA 4F2MB 1AQMA 1OWRM 3SJVD 2GKIA 1E4XH 4WO4B 3TFBA 4KITB 2QZ5A 5HHNB 5CBAB 4AOFA 3KYMA 5DFWH 1PLBA 5FYLL 4CVWA 1J1PH 4LLWA 5E6IC 4I3RL 3MV7E 2D2CC 1Y0LA 4KI1A 4GW4A 1F00I 4P5MA 4YBLB 3VG9C 1NCTA 2GK2A 1FO0H 1P4UA 1UWXK 3MGOB 3BP5A 2GBUA 1DN0B 4QY8A 2VITB 1DEEB 1QX1A 1W8EA 2V6HA 2L7QA 2R0KL 3MJ9H 5KYNA 3BGMA 1P5UC 1WWWX 3VXSD 4JQVA 2WZ5A 2VDOL 4I77L 4P9HL 2L8AA 4NN7B 4WVRA 3CUPB 3R1GL 4LCCB 4X5PA 2WZPD 3BSHA 4LF3A 1S3KH 1MWAA 1OL0A 3BAYA 4G3YH 3LHAA 4PSPA 5FAAA 4QTHA 3GO1L 5CMAB 3MROA 4P2OB 5LN8A 2GC4C 3QUYC 1NCDH 4OVVA 1MW1A 2YAPA 4QAMB 3C60D 1R3HB 3EH4B 2BMKA 4K7PY 3WNNA 4EI5B 4F1SA 2FNWA 4NRXA 4AQOA 1S4IA 2H1XA 1CBJA 2VDLL 4BUGA 1J8RA 3OGOE 1C5CH 4OGAD 3UERA 1OAXL 4DVRL 5EZOL 3OKKA 1OAQL 4RGNE 2WAQA 3BZFB 1O9WA 4IDJL 1YZZA 3VWKA 5DK0B 5T3ZH 1QVOB 1GY1A 4NQVA 1AC0A 4NHCL 1BVKB 4Z0BH 4PCYA 1OCRB 2H0JA 4Y9FA 2HT2D 3OAYK 2YGNA 3C08L 5ENWB 2E47A 2DWYA 1LWRA 4RBPH 1IGJB 2UV3A 5J11B 1HZLA 2HVJB 1BF2A 5F3HA 3K6FA 1X7TA 1IL1A 2DQGL 2PCFA 2XWTA 1J0ZA 1QLRA 3DGGB 1OZTG 2ZNWA 1KC5H 3ZOAA 3CQFA 5I71C 3FT3A 5CZXC 1IC1A 2NY3D 3SGEI 5IR1A 3V9FA 5DFVD 3NFPB 2BFVH 4HF5L 4H25A 1JXKA 1FL6A 3MYJA 4IDLA 2D7TH 3B9KD 3CVDA 25C8H 2A7BA 3DGGA 3U2IA 1FVEB 5IR1B 4XOEA 5EU4A 4N0UB 5AZ2L 2JKIS 3A6OA 4GUOA 2B4CH 4OLWH 4S0HA 1FH5L 3DETC 3QB7C 4XPAL 2GJ6B 4P46B 3GKWH 4IRZL 4UTBL 4QXUL 4Y4HB 3MO1B 2MQ0A 3US0A 3GLDA 2X4TA 2VDRL 5LBGA 1ZAGA 3B7SA 1SJXA 2D31B 3SBQA 2CLRB 3NRFA 3Q44A 4PIBA 3CVHL 1G84A 4EXKA 2OX5B 5ADOL 3COOA 1J1XH 4Y16D 1TF4A 4FXKA 4P2QD 2OMXA 1S7SA 1RSFA 3RX8A 4H13C 3H9SE 1MHHB 2IXQA 4JRYE 4DO5A 1U4FA 1B88A 3B9DA 3ARDD 3SIKA 2OQJA 1JRHL 4PRIB 1KWGA 3LS4H 1EAPA 1U2YA 4MLIA 4UDTA 3T4AC 4NBXB 1EXHA 1VCAA 4APQC 4YGAB 3D3VA 4Y4HD 3VFGL 1PDKA 3RGVD 4G43A 3IPFA 4WI7A 3PJLA 3Q0HA 3WL9B 2WBWB 1WBXB 1NBYB 2UUDK 3HI6L 3LNEA 4KXDA 4JHZA 5F7AA 2HKAA 3U36B 1QVOA 4ELMF 2EIJB 2HTLC 4N90D 4IU3B 