5I0XA

Copper-bound m90i variant of uropathogenic escherichia coli strain f11 fetp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
153
Chain Sequence
MGFKEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPIVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
publication title Metal-handling and Receptor Recognition by FetP and P19 from Uropathogenic Escherichia coli and Campylobacter jejuni
rcsb
source organism Escherichia coli f11
molecule tags Metal transport
total genus 26
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5i0xA00
3NRPA 3NRQA 5I0VA 3PJNA 5I0WA 3LZLA 5I0XA 3LZPA 5I0YA 3LZNA 2O6CA 2O6EA 3LZQA 2O6FA 3PJLA 2O6DA 3LZRA 3LZOA
chains in the Genus database with same CATH superfamily
5D7LB 3WHE1 4WNSA 8PAZA 1UM6L 5ICYA 1BXVA 4WW1A 5A1AA 2R15A 4ZUSA 2NXYD 1KXVA 4H0HB 4QRUA 3ARBC 3JQOB 3MNZB 3S3JA 4HS8H 4FQCL 1X3DA 3F84A 2W60A 3T2LA 3ERXA 1YEIH 1SVZA 3LEVL 4BE6A 5IQNA 1PZDA 3RPKA 1WS8A 3BPNB 1YYML 5AWNH 2I9LA 3UACA 3KW7A 3HG2A 2O30A 4IGBB 3SKNB 4LLVA 2ZD0A 2NSMA 2NUPB 2OXHA 3APFA 3MNMA 1RD6A 3BAIA 3TGXA 1JNNL 3BDBA 1OTUC 4B9CA 6FABL 5LB1A 1X7TA 4ZODA 1GYVA 3MUHL 2VAAB 1FAKT 4OCSL 1OAKH 3CDZB 3NDYE 4M3KB 4DF9A 5CEZE 1QLRB 3N91A 1KCLA 1MPAL 4YDIL 4BJLA 5DUML 2MPAL 5I1DB 3LVEA 4FA8A 4HUMB 1OGAD 3ZMRA 4JDEB 5F9AC 2BVEA 3IEAA 1OWWA 2O5NA 4U2ZA 1TVHA 4WI0B 3EFFA 3ELQA 3II1A 4XXWA 1YEKL 3FCTB 1YVLA 3FQYA 3PIQB 5KG9B 4D94A 3SSGA 2FIKA 4X9IA 5L9DH 3VW3H 1PCSA 3EUDA 3EYOA 3JWNG 2YMTA 1RUMH 4HH9B 1F1AA 1CD1B 2QQQA 1EFXB 5BVJA 5G4NA 1I8UA 1MRFL 1J05B 4K71C 5H4YA 3KG5A 3MPCA 3F65A 3G5YB 5EOCL 2IDQA 2COVD 1O7SA 1J86A 1EAOA 3FT3A 2R1WA 1OAZH 2QPUA 4XMLH 3ZL4L 5I0YA 4WNJA 1MG2C 4LPYA 3DOSA 2QHRH 4OLEA 4K94H 4P23D 3BKYH 1U8QB 43C9A 3KVQA 2CO6A 1A4BA 4AQ8C 1XCTB 1HSBA 1S5IH 1DFBH 3WKPA 3TIEA 2EC9T 2GAZB 2Z65C 3MO1A 4NJ9H 3VG9B 4Q52A 3GSRA 5HHNB 3PGFL 2P45B 1A2YA 1HTYA 1KTKE 1LE9A 4HS6A 4AQAA 4P57B 1N6VA 1MG3C 2DLFL 2XTLA 2QSTA 1CF8L 2YWZA 3F6JA 1XSJA 3S35L 2WB1A 3IFLL 2FEJA 3PJSA 2WWNA 4KK5C 4F7KA 4F7TB 4BYHA 5HDLA 4Q4IA 1GHFH 1CFNB 1B3JA 1FC2D 1F45A 4PJCA 2QQNH 5D1XA 3OZKA 3C60D 2DQTH 1JTPA 5DK2B 4BFFA 4P2RA 5CCHE 3BVXA 4ICXA 4KKZA 2GSIA 4BFEA 3MLYL 3D2TA 4NQVA 2X4SA 1CGWA 5IVZA 4OCRH 4JGMA 4XVTL 1UQSB 1FE8H 1G5GA 2FB4H 4LHJB 4AXWA 4IRSD 1Q1JH 4XXCA 5ELIA 5FA3B 2VDML 4XODA 1AJ7H 2VZVA 3GDBA 3QCTH 3QDMD 4IMLB 4KO9A 3RE0A 2DJMA 3IDIB 2DBLH 4PW9A 1INEH 4ELMA 3IGUA 3OQ3B 4NZDA 1CFTA 3V0JA 1P2CB 4XVUD 1CZ8L 3AM8C 1YN6B 4R7VA 4JZOB 1U21A 1K8DA 3IN2A 1LO0H 5DJDB 3BP6A 3T0EA 2CDGA 2YKLH 3CFCH 2I5YL 4WJKB 3UDWA 4FLOA 3VE0A 4V33A 2V9QA 3W3BA 2WYHA 3FC8A 5D1QA 1QA9A 2PCPB 2B9BA 4DK6A 5K1NA 3UPRB 4R7NA 2WZPA 3BSGA 3HG4A 1NDGA 5SWSD 4AIEA 2O5YH 3DSFL 2ICEB 4PJBF 2FSEB 2G9HB 2ZF9A 4OGAC 2G3XA 2QGDA 4DETA 1OPGL 4H25A 5AAWA 3KWXA 4P59L 2VZOA 4C56D 3U4EA 1BLIA 1A7BA 4QHNA 4XMZA 4C4KO 4TTDD 3I3EA 2NNAB 2VLME 3DGCR 4P8QA 1VFBB 3BPCB 2YK1L 3KNBA 4AT6B 3GSUA 3MYZA 3Q2WA 4JZNA 2DL9A 1ADQL 1UJ3B 3KXFE 4PRNB 4M8RA 4OZHB 3BP4B 1T04B 1BECA 3L5XH 2DYPD 2WVVA 5DD0H 1TF4A 3WL9A 4OM1H 5DJXA 3LOWA 3ZYZA 1IIIA 5LJYH 