5J1AA 4AIZB 1G6VK 2C7UB 1HHJB 2J5WA 4S1RH 3BP4B 3N41B 4X6DF 1WA1X 1AQDA 1RJLB 1S7VB 1JFHA 5A16B 4Q9BA 3KGSA 2BSRB 5HHOB 3ZMNA 1Z0NA 5MERA 2HFEB 3F7LA 4BGDA 5JXAL 5I1DB 4LEOA 3KBPA 1WV7T 4JKPH 4LLQB 4ABWA 2XWBB 3MRFA 3HCVB 2VXTH 4Z8FH 3SQOH 1B6DA 5E8OA 1RUML 5BS0E 3UC2A 5D2NA 2L0DA 1MVUB 1FIGL 2XWBA 3MRFB 3P2BA 4U2ZA 5F7BA 4A66A 1UOLA 2XKNA 5I16B 3ULVF 1E6OH 5EU5A 3W2DH 1ZHNB 2O5ZL 3E6FA 3E2HB 4P48A 3UP6A 1IC4H 1YMHA 4MYWB 3UGEA 4GRLC 3WIFB 1GYWA 2X4PB 3S35H 1JVLA 1I82A 2I24N 3DGDA 3IDXL 3C6EA 1FCCA 4YDKH 1WITA 2FWLB 4HALA 3BWUC 2JSFA 4JM2B 4RFEA 2ED7A 3HC4H 4L18A 1FLTX 4IBQA 1CDCA 1ADQH 2UVEA 2ENYA 1MOEA 1K85A 1GJUA 1J87A 1UJTA 1DYZA 1S5HB 2QELA 4WO4C 3GMPA 3UYRH 5IGXH 3WIHL 3WJLA 2MJWA 4QYAA 5I2IA 2WXRA 4I0CC 3PAZA 2B1HL 4H88L 2G2RB 3IAPA 4Q74A 4H0LC 1AGCA 4FL4C 4KV5E 5GS0L 1A47A 4WEEA 5DUML 1D2PA 2Q3ZA 3NSJA 3SJVA 5TF1L 4AJYV 3FTSA 3I9GH 3TBTB 3APDA 3SO3C 1OAKH 4IBVA 4S1QH 4XP4L 4OD3L 4PG9A 4U3SB 5D1QD 2QQLH 4Y5VB 1RJLA 4DFHA 1IKFL 4EN3B 3B1UA 4WWKC 2CKBL 2BVQB 2R1WB 5BJTA 3GXDA 4ODTH 1FFNB 3D0VB 2GI0A 3GJFK 2J88H 4EAEA 4EI5C 2ADJA 3PGDB 1BZEA 1WFJA 3EUUA 3HG4A 4MNHB 2YA1A 5EA0L 4LCWB 3IDJA 5TF0A 2HT3D 3WXVL 2QLYA 3V4VH 5KS9E 3VXUE 2G9KA 2ICCA 4NHUA 4UYPA 1UURA 4AXWB 3CDYA 5KBLA 3IVKB 5SX4H 4KZCA 4JDZB 4K9EL 1Z9NA 3MKKA 4BWWA 1XWVA 1AR1C 2HJFA 3O9WD 1NLDH 1HWWA 3MNDA 1P7QA 1JTOA 3UZQB 3SYOA 3ZRCC 4RNRA 5AOKA 3O4LB 3IETB 5D7SH 4K4KA 1TO5A 2CJUL 3G04B 5SWQB 2COVD 3TNMB 1J12A 3KYNB 1I8LC 3WELA 1U9KA 1CDYA 2V5RA 2AJVL 1D5MB 2W5PA 1MFUA 1P4IH 3BEWA 4RNRB 2XDHA 4CRPA 2XWXA 3S8WA 2NCMA 3DOIA 2X88A 4GXUN 2J12B 2KLTA 1BOGB 3RUGA 4OZFB 1GSKA 1AANA 3WOVA 2V5SA 1PKQE 5IFAL 3S3JA 1XB3A 5B1KA 3SE9H 4F9LA 1VFMA 3F65A 1AFVL 4OY9A 1DCEA 3SD5A 5KVEH 2V2TB 1NINA 1H15A 5JIHA 3GB7B 4CC0A 4FNQA 4OGYH 4PJIB 4PVMA 3T2LA 3L3HB 3QDMB 4GKOA 4NYLB 5F7WC 1N0XH 5AOMA 5F0JB 2ZOTA 2CO6B 3VU1A 5AZEL 3LDBB 3PGFL 5BVJB 3FFCB 4QNPF 1JF1A 3ILQC 4TLUA 3ZSTA 1DLHB 5I1KH 4M8QA 5C0NC 3BGAA 2CXGA 2XIIA 2GHWB 3FW6A 3BO8B 1RZJL 2ZXEB 5ESAB 2BWDA 4JDTH 4XVUD 1VIWA 5IBLC 1OB0A 2XC8A 2XRAL 1QFUL 4PG9B 1E3FA 3ULVL 1KIQA 1H3WM 3G6JE 1HXKA 3TTYA 5BXFA 2DQDH 3GXPA 4JKWA 2AK4D 4YVNA 5ESAA 1CR9H 4L37B 1AH1A 2VJ0A 3QXVA 4A2HA 3UJIL 1D6EA 1IC5L 3M7FB 2D7OA 2GAZB 3ARFC 1C16A 3U0WL 1VKXA 1N59B 1TJIH 1JZ3A 3EYSL 3DTXB 3N41F 4L2YA 2EO1A 1T03L 4JFPA 3GNML 1A6VH 2OMNA 4N2BA 3B2UC 3LS5H 1SJHB 4G8AC 1JK9B 4JG1L 3VFVB 5FR3A 2QGCA 3IU4H 3PFUA 3QJFB 3RRQA 1AP2B 4XODA 1LD9A 4EI5D 4JFWA 4NZUH 5CGYC 4XO4A 1L7TL 5DQ9B 4OLWL 5E1IA 5TPWL 1SY6L 2R9HC 2UZXB 6FABH 3OV6A 4XMPL 2FYYA 3BKJL 1RZIA 3AS0A 1QSFA 5LAXB 5L0QC 2VN3A 3CDFA 3S36L 3FF8A 4YGVB 3D3VD 4MNGE 2FBRA 5FYKU 3SDCD 1W6LA 4A7UA 4ZXBD 3RKDD 1A4JB 2V7NB 1VPOL 4JFEB 5E7FA 4A39A 4ZOCA 3MCKA 2Y7QA 4AQAB 4XBEH 5CEZD 3ZO0A 1EMTL 4F7PB 2GSIA 2WYIA 1ET5A 1MIEH 4WNQA 4YDIH 2DD8L 1BFOA 4NQDE 4CSTA 2QQKL 3WDJA 3IJ8A 1KCRH 2XNAB 3FS9A 1CJYA 5B8CC 4LRNL 1G7HA 3PL6B 2HB0A 1NFIA 4JZOB 1S7UB 3R7RA 5CAYB 5L9DH 3LS4L 3G08B 1CFQB 4O9HH 5D2LB 4EZLA 3L7EB 3GSVB 4WDIB 3DTDA 1KTLA 3DPBB 3BO8A 3HHMA 4YPGA 3PDOA 4UMSA 4JM2C 2OR9L 1WWAX 2I85A 3HI6H 4OSUL 5DUBA 5DJDB 3N6YA 5B38G 3OR7A 5I0XA 3QEQA 3FQ1A 3RVXD 1JNNL 1M6UA 1YY8B 3BH9B 4JPWL 4K7PL 5EWIL 1WUNT 2CHNA 2FBOJ 2JJSC 3KLAA 2Y69B 1EHNA 1QPPA 1Z9SA 3QP3A 5ABAA 4U6VL 4ZPTA 4OVUA 1ZTXL 1BVOA 2DQCL 2I07B 3OLDA 4X5LA 3X17A 2Q8AH 3ME0B 1DQDH 2DH2A 1L3WA 2Z8VC 5TDOA 4Z7OE 1OTSC 3SCMB 2FGWL 5F9AC 2X1WL 1ODUA 3FN0H 1HXYB 3N42F 4JFDE 3FSAA 5DFVC 2WJ7A 1DUZB 4PLNC 2GI7A 3UBXI 1EXUA 5DHXB 4X9YA 4TUOB 1UWYA 5FYLH 3GBEA 1MFMA 1EJ6A 3JWNC 4D7PA 3H55A 3N06B 5GIRB 4TVSa 2ZUVA 2IANE 2R83A 1CTOA 2Z93A 2ITDB 5AW3B 3FQNB 4IKKA 3LRLA 1IQDB 3LH8A 3CDGB 5C0AA 4UTCA 4YZFF 4HIPA 3RA7L 3EDEA 1NEZA 1FL3A 5HDRA 5JLZB 