2XA3A 1ZA6A 2BOCA 1AE6L 1E43A 3G5ZA 1A1OB 4PGCA 1OP3K 5GGQL 2C3VA 2KT6A 1ZMYA 4G59C 5EIVA 5GPRA 3R8QA 1IKOP 1DVSA 1G6RH 2R56H 3LKOA 3LKQB 2OSWA 5A7EA 4KOBA 1NFDF 3NZ8A 4JREC 3GSWB 2JLPA 1Z3GL 3WIHL 3ARVA 3H9SE 4J8RB 1PS3A 3QNZA 3SKOA 2OMVB 2X88A 1ZDQA 3S36X 4UWQB 3GXIA 3GLZA 3I2CH 2BSCA 3FPYA 3X3FL 2PW2A 4WJ5A 5K39B 3MXWL 4OZFB 1YQVL 2H2SC 1R3HB 4HEPG 4XI5D 5I5JA 2VZUA 5JR1L 2O5XH 2NZ1A 1PCXA 1YSOA 3IVKA 1M9SA 4QAWA 4DKEH 1CU4H 5IJDC 1LMIA 4ONHA 1L0QA 1U92B 3D69A 4G9FB 1O7DC 2OX5B 4KROB 1OF0A 3MREA 5B7EA 1B6DA 3LKPA 4XNAA 3L9RB 4P46B 4XVJL 2HG5A 1QHPA 4Z95H 2O6FA 4I77H 4DCQB 4QXUL 1J9SA 4AL8L 3PCYA 3A6BH 2EKSB 3WEMA 3GMNB 2H47C 3QYNA 4I18B 4LOEA 1FZKB 4NC1E 4KXZI 3KPTA 1PKQE 3ISWA 4P5MA 4OKDA 3S88L 1T1YA 5CEZD 5IVNA 2YD0A 3KLLA 4MAYB 3W1ZA 4HEME 5D7KE 3RZCD 1PFCA 3QQ4B 2VDKH 2DD8H 3MRKB 1GGBH 2HA1A 2EVJA 3QPXL 3FB8B 1NCJA 2NCMA 3DBXA 1H9DA 3WSQH 3X12A 4ZXBA 3MBXH 2VXUL 4N2FA 1N8ZA 1Q9LB 4OLUH 1N3NA 5LGHH 1MCBA 3ARPA 4XAWL 2CK0H 2AXFB 4DGUA 2IIJA 4E9SA 3WFDH 3BGFC 1C5BL 1ES0B 5FGBA 5D7JC 2G5RA 2P5EA 3IFOA 1PEWA 5JW4M 2ITFA 1Q94B 5EHFA 3SBQA 1OB1B 4WUKL 5LLIC 3MRJA 3T3MF 1P4UA 4HCRA 3PQYB 5GQBA 1KELL 5D5MA 2QVIA 3O8XB 3L1OL 1CE1H 4CU8A 1UOWA 4HPYH 3VFSB 4M61B 4YBLB 2BDNH 2VW4A 4BK4A 3OGOE 1E8YA 3ARGA 5EBWA 5JDSA 4AH2A 5IROC 5IVXF 2Z3FA 2DY2A 8CGTA 1BQHA 1P5UA 5FHAH 3BZFB 5GIRA 1W72A 1OAYL 3QISA 3FO9B 3RIAK 5CS7A 1I8AA 1INQB 1UKTA 4PGDB 3O4OC 3AXLB 2ARWA 3VFTA 5ERWB 3D2UD 1VKXB 1JV5B 5I0XA 1O6VA 2HPOA 1S9YA 1T22A 2JKTM 1VEPA 4A2FA 5J0BA 4M6OH 3PABA 5AW4B 3EYUL 5ISZB 4UOW0 1NC2D 1U3HB 1SEBB 2EE2A 2IAMC 4HPOH 2VDLL 5CXPA 2QPSA 2DQEL 2R0KH 1NSNL 2V5MA 3FSWA 3OBAA 2DM2A 4YK4C 5CKGA 3OKEB 2QDVA 1LO4H 4LNVA 3VVVA 1RKRA 4YFLI 5GRYA 5J6HA 5KSUA 1TYEB 3D25A 3HNSL 3G6AA 1NAMB 3IDYC 4RAVB 1WAPA 4KJYB 3ZQWA 3GI9L 3HLAB 3RWEA 4Z3IA 2BHFA 4Z8FH 5E5LA 1E42A 2YS4A 1ET5A 3HBZA 4UQ3B 1JJUA 4PJ7B 4O2EB 3WY1A 3UJJH 2UUDH 4POZC 5C2BL 5I5IA 2DQIH 3MRBB 4XBMA 5JHBA 3OKNB 1VFAA 4E9WA 1MRCH 3QIBC 3S36L 1A3RL 1D9KD 3AXHA 5SX5H 4DGWC 3HFML 3MACH 4OY9A 5E5MB 3FPXA 3P0VL 4FQ1H 5HVWA 3RI5K 3CFBA 5JUEH 4NM4H 3TYGH 4TKWA 1GZQB 3VXOA 1UUSA 1SJVA 5GS0L 2MH4A 3AS3A 1U8PA 3WFCH 1UG9A 1GIGL 2FR4A 3FNKA 2WO4A 4N2KA 2AJUH 4U1HA 1CE6B 3FCGA 5I28A 3QJQB 1FFQA 1KTDB 5AVVB 5FF6B 4LLWB 5BQ7A 5FFOA 1U3JA 1G7LB 2CU9A 2X3CA 5DC0A 4QKTA 3IAGC 4YVNA 4MD4B 5J89A 2VO8A 2RB8A 3QORC 1M42A 5I9QC 4ZOCA 4P2CG 1WA1X 5DJAA 4JNXA 1N0XL 4QEGA 1TTGA 2F15A 5D2LE 1C5DB 1JD7A 3BUTA 4NO2B 3RIAF 5DS8B 3HNVL 3KXFD 2PCXA 1PY0A 2GBAA 4B53A 3EGXB 3OG4B 1CXKA 3RL2A 4K5MA 1GAFH 1O9ZA 4N28A 5TGBA 3UERA 5KJ4A 3V55A 5C1MB 2P80D 2QGEA 2ZX9A 1CL7I 3FFCB 1UURA 1IEBA 1P4LB 2H6PB 1T0OA 2X89A 2R29H 3BUQA 3RHWF 2GK0A 3AG1B 5E2UH 1R5WA 2YSTA 4YUEH 1OWRM 3CHRA 1XF1A 3PNWB 1BCIA 5ES4B 3WGUB 2WXIA 1K4CA 1G9MH 5D96B 4PJBA 4QRRA 2X87A 3QARA 2DQHL 3FTUA 3QHTC 5IVOA 1GGCH 5KVFH 3D34A 5LQBL 2DM3A 3Q7JA 4KQ3H 3RFRA 1S9XB 2Q7YA 2QVFB 4S11A 4YPGB 2G3NA 3PV6B 1ND0A 4FXKA 2NYYD 4MLIA 1HI6B 1Q8MA 5EN2B 4AC2A 2RQEA 2WXHA 5LO7A 2BVUA 2Z92A 5IV2B 4UZUA 4BFNA 3NZHH 3RI5F 2CUHA 4KRPB 1E4XI 3UTTB 