1QUNA 4XMLL 2D9QB 4U49A 2R29A 2FJFA 3QVAA 4OZGE 3QS3A 3MOBH 4AW4A 1MW0A 5HGAB 3OZKA 4YHKL 3FF7A 4QRBA 5D7KE 2MTAA 5C0AB 5FHBL 2A9NL 2RA1A 1I1AC 4K3DL 5LWYL 4W9ZA 3Q8BA 4EUPA 4JB9L 1WD9A 3CFDB 1PD1A 2LLLA 4Y19B 3PWPE 4N2DA 4PP1C 1FYTA 3F83A 1ZVHA 4AGPA 3MXVL 4JMXA 4Z7AA 4E42A 3DV6A 3KL3A 3S36X 4PJBF 3X14A 3IWVA 2OA9A 1C5CL 3FMGL 4S1DC 3OWRA 3T77A 5IW3A 4QTHB 4DVRH 4TUJB 2WYZA 3CN2A 4QRAA 1JZIA 1EA9C 2UZPA 2YMXH 3K2UH 3QBTB 3N85L 5DURD 4UT6A 1TU2A 4DP8X 1BX2B 5JA8B 4L9DA 1XBDA 4W9DC 4WTWA 5B39G 2ZF9A 3KM2A 1G4RA 3DX8A 2CKBH 4NXKA 4PMFA 3GEFA 5IEHB 1GZPA 2WMPB 2WZ0A 3CSTA 3TO4B 3VWJA 1WT5A 3ZE0F 3T0VA 2IH1B 2WVTA 3ZHLA 3MKGA 5D7IA 1OSYA 1AQHA 4L48A 4OFIA 1PU0A 3GS7A 2BFVL 2DKUA 4WLCA 4TVPD 2XT1B 5I73B 4K9EH 5BQ7B 5BV7C 4K5LA 1KBWA 3OKEA 1HS6A 5I1HL 1UCBH 5E0QA 5DJCB 3V7MA 3L5WA 3NIGF 2O6FA 2APFA 3QYNA 4ZSOA 3UDWA 2A5UA 4XPAH 1FYTD 4S1SH 1MJ7L 2D7MA 2Y9RT 2Y0SA 5FUZH 4L5FE 4X83A 1LE5B 1T5KA 1S78C 1UKTA 5HHMD 1X4XA 3VXOA 1VFAA 3LHPL 1WFNA 3WNPA 3GIZL 4LLDA 1PZ5A 3J7HA 4W9IC 4K55A 4MDJA 4KY1H 3CSPA 4G6JL 2X2YA 3PABA 4LCCC 4PJ6A 2YJQA 5MP6L 3MRIA 2CM5A 2V9RA 1H9VA 2V9QA 3PE9A 4FQ1L 4OLEA 1FYTB 5D9SB 3THML 4DZ8B 1CS6A 1VZHA 2D3JA 1CB4A 1CTMA 1HWGB 1UM6L 3O4LE 3C6SA 3K4DA 2KBGA 4IEFA 4Y19D 1F4XH 3N0PB 5CEXB 1XGPB 1YG9A 1U6AL 2WPGA 4YHNB 4YAQA 4HC1A 4QRPD 4RSVA 3OLEA 4TVPE 4BELD 2CO2A 1KJ2B 2G2NA 4IKNA 2F5AL 2F53B 4GI6A 4KVNH 2R2HA 1BX2A 4F9LC 2VXUH 1XIWA 4GIAA 5LLIC 1NC4B 4QRRA 4GQ9H 2IH3A 2QSCL 4BV1A 3P11H 4PN6A 1JPFA 4IMKC 2KERA 5F0LB 3E8UL 5E5RB 4OKVA 1UEMA 4D3CL 4KKNA 1SHSA 3KS0H 1L9NA 1EDQA 1ZJAA 3MLZH 1HHGA 3SDDA 4EIZC 3M17B 1T0NB 4KUZL 4TQPA 5H37A 4TLSA 1AVAA 3GI9H 5E4IA 2H6PA 4Q2ZA 4KO7A 4IYKA 5B39A 4GXVL 3AM8C 2VQ4A 4LXFA 3L1EA 1ZLWH 5IB1A 3QARA 3V6BR 4WEBH 3BT2L 4WSKA 4LL9A 2BNUA 4HIHA 1KXVC 5MEOA 2XWJB 2AJUH 3MRKA 1DVSA 2V2WB 4OJCA 4QRTA 4HJJH 4YFLF 4NZUL 3EYUL 4CBPA 2ZUUA 2Y6TE 1NKGA 2MSPA 4YSOA 4P9MH 5DZLA 4HS3B 1YJDH 2VDNH 1IC4L 1JZGA 2E9BA 4AQEB 1MCQA 2HYMA 3VGAC 5F96L 4O5LL 3LV3B 5AYQA 1B3JA 1XGYH 1DQVA 1JZ4A 5F7MC 2BH0A 2XTJC 3ARDB 4HETA 3OJMB 4WGWB 4MBOA 1K5WA 4J8RA 2VDRB 2NY2B 2FRGP 3CXHJ 4O2CA 5CJQH 4AYFA 4OLUH 5HGHA 4URTB 3HZKB 3N0AA 2W0LA 1KTDB 1A6TA 1SPDA 1BQSA 1GAFH 5HJ3A 2AGJH 4NDMB 4FNRA 1FV1B 1PY4A 2JQAA 3GBML 3QA3A 4WI3A 4AYSA 3IU3B 4IEFB 1SUHA 5CJ8A 5A2IH 3KJ4B 1F11A 1CQKA 1UA7A 4PD4J 5FOBB 1UZ6E 3MGOA 1HL9A 4M7ZC 3T2NL 4X4MA 5IJVA 1KB5B 2HH0L 1SDYA 3IU3A 3C09C 5JXEA 2GIMA 4N24A 4OJFH 2QPDB 3DVGB 2Y24A 1M1XB 5FECA 5I15L 1ZT4A 1Z32X 1KB5A 3FCSB 1HZHL 3ULUL 2OLDA 4DCQA 3NZSA 1REIA 4XP4H 5IW6B 2VLKE 3I6LD 3CWGA 5ANMB 1TZHB 1AGCB 4F93B 1U91B 1UA6H 2D7QA 2PCPA 4JFZL 4FLRA 3M17A 1OSZA 2YQ3A 4F1ZA 4ODTL 2CO3A 4MA7H 1E43A 3CMGA 2BVOB 1TJHL 2G30A 4XCCH 4MYPA 3O4OC 4J2QA 4H5SB 5DJXA 2ADFH 1Q0YH 1TQBC 1TQTA 2DMHA 3KVPA 3FTZA 3MGAA 4DEWA 4OGXH 2W9EL 4UOW0 4XMTA 5GS2H 5IF0A 1XXFC 3KGUA 4WWPA 1ZTMA 3WKMH 4JHAL 4NNYB 3QS2A 4HOXA 2NY7L 3ZVVA 2KZ1B 5D7LD 2MCAA 4JZJC 1AKJD 1UWEL 2EIZA 4N2OA 1GC1H 5EC2A 5HI3D 5D5MA 3B1TA 3OX8B 1NFDE 4N6RB 1S9VA 4DPRA 1WZKA 1OT4A 4IS6A 2JQMA 1KIPA 2PCYA 4KROB 2WQSA 4KRLB 3RA7H 2ZXBA 3CHSA 1K5NA 5F7NC 1AZVA 5KSBB 4XWGL 1MQ8A 4FQJL 3IF1B 4GRMB 4RMSA 1KEML 3PHQB 1E8WA 3WHXA 5D1ZI 2XQYK 2A9MH 2CK0L 4Z7WA 1QD0A 4OF3A 1QTSA 4I87A 3MBXL 3L4UA 3SE8L 4OCSL 4IRSA 5AKVA 4MNGA 4WIQA 2AI0H 3CDZA 1WCBA 1XSOA 3TT3L 4TSBL 3QQDA 1NOLA 2A74C 2EYTB 3PGFH 4YXHH 4UTAL 4HS8H 4PW4A 5E6RB 1X5JA 5IQLA 4YXLH 3QFGA 1NKRA 1R3JA 3HE7C 3LYRA 5J3HD 1J0IA 5DA4A 3ARED 5LHDA 1W0WA 1L9MA 3VGHA 3X2QB 5JO5B 1KIRB 4I5BA 3SJVB 3U36A 4Z1PA 5IG7B 3KLSA 1A9BB 3EOTH 1TTGA 2GITA 3HNSL 5F7KC 3KL5A 4FNSA 4MVBC 2X9ZA 4WWKB 1BZ9B 5GISH 3B83A 3B9EA 1AI1H 3BDXA 2YAQA 1KIQB 4FI6A 3INUL 4TSAL 3U79A 5F89B 1T03H 1OEZW 1KPUB 2E4FA 