2V6HA 4YE4L 3S3BB 4FNQA 4GBXC 3ZTDC 5C0RH 1HJBC 3I9IA 5B1BB 1ACCA 5E9DA 5PAZA 2J6EL 4NKDB 3U4BH 1JOIA 4I3GA 5JHDB 5DJYA 1EVUA 2B16A 1M7DB 1CLOL 4M93B 3QUYC 3MMEA 3BAEL 4RNRA 2AEQH 2EJ1A 5BJTB 1ZXQA 2V3EA 4N2MA 1NFDA 4Q2ZA 3DX9A 3VWKA 2DQJL 4OV5A 5TPWH 1JV2A 3ULVL 5HYSB 4U4IA 3C6LD 3CFEB 2C1PB 5D7KD 2VR8A 1F3JA 1IC1A 3WTUA 3T1FA 1SLUA 3HB3B 4PUBL 2FSDA 2VQ4A 2DEXX 3B9KC 2JB6A 2A77H 3NIDB 4FQCH 4PTUA 1MEXH 3VSUA 3C5ZD 1NUFA 3BRFA 2ITEA 2ED7A 4JQVA 4U0RB 4IKIA 1INDL 1FNSL 1YYMH 1IBYA 4NZRL 3ZRFC 4CC4A 1AO7A 1NPJA 1VLXA 5F0JB 5HVHB 3ULUC 2YFNA 5T3XL 1ZLWH 1TPXC 2H41A 2MRYA 2Q10A 3RBSA 1L6ZA 3KYMA 4UQDA 1WT5A 4HKJB 4G8AC 2X38A 3UZQA 3MLSH 1DLHB 5IGXL 2RMNA 1LO5A 4UBDC 2X1WL 1QFWI 4D9QE 2EYSB 1I3GL 5EIQA 4E42B 5DUMH 2IQAB 3F7VB 4AYMC 5FUCE 4LL1A 3FYEB 3CBJB 4IRJC 3VA2C 3FU3A 1T0MA 2K8QA 4WI2A 1KOAA 3IGAB 3MNVB 4OZGA 1QI5A 3VDAA 3PF2A 3I02B 5C0AE 4GI6A 2N56A 1G7HB 3LV3B 1XTLA 4H20L 4KFMA 2OJEB 4NUGH 4V1DB 2NY7L 4E2OA 1I82A 2FGWL 2IEPA 3CN1A 4FJYA 4HXAL 4M7LH 2O4EA 5BO0D 1RFDH 3BSZH 3VXSE 4X6CB 3U1QA 3HHMA 3MRRA 5BO1H 4PS8A 3UBGA 4HBCH 3GZQA 3MJ6A 4BZ2A 2WANA 3R06A 3F04A 2H1PH 1I7TA 4EN3D 3ZL4H 4YR6B 4JKWA 3Q6FB 1W6LA 4RFEB 1RU9H 3DX1A 5IQOA 2PPFA 5HGDB 3WJLA 2AQ3A 1GY1A 2DPKA 1W9XA 2QKIB 2BSTA 1R3IH 4PJ9D 2FL5B 4FL4C 3D18A 1RK0A 4IMKA 1KIPB 2VDRH 4DZ8A 2NYZA 5KYUA 2ERJB 3K6FA 1XF4B 1TG8A 4ZFZB 1IC0A 4W9IC 4C83B 3UPAA 4LSSL 4BKSC 4J3SA 5FGCE 3DX8B 4LLMA 5FYKE 2QJDA 3AAZA 5DD1H 4W9EC 1FH5L 4MYWB 1H3WM 2HJFA 3BD5A 1F4YL 1WC7B 3C5XA 3TESA 4LRNH 4RZCA 4XX5A 3C8HA 1RSYA 4PRPE 1YUHB 4XBPB 3WLBB 5GGTL 1E6OL 1F3DJ 5E8NB 4G7YH 4ZX5A 5EU7E 3ARQA 4M1CC 2ZKHL 5AW3B 5L7XH 4L0PB 2J8HA 5IHBA 4G8GA 2WTOA 1MWAB 4H2AA 5H8DA 3HI6L 5MI0C 3JWDL 3W9EA 1OAXL 1UXSB 3UYPA 4D9LH 4XBGB 5I16A 2XZAL 4HULB 4KI5E 1P4IH 4EXKA 1DJZA 1QKZH 2VR4A 1G6RB 3MZGB 2DBJA 3ZE0E 5K9JL 1E27A 1URLA 4KPHH 3FSAA 5L0QC 2K8MA 3U36A 4PRBB 1T5XA 3B2MA 2CJ3A 3Q5TA 2I5YH 4HWBL 4MXWL 4A6YH 5F7FA 4XHQA 3FB6B 3WN6A 4YSRA 3EXLA 3VXRA 1ET8A 1EZVY 3RVWD 2FCBA 1S7WB 1AIFA 2YPLB 4YDVA 3OX8A 3TO4D 1WHOA 4L4VB 4NQCB 3L5JA 1CJYA 1D6EB 4U1NA 3QYCA 2CHWA 4FHJA 3I84A 2IADB 4M6NL 1TQUA 3BMWA 3DSFH 1TEFA 5D1ZB 4JM4L 2CR3A 4HIIA 3GYRA 1ZANL 5JOFB 1SUJA 5C07E 2X4QB 1YEJL 4JHBA 3QUGA 1OPGH 5CLYA 1E28B 4R9HA 1KB9K 1IC5L 3LPOA 5LUMA 1ZV9A 5I6LA 3IFNL 1QSEE 5BXFA 2QHLA 1BOYA 5E9NA 1CDUA 5E51A 1IQDA 5GZNC 1RUQH 1KCSL 1PZSA 2WCSA 1RZKH 5A16B 3EAKA 4M9PA 1NMBH 4LT7A 4PJXF 1A5FL 1YDPA 2A6IA 4MMXC 1CL7L 1ADQH 4ZFQA 1FZOA 4ZPVB 1B6UA 3Q8BA 4HWZA 2WXNA 5C08B 5DC2A 5I6XB 2D3NA 5I66A 1JZGA 4AEEA 1JNJA 3UH8A 4HKXB 1AZRA 5J9PB 1AE6H 4ZW3A 2VDKB 3E38A 2IANA 2PN5A 4U6YB 4UU9B 5DLML 3TVMC 1E9PB 1P9MA 3Q2VA 1OP3H 4NO3A 1JGDB 1PIGA 3CXHK 2HPTA 3BYYA 3ZHFA 2APWA 1C9SA 1PLAA 4PJEB 2VABB 5LCVA 3SGKA 4HK0B 1AKJD 4WKXA 4F2EA 3QHFL 4PJ8C 2WLIA 5FYJE 1V3LA 1X4YA 3ZXAC 4AYFA 4GKSA 5KBNC 1TEGA 1IAMA 3X3FH 2BSSB 2YC1A 1ZE3H 2ZICA 5I1DA 1ZGLB 1Q38A 1I1AD 3CE1A 5T33L 3DYMA 3MV8A 5F8RC 3K4DA 3W0WE 5J57B 4AYSA 4JFHE 1NEPA 2X40A 1KLFB 4DOHE 3BXNA 1LO3L 2NY1C 5B7MA 3K5SA 2JLLA 1WAAF 2NY6D 4NP4L 3D9AH 3FMGL 