1OALA 5AVVB 1QR4A 1UOKA 1B2WL 4Z77A 5C0DB 4BFIB 5DMIL 2C7UA 1ILUA 4X6CA 1RHFA 2W88A 2P45B 4KJYB 3GSXB 1QMUA 1GYCA 4KJQD 1AR1B 1HDMA 5KSAA 4R6UA 4Y8AA 3ES6A 2IMNA 2PR4H 1VJSA 1BEXA 4PEEA 1OP3K 2BWQA 2X6MA 3OF6A 2CDGA 4UOJA 3U7WL 4A2GA 2BSSA 5LGKA 4PJ9B 1L3NA 4PV1C 4DPAX 1QPXA 2G5BA 3IDMA 4KTDH 5GRJL 2DIBA 1JWMB 2OTUA 3T3MF 3T71A 5IUCA 5JHMA 2MQCA 1B2YA 4X6CE 1ZKAA 1S5IL 1ODAA 4LFHG 3D7PA 1ORSB 1ETJA 4K07A 4HWEH 2AJXL 2BP3A 1EZVX 1I8KA 3NJNA 1A2YB 2IG2H 1WUZA 3KEHA 1KZYA 3NACH 4WW2C 1U8QB 1WIOA 4QXTB 4YHIB 4R96B 4D8PB 1QLEH 3L54A 2VJXA 3CHOA 4PGCB 4X4XB 1QLFA 2PWGA 1ZV2A 1RIVL 3HHSB 3A4EA 3UFIA 2F1AA 2APVA 4B5ZA 3VXME 3HZYA 1WSST 3LQAL 4NQQA 3CZGA 2F61A 1CICA 5B1BB 2Y7NA 2YSTA 2F5AH 2CWRA 1K3IA 4LCWD 4CILA 2HRGA 3BRDA 4QO1B 4XCYB 3DX1A 5ADPL 1QA9B 1MCDA 4DEPB 1KIUB 2NZ1A 3C8KA 4GQ9L 4K7PH 4PLKD 3V4UH 4AGNA 3SDDC 3TCXA 4LU5L 1W8NA 4XC1H 4TL4A 4X4YB 4RWYL 4KJWC 1UFGA 2AEOA 3EYVB 5ERWB 4XN9A 5LUMA 4EDXB 1U58B 2B9AA 4EN3A 1YN7A 3DIFB 4C83A 1KCVL 3QSKB 2H0EA 1PMYA 2Y7SA 2I9TA 5JW4Q 4P3DB 1XZ0B 5E6IA 1N2RA 3RL1B 2ICWB 5E8NB 3RPIA 2CIKA 2AJUL 2HG5A 3LXUX 4KTYA 1B3IA 2WZPA 1E27A 1MEXL 1V7NH 2VL5A 5J7CC 3ARTA 4N25A 4R4NC 1I8UA 4S10A 5E6IB 4P9ML 2BO0A 1GSMA 3GLAA 2ZAIA 3G6DL 3K4ZA 4RAVB 1RJZB 2YMOA 1TG8A 5L4IA 3IMRA 3O4LA 1FF5A 5GGSA 1CICD 4X7DC 4D0BB 1ZXKA 1KLUB 3OL2A 2XY2A 4GEIA 1MCCA 4RISH 2PP9A 7FABL 1H6EA 1WWBX 2L04A 1KACB 1GAFL 4P2OC 1M2VB 5E8EB 3UO8B 1C08B 3EW3B 3PLYA 4LCYB 4RMBA 2VMJA 5F6HI 3KMDA 3HHSA 2BSBA 2A77L 3P0VH 4U1HB 2Y5EA 3T0EB 4M6ML 1UYWL 2CGYA 3FCGA 4KZDL 3A3YB 2BP0B 3V6OC 5I0WA 5GRZA 1FORL 4Y5VA 3UROR 3V2AR 1A22B 1OGAE 2K9UA 5TQ0L 4F7EA 2Q8BH 1HK6A 1QKZH 1JGVH 2BJMH 2NNRA 3ZE0E 5T3ZE 4A7GA 4ZO9A 4DPCX 4XMXA 4HFWB 1R3LB 5EORH 1HCFX 4G1MB 3GJFB 3A6CH 4LBAA 4GLRH 1KGCD 5DR5L 1VACB 2XVGA 5C08D 4CNIA 1INQB 3BD3A 4WHTA 5AVYB 3MLVL 1Q0YL 2VDPH 2XSKA 3PJNA 