4XVJH 4W9GC 1MRDL 2F7RA 4BGDA 5BRPA 2FYVA 3ARSA 3G5YA 4PFEA 4FZ8H 1UZ6F 3TXAA 5F7WC 4YDJA 3TCLA 5ALCL 5AW8B 2RTTA 4HIQA 5FFGA 1CT8A 4J2QA 4KMQA 4JHWH 1EUUA 4NPKA 2VMJA 4L1SA 2GBVA 5BOPA 1GTFA 2IWKA 3ARBA 2RD0A 1EVTC 3NJVA 2YD4A 4MA1C 2ADJA 4D9QD 1YMHB 2A73A 1NLDH 5EPMB 3EADA 3IRCA 4KV5E 1RLWA 4P57A 3VJ6B 3QPXH 1R4XA 3UAJD 3GIZH 1BZ8A 3MBED 1AVAA 4W1TA 4XMKH 1CLYL 4KKQA 3GMRA 3JUZA 3NJJA 1NIBA 1SM3H 4U1SA 3WKNA 3H2PA 1QAWA 1RZQA 4UQ2A 2NR6C 5DMGD 7PCYA 4XAWH 5C0AD 5F7UA 5KYWA 2X4PB 2XKSA 4YBQC 5F0PB 2A9CA 1ZTXH 3D8MA 5DHDA 5DK2A 2RACA 1WIUA 3LTVA 1QFWL 4MQXD 3BQUB 3SJVB 2W9DH 3MROA 2ADFL 4W6YB 3VXSD 5D7IF 1LEGA 4LU5H 4M7JL 4MJIA 3MRDB 1KGXA 1WUZA 1G9MC 2YJQA 3VFUA 1B88A 2VN4A 4GAFB 3STZB 5FA3A 4IBUA 3O81A 1JNHB 4IMLA 2C1OB 1PZ5A 1RK1B 3ZMEA 4ODUB 2IFFL 4P06A 4YHKL 4A68A 4EDWL 4Z7QE 1F56A 4MA3A 1FORH 3DPDA 4PP2A 4MQSB 3MUY1 4PJHE 1SY6H 3NBNA 2YAOA 3L9YA 2X4RA 2XV0A 1XGRB 3DX3A 3QQ3B 4KNUA 3K72A 3AB0C 3FTVA 4LKCB 4MJ6B 1WDAA 3EJYD 4UIMB 1QI3A 5KBKA 5D2NC 1NQBA 4TSBH 4L8CA 4AQ8A 1EQWA 3L3DB 4A7SA 1SEQH 1UXWA 5TDPB 2F5AL 4IDJL 3WHXB 3MRQB 2Q3XA 4Q89A 2ZCHH 4PJ5B 2ICWI 1X7QA 2VQUA 4XCCH 2Q1EA 5CM1A 4Z18A 1KWKA 2DQEH 4PRPD 2UZXB 4PREB 3CZJA 3FT4B 2PO6B 2OSLB 1G87A 4NQDA 1I9JH 1VZHA 1KENL 2ZYHA 2DQCL 1Z7JA 4KC3B 4QXWA 4X98B 1B0IA 1E0OB 3GI9H 4LPWA 4ZW8A 1IO4C 4LHQB 1VFBA 4L3CA 1NEZB 2IDUA 3IPEA 1CR9L 2AQSA 4QT5A 3E80A 3P4OA 4OQTA 4I0PB 4KI5D 4XR8C 3CN4A 3HI1A 4P4KC 1BMWA 1A6VL 2UXGA 5IHZB 1OK8A 1J8KA 1J0JA 4RFOH 3HFMH 4XH2A 2XQBH 1CDBA 3BZDA 3DUSB 3BUPA 1T66C 3VRLE 2I07A 2AQ1A 1IVLA 4RX4D 5DJZA 4PGZA 5DUBA 1EO5A 5JMOC 2UVFA 3PWLB 1XR8A 1GIGH 3ML8A 1RZ8B 3RDTB 4PCYA 4WEUD 4MDJA 4N0YL 5F7EL 3EO9L 3CQFA 4X7EC 1U8CA 2NT0A 1NUNB 4JQXC 2V5YA 3V0HA 1CICB 3VH8B 3TASA 4AZUA 3UOAB 3DI3B 3QQ9C 5C07D 4WFFE 4BH7B 1NIEA 3BPOB 4B9KC 3HUJF 4H8UA 4EDXA 4GW4A 2IV9A 4UZSA 4ESKA 1QSED 2JCCF 4ATTA 1AD0B 4P2QB 1W15A 4HLJA 5CCKH 2XPZA 1N0XH 3QUMA 3KAAA 4TRPL 1S7QA 5I73B 3VI4E 5ABAA 3F5WB 4PMFA 4HMDA 3FQWB 2VUOA 1T5KA 1R34A 3MOAL 3WNMA 5EWIL 4XAKE 2Y6SC 4OR1A 4RGOH 4CJ1A 4LCIL 5DD5L 5JQ6H 3N1MC 1Z3RA 5LGJB 2ZXAA 4EUPH 1HESA 1DDTA 2Y9RT 1ULVA 3UYRL 1IGCL 2P4AB 1XV8A 5I23A 3SDXA 4BFKA 1KBGL 4J3OG 4UTBL 3V6OA 1HS6A 1FZKA 1AP2B 3TA3B 3BWSA 2GC7C 1UWXH 2FBOJ 3KPOB 4LARL 3N40P 3MV9B 3ESNA 4A37A 2WBJC 4JFPB 3BAYA 1ZXKA 2CO7B 1A6TA 2C4FU 5LQBH 1KEGL 3FO0H 3HI5H 4RIRA 4DT2A 1KIQB 3FFDA 1FHGA 3O6LH 4OFVA 4NUJA 3RVUD 4FTVD 5D6CA 2PW1A 1IV8A 4MJ5A 2WKOF 1BJ1H 3EUUA 4F9LC 2JTDA 3EJUA 3W0WD 4EIZC 1IKFH 1DBKL 3RU8L 3O2VH 2XXMB 4PJXA 3O3EA 5F88B 3FN9A 2AXFA 4LF3B 3J7HA 3C09C 3HN8A 3SBWC 3B3IB 4APQB 4YHZL 1AZVA 1PL3A 2ZP0T 5E5UB 1Q94A 5F7DA 3KR3L 3IDGB 2MCAA 3ZTEA 4EBQL 1CYWA 2WTRA 1ZV2A 1OARH 2E8ZA 3GSXA 3HC2A 3WO3B 3U79A 3K74B 2WK2A 7FABL 1CI5A 3WENA 1QEWB 3E2HC 4KK6C 5T1LD 5GJSL 1XGTB 1MW1A 4PRDA 3O6ML 4EMZA 4DW2H 3G6JF 3GO1L 3KH4A 3NABH 4QTHA 4J3UA 3CVHA 3ULUF 2DQJH 1CDHA 2UZIL 3H9HA 4MCMA 3V4VH 4AVHA 3ULVH 5AOZA 2WIIB 4NAMA 4V2BA 2OMUA 3CCHA 2GITA 3G6DL 2LU3A 2D73A 2BS8A 3VI3E 4RDQG 1YNTB 1INQA 5LHDA 2ZE0A 3SDAD 3DHJA 4NBZB 5E9DE 1IGML 1S7XA 3EYSL 1RZGB 1QRNB 1QQDA 2X3BA 5EOTA 3NJGA 3U1SH 5FYLH 1WD8A 1MNNA 1C5CL 5EU5B 1FNEA 5KSAD 1JV5A 2VDRB 1ZK9A 1INDH 3ZE2F 3QEQE 3OSVA 1IRAY 2BCKB 5T3XH 3H9ZA 4Y4KB 3TBWB 5DTFB 3B2DC 3V7AE 3EBGA 4LBEB 3L4VA 5D7SH 1XL4A 2A74B 4CADB 2GJZB 5L2KB 1CCZA 1M7IB 1KNOB 5F89A 3RA7L 3THML 4F7CA 1W0VB 3V0DA 1MFCH 2EIZA 3T1WA 1OSEA 3ZE1E 4WV1B 2LGNA 1XR9A 3EBHA 5D7JA 3DJRA 1FL6A 3L8QA 1G6VK 3B9DA 3HKZA 1SOXA 5DJ8A 3US1A 3F7QA 1TTUA 5IJKA 4BIKA 4NNYA 5K5YA 4HSQA 3U2SB 1AFVH 2XETA 3QWQB 2JTYA 1FO0L 2XWTA 1MCFA 4XTRC 5BW7A 4ZO9A 2BSED 3E1F1 2DJ4A 3PWJA 3WEXB 4Z76A 5LDSA 3IM1A 1GC1H 3JTTB 3B2VL 3NJHA 2NY7H 3FU5A 4HUCA 5CIPB 3ZR5A 2FZ3B 1D3CA 2JKRM 1TIUA 1YMMA 4U31A 5A3ID 1JF1A 5CU5A 3HG1B 3U2JA 4G1MA 4DKTA 5I15L 5E00B 5ICZB 1AS6A 2ICCA 1R5IA 1K4DB 2B3IA 1NOFA 5AZEH 5GXBB 5JHLL 2ZXWB 2A2QT 3D7PA 2R2HB 2WXPA 4URKA 5IOKA 3DXAA 2VRAA 1RVFL 3AG2B 1CD0A 2IO5A 3CFJB 5FA4B 3HLKA 3S4SB 5A2KH 5D7IA 3QUZB 1YEFH 3PREA 1G7LA 3LH2H 3IF1B 1A7OL 1NGXB 3FQTB 4EZLA 2WYIA 5J12C 2GIMA 1OSYA 5GSVB 1JPGB 1ZHKB 5C9KA 3GI8L 4GRWF 2ESVB 1I9RH 4A1RA 2FT6A 5E99H 4TQEL 3TBYA 4UM9B 2GKIA 2QPEB 4L1LA 5I18H 1J0ZA 4Y7MA 1MJ7L 5IZ7A 4ODHL 4OBSA 4J4PD 4UINL 1FZMB 4J2XA 4WHYH 4L29A 4AL8C 3N55A 3FFCA 1JAEA 2HRHA 3QDGE 2UY7B 5DJ2B 2EDOA 4WKZB 5HPOA 4H40A 3I75A 5HJ3A 4Y5YC 3S5LG 2H26A 1EXGA 4ZPTB 4F2MB 1GZPB 3TIDB 1U3YA 1ROCA 1BEXA 5C0CB 5DRNB 3ULSA 3HI6H 4G70B 1FNGA 3K6NA 3L5IA 4EZKA 2WLYA 1GR7A 4FFVC 2NW2B 1A25A 1FFPB 1OAXH 2NDGA 3TNNB 3IBEA 4WFFD 3BWZA 3RWGB 3T3MB 2XZAH 4M62H 3TZVB 4ABWA 4K23L 2ODHA 3VXPB 4JQIH 1G1KA 2HP4A 4AENB 3ILQC 4LSUL 4BFIA 2XACC 2B9AA 1KCKA 3PV6A 1RHFA 4P9HH 3M1BA 4JUSA 4L3EB 3APNA 1IM3B 1TQCC 3Q8CA 4FQ2H 4I1RA 4QRQA 5C9JA 5IVXB 5L88L 4F15B 1UM4H 4L18A 1O0VA 4G8GE 1OM9A 3KW8A 3T3PE 4J7RA 4M6NH 4M5TA 4XAKD 1O6SB 4XPFL 5D93C 1FGVH 3SGJC 1ZRUA 3W39B 2VLKA 1SDDA 2BMKA 4JM4H 2KHAA 3ATFA 4OIBA 2D03L 4X83A 3QUXC 1GOHA 1MCOL 1J1PL 1BYNA 1JGEB 1AR1D 1IC5H 5AOKA 4N85A 3Q2LA 2BVOA 3IFNH 3TPKA 5DSCB 4WSKA 4OQ1A 2OW6A 4X7SH 2ISDA 3WO4C 4F7EA 4EI5C 2OL3B 4MNQE 1HK6A 4ZTOH 5EU6B 3CZUB 4MMZC 3HUJA 3ZKQD 2F54B 4WWKC 4ICWA 2FX9H 5KVGH 3W81A 1BF8A 1B4TA 4JE0A 5IBLC 1PD1A 4DP5X 1CGVA 3VFGL 4NZUL 4WY7L 3QPQC 5AQ0A 5E8PB 3MV7A 1I4FA 3FHAA 5IHLB 4HJ0C 4MASA 1Z9MA 4MQ7B 4PN6A 4IQHA 5KZCD 4JN2B 2D0HA 5C86A 1F6FB 1T6VN 4GRMA 3ABLB 3BFWA 3PAVA 1OHQA 2FX7H 1ML0A 3BP7B 4XHJD 2VN7A 3GEFA 3MTXA 5TE6H 3D4ZA 1AACA 4KQ4H 2FQDA 5D7LE 5T3ZH 1FNHA 1TT6A 4XCEB 3LKRA 2Z7WA 4UT9H 5TQ2H 1OANA 5BRZB 5EU3A 5FCSH 1NCGA 2BVPA 2GUOB 4KNSA 4DEPC 1CLZL 2IQAA 4KU1A 5E8OB 3BLBA 2W9LA 1FSKB 1OW0A 2NCEA 3WY2A 4KZEH 3ZVVA 4NAJA 5T33H 1Q0XL 4OUUB 3WMPA 2QSCL 1F8TH 5CWSA 2IANE 3T65B 3TNMA 2NY3B 2ZOOA 1SBSL 1SJXA 4DPBX 4JG0H 2DQGH 4PJFF 3V0VA 4UILL 3HC4L 4PS4H 5GS0C 3GSQA 3UZEC 3FMGH 1I75A 5I0WA 4FLSA 4PV9B 2IWGA 3HNTL 3HS0B 1J7VR 4JM2C 4UAHA 4HIEB 1TSHA 2OV0A 5IOPA 5JLZB 2CRIA 1PQZA 1XGZA 4BRJA 2E9GA 2PPCA 3Q6FA 1HHJB 4JLRA 2UY6B 3SEPA 5FW7A 4EZMA 1KCUL 1NCDL 2V7NB 3DMMB 5ADPL 1B4LA 3OLDA 3QG6A 4JFWA 3UAEA 1LQBC 3R4DA 2EUZA 3SYQA 1N4XL 1X9RA 4RZKA 5JW5B 4FNPA 4LDEB 5E6IB 