5F7HA 3BLPX 1XF2B 2WJ5A 3B9KB 3DROA 5D2LE 4OGXL 3NEOA 2F15A 4PMEA 4KJPC 3VXNA 3OKDB 3ARYA 3EYFA 4MHHG 3VGGA 3VWJB 1X6LA 4Y5YA 2NY7H 4D0CB 5HJBA 4HUCA 4X8GA 2DQHL 1JNHB 4MD4B 2JCWA 3NQIA 1MIMH 4KRPD 4WI2A 4NSKB 1DE4A 2DKMA 4KROD 1N18A 1BD2D 1EAJA 2EC9U 4XVJL 1N59A 2VN4A 1LO4H 4UM8A 1CFBA 5H4ZA 1N19A 1LQBC 2R69A 3LEYL 4NENA 1JRHI 2YIHA 2HFGH 4N8UA 4OTXL 4PU2A 3RPBA 1MJUH 1BM3H 3LHPH 3ZBMA 1HWHB 3MCKB 5DD5L 1ANUA 3HI1B 4LASL 5AOZA 1H3PL 4XNAA 4ZUSB 5MP6H 2WNGA 4BFGA 1A3QA 3MRJA 4AYMC 4P57B 5FUCE 4PJEF 5EF0A 1DVZA 3CFJA 3SDYH 3WEOA 2XQBH 3V4VA 4FHJA 3GLZA 2AI0L 5MEQA 3JTTB 4U1MA 1MAKA 1I3RB 1AMXA 1WA2X 2DLEA 1BP3B 1U3HB 5TD4A 4UTAH 2GUYA 3RZCC 4RDQF 2VN7A 3RIFF 4X6FB 3LQZB 4F5CE 3GMQA 4YUEH 3AUVA 3HG0A 4QRRE 2P5EB 1PFOA 5T1DH 4HPOL 5EO0A 1FN4A 3P4LA 5AAWC 2YD8A 2YXFA 2KZKA 4P2RD 3WKYA 1AC6A 1Q9LA 1SXNA 4U3CA 5F1IA 1VKXB 4ODSH 4HH9A 2WBXA 3WDHA 4XX1E 3BZ4B 3CFBA 3QJRB 4TNGA 3G5ZA 3MV9E 4BZ2L 4JFFD 2CK2A 1P84J 4DTGL 1JZ6A 5KVDE 3ZLQC 1ZDSA 2Z9TA 3GM0A 1SDDB 4GXVH 4NNPH 4BGLA 3KW8A 2L7UA 1GPOL 4GMSH 3G5XB 3SCMA 4NB7A 2UZXA 2AVGA 3GK8L 1EERB 5B21A 5AZUA 3RWIB 2HTLD 3NIFF 4YWGL 1TTCA 3CK0H 4ZO7A 3EYUH 5D7KD 3LSOB 4ZPTB 1NBVL 3IDYB 3HE7A 3HRZB 4CMHB 4CN4A 5FGSA 4EKJA 3KAAA 5T1LD 1VZIA 4K71C 1ORQB 4MMXC 5F96H 1Q38A 5BUPA 3DSNB 3SYQA 1N26A 3U7WH 3DX2A 4PJ7B 4UINH 5C0GB 2F74B 1NGQH 43CAA 4DVBB 5KG9A 1YMMA 2IAND 5CJQL 3UCRA 2KPNA 4G9DB 4JKNA 5EIIB 1A6WL 4XVSH 5KVMC 3S34H 1MJJB 1K3ZA 4PREA 1CFQA 4PJ8B 1DUYB 3HA0A 2IO5A 5F7LB 5E70A 1IJNA 4HEPA 4HZLA 4U6TA 1AD0A 3UO1L 4YDMA 1CGUA 1OXYA 2FB4H 3UACA 1HE7A 3N55A 3EXLA 5KS9B 1U3HD 4NOBA 3QIUC 5CCGE 3BVDB 2HH0H 3BOVA 1AS6A 1A6TB 2C4XA 3BP7A 3MCG1 5CSZB 3ULSB 4Z7VA 1J9QA 1YY8A 4MA1C 5DK2B 2XOTA 3F6JA 4W4OA 5E5MA 5AD0A 4J1UB 1NC4D 2IV8A 3V5HA 3ZX1A 2VRAA 3RWCB 1Y7VA 1JP5A 3ULUH 4U7MA 2SEBB 5J89A 1NUFA 2VRKA 3T6ZA 4YMPA 5JZ7C 1LO0L 