4L37A 1KIPA 2R51A 1QUPA 1IGIL 1XF4A 3G6JA 4O5LL 4DEWA 4MDIB 2ZXDA 2K6WA 1CLYH 1C16B 4JG5A 4ZK8A 3WNKA 2WLLA 3AXIA 3CHXA 5KTEL 3N9GL 3QIWB 1TZAA 4PSRA 5DD6A 1S9VB 3HC0A 5J13B 1Q9OA 3CDCA 4IS6B 4JJHA 3ES6B 2HFEA 4KZCA 1FVDB 2AEPL 4OD2B 1TJHH 1N68A 1ZSDB 5JXAL 4UAOC 3W56A 4CMMA 1L9NA 3QI9C 5F2FA 2VXQH 2PYEB 4YHMH 1B0RB 1TQWA 3FN0L 4LP4A 1PX8A 4BFJA 3BKCL 1T21A 3DUUA 4I5BA 1CGYA 3SYCA 4ZBJA 4X9BA 5GZOC 2H9GB 2XCMC 3ZKMD 1G0DA 4F3FA 3KLHD 4K8RD 2RALA 3V10A 3DV4A 4HS3A 3IGLA 1NBZB 1WA2X 3O6FA 1QLEL 2V17H 2KPWA 3LNEA 4GP8B 4XCNB 5FUOH 2FJUB 5I17B 4FZEH 4A2LA 2GG1A 3IGKA 1HSAB 5HYJB 4MJIE 1I1FB 2R39A 1BX2B 2DQUL 4X99B 1UA6L 3P4NB 5FECA 3GPEA 3F7PC 4L4VA 4HGWB 3S5ZA 4LPTA 2IPTL 4GAAA 2XA8L 2QADC 2JI2A 2PMZA 2BX5A 3IDNA 2BHYA 3QDGD 4TYUA 3TWCH 2NSQA 4I48A 2WSKA 1JFHA 2Z31D 3EZJB 4NCC1 5KS9F 4ZD3L 4JFXB 5T1DL 5AB2A 2FLMA 1QATA 5IP4A 3ULVC 3SCMC 1C1EH 2G60L 4OJAA 4GPVA 3RY6C 2DQCH 3ZT7A 4LLUA 3HAEG 3H42L 1HHHB 2CBPA 3AY4C 4JPSA 1OZTG 2PYFB 1T1ZA 4MXVF 1DJGA 2ZCKL 4ZO8A 4NFDA 4JZJC 3UJTL 3CQQA 3D0LA 3BKJH 1PYWA 5KBDA 4XXDB 5E9AA 1JP5A 1HNYA 4AE1A 4JRYD 3QS3A 1DQJB 1I7RB 4G8FA 1SN5A 1MHCA 2EDYA 1E4JA 3HR6A 3V4LA 1IQWL 2CCWA 1RI8A 5BV7B 1HT6A 1TZIB 3JV6B 5JHMA 1MKFA 4QY8B 5HI5D 3Q9PA 2CRMA 2W07A 1NA8A 4HC1H 4WO0A 2YRPA 5DK0A 4O51A 2H8PB 1QBLH 4X7FC 2NX5B 4H0IA 4N90D 1HOEA 2LLNA 1U9KA 2RJMA 2VITA 5AW7B 3T0VA 4YMPA 4LASH 3T2QA 1HILB 3DSNB 1WF5A 5HPMB 1OM3L 4JFFA 2EDXA 5DFAA 4N68A 4ODVH 2QDWA 3SPCA 3KYNA 4DTGL 5IQMA 5I6MA 3INOA 1QLFA 2K3TA 2Q5BA 4HUUB 3V52H 1ZGLA 2DH3A 15C8L 4MNQD 5AOIA 3LKNA 5E0FA 4OFQA 4R4ND 5DEFA 4FYSA 3U6RB 3WXWL 1CYXA 4CDHA 5A6LA 4J8QA 2WXJA 4DGYL 5CD3B 5IB1B 3RGVD 2N4IA 5ENWB 3V95A 4TOYL 2ZOTA 1BW8A 3V4VB 4KK9C 4ZFFB 2LFGA 2DKSA 3UZVB 4GB9A 4OGYL 4JANB 4G6AC 5GZNA 1I8LC 3ROOA 3UYRH 5CF3A 3IU3A 2QLVB 3AQDA 4CW1A 5FK9B 1KBGH 2BSBA 5TQ0L 2UYLA 3MN8A 4PBXA 5ICXB 1SNRA 2Y0SA 3BVDB 1URIA 2WQUA 3L3JB 1OCCB 5E03A 1HQRA 1TZHA 4G9FE 2DV6A 3U9PH 5KSBF 4KFZC 5CGYC 1KEGH 1XHHA 2WQXA 5B39B 1MWOA 5D4QA 3VTAA 4LFHG 3CIAA 3H0TB 4KOCA 4PJAF 3V4UH 2GHWB 4UB0L 3SOBL 4QF1B 1DBKH 4OCXL 1EZLA 2Q9OA 1GPOH 2GFBA 2XWBA 4U6XA 3RQ3A 4Z77B 3V6OE 4IGBD 5CD5C 1KFGA 3T8XB 2IG2L 3D0VA 4MLSA 2HYMA 5CBAB 3ZDXF 1I8MB 5HJGA 3S48A 1MFBL 2G4EA 2ZT9C 1SLVA 5MHSD 1JWMB 4HT1H 4XP1H 3EJSA 4M8UA 1FCGA 1A1NA 5CCJA 3NSFA 3DX6B 2RFXB 3JWDC 2DW5A 4GKZB 4AK1A 3O6MH 2OMXB 1S7RA 4K3GA 1E4KC 2HT3D 2D31A 2CLVB 2KH2B 4HJEA 2W65A 1LYQA 2XIIA 2P3YA 1KFAH 2YPVA 2NXZC 4JEGB 4JL2A 5EIIG 5GGVY 3RWIA 4BQCA 1SUHA 2V7HB 4N24A 1Q9WB 1NCBL 5K1VA 2KZBA 3B9VA 3NA9L 3TPUA 5GRJH 5CP7A 3UEQA 5F3BB 2BY2A 3GSOA 3TEYA 1X5FA 4NQEA 5CN3A 5F8QC 2AJ3B 5KJ7E 3U7WH 2R9HD 2WBKA 4YSOA 4TQIA 2EUVA 1JRHI 4ONGL 3DJTA 5IJCC 5LKNA 1O75A 1HXYA 1JCVA 2XNAB 3NQKA 2XZQL 5G2NA 1ZK5A 4PTTB 3RTQC 2ZX7A 1AAJA 3DVNB 3IE9A 3ZTNH 1A4CA 2XWRA 4OAWB 2CIKB 1Q90A 3STLB 5F9JB 1A7PL 3U9WA 1EZUA 4DFHA 3QDHA 1LTXA 4R0LB 4WFHE 1KSRA 3PHQB 1H15B 2JI1A 1T89C 5CEZH 3TURA 2O6PA 3THMH 2OSLA 4YO0A 3MLVL 2NR6A 4FADA 5TF1H 1GSMA 1J8HB 1WVZA 3S2AA 2ZOKB 4NFCA 2R29A 5IUSA 5KSVA 3MU3A 4XGZA 5C09A 1CXEA 2ZJSH 1RERA 3L3IA 3T5WA 2GC4C 2VR9A 3GLEA 5F9OL 1U8JA 4WJG3 3QCUH 3KBFA 4X0NA 3ZT6A 4AVIA 4NC2B 2JJUA 4ELKA 3QFDA 4GW1B 3SYOA 5ISZE 3B2VH 3SGEI 4QXTA 4F5CA 1QACA 2ENJA 3EOAA 3QULA 1MREH 3DJZA 4BQ8A 1S7TB 3JVFC 5F44A 1WP6A 3SIKA 4YXHL 4Y16C 4H44C 2NOYA 3UMTA 5I15H 1QHQA 4S0SD 5T8IA 1J5DA 3FT0A 1PZBA 4UQCA 5F6HJ 1RVFH 4W9JC 3ARFB 4ODTL 4YNYA 4ZO7A 1EWHA 2Z8SA 2BC4B 4X6EB 5LNEA 2C7UB 1FL3B 3L3OC 3HMXH 5BMFH 2HMID 1MCNA 3L4XA 4LCCB 4TSCH 1VGEL 3X3GH 4EXPX 4AG4H 1QI4A 3RGBA 3GJFA 4MNGA 1YMME 4LCUB 1AC6A 4RMBA 3VGEA 3ULAB 2VXVL 2MOVA 5FYKL 5SV4A 2EYTA 4R26H 3QZWB 2OSYA 3OHMB 4X42A 2AV1B 1V10A 3JWNH 4ODHH 3OJDB 4UINH 3M45A 5MEQB 1NANI 2G0KA 1ORQA 3FUNA 4ADJA 3T2NH 1KB5L 4JY5H 1B9KA 4WHTB 2G4GA 2WMPB 2YUZA 3F6IA 1HDMB 1QNZL 4WU5B 4N0FA 4XNXL 3BT2L 4P4KA 2IBBA 1AP2A 1KJ2B 3B2UD 5G5DB 3IJ9A 1CG9B 2X5PA 3AU0A 1D5ZB 1WWBX 3O4OB 1TKWB 3CN2A 4M8QA 2ITDA 3PP3K 2E7BA 2ENQA 2VWEE 5T5NG 3V7MA 3FB7B 3FFCE 3FS9A 1QNIA 4LEXL 4ZOEA 4IU2A 5JDJA 4LDLB 5T5FH 3K81A 2GY7B 1ASPA 1IBGL 4YDZA 5B3JF 3T4YB 1KLGA 3SDCA 6CGTA 2HCZX 3VD0A 3KZ8A 4OVVA 2MCMA 5AVXB 1JGUH 3H8NA 2F7QA 5ITBL 2IAMB 3KPSD 4LCWB 1TO5A 3BUYA 4HD9A 2YARA 4XMVA 5AVTB 4YK4B 1G7QA 3EJRA 4R4BB 5CGMA 5K59F 3JWOH 1N6QH 4ZS6D 4XE0A 5JQHC 1KJMA 1N7MH 3UBXA 5C7XL 5DT1L 4I1PA 4PWIA 2VDPB 3IDYB 1MCOH 1OIOA 4RISL 4GRLB 3GM8A 3HE7D 5HGBB 5J06A 3BESR 3APDA 1GCFA 3TH3T 3RFZA 1B3IA 3WUWB 2HJKA 4JO5A 3SDYH 3LN5B 3KMDA 2AJYH 1UHVA 1F58H 3IFPA 4MHHI 4DFIA 3MR9B 4AMXA 4MVBD 3QIBB 2YD6A 1SYVB 1J18A 2OYKA 4G9FD 4QYOA 5EO9A 1I7ZA 3CHSA 3UTTE 3O9WC 2ZIDA 5FXCH 2OMNA 3FQNB 2VLKE 3BZ4A 4PWGA 1FNAA 5HDBF 3PHOA 4P46D 3SGDI 3UGUA 2BNRB 1RZGA 4C4UA 4K3EH 1I8IB 3VXMB 1EXUA 2CMRL 2DLTA 3HZ3A 4CGUB 4P3DB 3MRCB 4JW3A 1ZA3B 4BH8B 4NNPH 1S7UB 1Z2KA 4WTZA 4NI6A 3QZMA 2XBZA 5L6YL 1ZDSA 1NWPA 4OLXH 3VFOA 5EV7A 4QRPB 1N64L 2W0LA 1D6VL 1XF5A 2J12B 4Y4KA 5MERB 4Y19A 5FYJL 4MAYD 2AQNA 1AGCA 5I9QB 5IB5A 1I85C 5IBUB 5FM5O 4NBYB 2ZOUA 2VW7A 4DGVL 3MRIA 3NRFA 4LESA 4HOXA 5K69A 1HHIB 3GGWA 2CO4A 4U1IB 1CLZH 3NIDE 3JVGA 4WV1A 1WZMA 1UASA 4ZAKA 5I8OL 5FDYA 1UT2A 4FHKA 3S3DB 3N0AA 4L8SC 1LGVA 1UWGL 32C2A 2VIRB 4FMKA 5LWYL 2KERA 3E3QE 2VAJA 1AG6A 1SJHB 2C7FA 5EU4B 3T9WA 4RETB 3WKYA 1PPIA 2H0EA 2J1YA 3CX2A 4ES8A 1M71A 2E6QA 2FJFA 1JHLL 3PQYD 4PCKA 4QHKJ 1ZTMA 4FYRA 4QAMB 5CU9A 3DIDA 5J56B 2JCCB 3FTZA 3O8XD 4IRSC 4LFHD 4G7VL 3QRGL 5D72L 3X1BA 4A7GF 4DNLA 1RZFH 4IKJA 4NPYB 4B0MB 2CM6A 3CDFA 3UIZA 2A4ZA 2IBZX 5E6UB 4LNRB 4B27A 4A38A 4ZMQA 2MTAA 3KVDD 4OT1H 2XHNA 4JRFA 5BZDB 1WBXA 2WINB 1KV7A 2ADIA 4A6YA 1TTCA 1KCUH 5HGHA 4N8VB 3TF4A 4AJYV 4WFHD 5E0QA 5ADPH 4LLDA 4HHGA 3S4SA 4POYA 1BEYH 1UD6A 1JRHL 2PXYC 1BFSA 2P8LA 3HE6B 5CJOL 4JG1L 2YRLA 2FBRA 3QEUA 3GS7A 4DN3L 3M46A 5GRVK 4CJ0A 3U30C 3JV4B 1AHWB 1KCRH 3D39A 4AUJA 1G9NL 2YAEA 4WI8A 1OXYA 4GSDL 3TBVA 2VDQB 3BVWA 4XCFH 1WTGT 1H9VA 5ADOL 4K7PH 1E9QB 2XG5B 1NPUA 2TRYA 5FIEA 2QR0B 4E0RA 2UXTA 1ITBB 1PG7W 4GSQA 4N87A 3GTVA 3UTOA 5L8JB 5EZIH 4W9CC 1ETZA 3QWNA 4OZ4B 4Y2NA 1TLMA 5FB8B 1FG2B 5DJ2A 1ADQA 3RWJB 3QUYB 3CVDA 3GUTA 1IVTA 3C08L 2EH7L 1HVXA 2VQ1B 2ATAA 