2X09A 5CD5C 1TVBA 3D0LB 4JFZH 3A4DA 5EDSA 5CZXD 3WO3B 3CPLB 3DV6B 2WLMA 1TJHH 3F7YA 1FYTE 3H1ZA 2NW2A 4R4FH 3MBEA 1D3CA 4ENZA 1M9WA 3PWUA 5CP3H 4FQHB 2KQMA 1IEHA 1Q0XL 1EBPA 3IJHA 1II4E 5CEZH 3GT6A 4MMYA 1HIMH 2JB5L 4DESA 2PPDA 3MMEA 1E4KC 5I8KH 2ZOLA 4UB0H 3MJ7A 3DVNA 2ZUQB 2OTWA 1ORQA 5I1JL 2KS0A 1FL3B 3K8LA 1QFHA 4NM8L 3VD5A 1JDDA 3NJLA 1XT5A 5EBLB 4YEEA 1BPVA 1N10A 3OXRB 3CZSA 1LNUB 3E3QE 3MQIA 3QFJD 4QI3A 4CVUA 1G9MH 3KXFA 3D25B 1E9QA 1G7LB 2AITA 4K2UL 4AM0A 3NEXA 1B4LA 2VDLB 4PRBA 4FADA 3CBJB 2C7FA 1IGTB 4Z9KB 4UQIM 2O61A 4OQ1A 1EJOL 2GBTA 3NSYA 4UT6L 3I9AA 5C0CD 3BVTA 1T5XA 5D4IA 5HYJA 3DRTB 1DQTA 4G59C 4KHTL 3ZTDC 1D7CA 1QSEE 4G7VH 5HTSA 1A3LL 3L16A 4F5CA 1XGZA 3BZDA 2WWOA 1MFVA 3MOAL 1ZA3A 4NFCA 4JO4L 3LMJH 2HKHL 4PV9B 1I7TA 3RVUC 3ZZSA 1A6ZB 2PLTA 4ZUVA 1E28B 2J5LC 1WFIA 1Z6JT 2NQDA 4GG8A 3NN8A 4M6MH 4P59H 4UIKH 3W5NA 1G7PB 1AE6H 1F41A 1U3JA 4NQCB 1C12B 3RAJL 3WAJA 4J6RH 3RNKA 4NRYB 3GSNA 1QKZL 1J0HA 2BJML 3DX9B 4V33A 4Z7UB 1BZ7A 3MLYL 1WD8A 3DX4A 4EI5A 5T1KD 2Z91B 4FD0A 2B16A 1MZYA 4U1GB 5F2FA 3F04A 3ZL4H 4POUB 2H8PB 3O11A 4KTGA 3QFJE 4XN4A 1U8LB 3ILQD 1BZ7B 4XXWC 3O3AB 2A1WL 2C8NA 4GAYB 4Z7OB 4KAQH 1CLVA 3NCEB 3NCFB 3O4OB 3UIYA 1F4AA 2HFTA 5BUGA 1T2QL 1I7RA 2EUWA 5AKSA 4W70A 4Z7QE 3J8F7 5HVWA 1TTAA 4HIHB 4X9IA 1CE6B 1QW8A 2J6EH 2KC0A 3ZKNC 2NX5A 5DMJB 3I9IA 4DP9X 2Q9OA 1FIEA 4LLWB 4UV4H 3OXRA 3V0EA 1HHGB 2NX5E 3VXOB 5LXGL 4UT9H 4CADB 1I7UB 4X9FA 3UADA 4C54A 3NSFA 2VR7A 2XFGB 4G7QB 2CAKA 2GCYB 4AL8C 5L8KB 4KVCH 1FVEA 4MFHA 3HE6D 2BSDA 4FJYA 2X4QA 7TAAA 5GZND 2VDKH 3H42H 1WHOA 1DVFD 4PI2A 3H9SB 2F7QA 5E9DD 5KSBA 1HDMB 1JPTL 3EFDH 4QRTB 4GRMA 2GG1A 2YC1B 1ZGLM 3BP6B 1FC2D 2NY4C 4FNLH 1H3PH 2OI9C 5AWNH 4OD2B 2XZCH 4KJPD 5T5FL 1PQZA 2FLMA 3DLQR 4ZFFA 4YAQB 1KDJA 4N9GB 1ZK9A 1CGTA 4M7LT 1G1OA 4DN4L 4YEFA 1S5HA 1CU4L 4JRYA 4PTTA 4ZMOA 4R7LA 2MHAB 3ELQA