3GMLA 5KN5B 4Z7UF 4QHPA 1C7TA 4APXA 3NDZE 4Q9CA 5E8EA 5LGKA 1AGEA 5BUAA 3RILA 3TBSA 1WFTA 2CJSA 4FQQB 4NZJA 3WNJA 5DHVH 1RJYA 5IG7A 1C08B 3L4YA 1ED3A 3SPVB 3K71B 1UOVA 1JZDC 3B9KB 2BOBB 1QLEH 4QHLA 1NOLA 4JJ5A 5EC2A 4FN0A 1Z5LB 5AVRB 4KUZL 4W4OC 3CPLB 4XVSH 4HCRL 1ONQA 1YECH 2KDYA 2OQJB 2CNZA 2Q86A 4UMSA 3FZUD 1UD8A 2AS5M 4G43B 1USZA 4PRIA 5SX4I 5MEOA 3NACL 1CFSA 3QUHA 2HT4D 1A7NL 4M1DH 3EOBA 1NJ9B 1UA6H 1ZVSB 4JKNA 4L4TA 1TPXB 2RH0A 2NMSA 2V9RA 3KPRA 2HFTA 2VKWA 4P0DA 2XWXA 4CC0A 1U8HA 4MFHA 1O6SA 1LDPH 3KL5A 4NIYE 4K9JA 4BRVA 5T1MB 1W72L 5EOCJ 2JCWA 1T0NA 4HJSA 4ZD3H 2DQDL 4NRZA 3V0GA 5EZOL 4JKPL 2VLJA 4XI5C 1R75A 5I30H 4ZS7L 4AMWA 4JS7A 1OSZB 3FU7A 2IXQB 4IRJB 4ANUA 4NSKA 1YNLL 2R4SH 2XV6B 3D48R 3H42H 3QO1B 4F8PA 5CMAB 3ZE2B 3GHPA 5I0VA 3NFSH 4X9GA 1KTLB 3OLIA 4C56B 1UWYA 3MRGA 5EUOF 4H8WH 5KJRH 1LE5B 3B7UX 4L4VE 4YIQB 4DUVA 4NQCE 2GPZA 3OKOA 2Q76B 3I6SA 1WFOA 3P11L 5E8PA 4K9EL 2CJTA 4BFRA 4DKFL 2QMJA 4OH2A 1KN2L 1R5VB 3H2QA 3LEXB 2FECI 2AABH 4D8PA 5A2FA 1XGPA 4BXVA 1WH0A 4YDMA 2DYPB 1DUYB 1IGYA 2LABA 3LZPA 1Z66A 2N3JA 5CLWA 2QV2A 1OP5K 4HJUA 4AVJA 5D70H 3JYCA 5J1AB 1D5MB 4MZRA 3EJCA 2HFFA 4JFOB 4FL4B 3RVTD 1J0HA 4E5XA 1MAML 3AWGA 1S7VB 5ESAB 1KTBA 1QVOB 1QASA 2AK1L 2HH0L 1L5GB 2IPUG 1EJOH 5C08E 2FATH 4QHUB 3I3BA 3QJZA 3GINA 5JOPD 1O9VA 4A7UA 4WIQA 5CKAA 4GFXA 5JORA 4A2GA 4FA6A 2E4TA 4LVOC 1BYPA 1F11B 5IHUH 3UTZA 1MF2H 4KRPD 1ZLSH 1N8OE 1N26A 1BAFL 2P7TA 1N19A 3HCVA 1HHGA 3MLXL 3QUXA 4GEIA 5EULV 4H5SA 1WZ1H 4PJEE 1GTNA 4H8VA 4NWTH 3ZYJA 2DIAA 2AJSL 4FJZA 4HF5L 5JHDD 1E9OB 3SYPA 3VXTB 1NCHA 3L6FA 1OOAA 4BHUA 3A0OA 4GRWB 4EI5A 1SY6A 3QO0B 3H3PH 3ZL2A 5EF2A 3O6KH 3D85B 3FCSA 4YFLF 3ILPB 2WXLA 3PWUA 1KGYE 1IGJB 4MMZA 3C2AL 4W6XB 3LDBC 5TQ0H 5BS0D 5ID1A 1BFVL 4R7XA 4KUCF 2XT1B 1IKNC 4FFWD 1T2JA 1DBJL 2C9XA 4PJDA 5IB3B 4GINA 2VH5H 2YPKB 1WLHA 2CR0A 4P07A 3VU2A 4M6AA 5I1EL 1NFKA 1D5XB 4GFTB 3M8OL 5L0QB 1BMGA 1BM3H 3HB3D 3U0WL 4ZMZA 2IFGA 2QQKL 3WFHA 2QGBA 3U46A 4PP1C 4IIQB 2EXTA 4MB3A 2NUTA 2NQDA 4UTAH 3HR5A 3TO2B 4AQEB 5CN2A 3RPIA 3BVVA 3TBTB 3E8VA 5JIPA 3MHZA 3RZCB 4NQUA 4FABL 4ZMVA 4AVKA 2YMXL 5I1IL 3PDGA 2I69A 3HFFA 1WBYB 3HZMA 3CFMA 3EBAA 3D30A 5AD0A 5IKCB 4XCYA 1WV7T 2W1NA 2AKRB 4B9JA 3QDJB 1MFBH 4K0OA 4L2YA 4L9LC 3FJTA 4ABQA 3FO2A 3BW9A 1OL0A 5IR1B 3PWVA 1UENA 3GRGA 2NY4D 1A14H 1OGTB 4K15A 3KPPB 1JFQH 1Y0LA 3N5AA 3QFJA 3WJMB 3BGMB 1HNGA 4IIZA 4N0UB 2EVIA 5IMLA 1A1MB 4MMXB 3AREA 1R3JB 2FWOB 3GT6A 4ZNEE 4FNUA 1OT2A 5D71L 5HHOA 1KPUA 2PLTA 4GUOA 4P2OC 4QPEA 3UZEA 3H1ZA 4QRTB 3QHZL 5E95B 3SKJL 2BO0A 5HHXL 1A6ZB 4JM2A 1TITA 4V1DD 1FHNA 1KG0A 1CWVA 1OZUA 5L4MA 4N1CA 4ONGH 3SYAA 4R84A 1U0QA 3CZGA 4UDTA 3TVMB 2VUYA 4MBOA 3US9A 3MJ8A 2XZQH 5AYUH 2D7PA 2PWDA 1KCBA 2BXZA 1AMXA 4OFDA 3ESPA 2DTML 3CFKA 5BNXD 3H9YA 3LNGA 4PJ8B 4UOZA 1FL5B 2UXFA 3HHSA 1IBFA 1IAII 1ZWIA 4DPAX 1MH5A 1X5MA 5AW1B 3ZQXA 4PWKA 1MI5A 4Y5XB 1FV1B 2OMYA 3QXAB 3FU0A 4P5TA 4NQEE 2E59A 1HINL 2VC2L 1DVFA 2DLGA 4QXGL 3BVNA 3IN0A 4YHLH 1IZKA 5HI3D 2JJSC 1LWRA 1NC2B 4ZZKA 2LVCA 5JYLA 1RIUH 1MQKL 4B60A 4EUPA 1FJ1B 3UC0L 2A9MH 4TUOB 4Y2DC 5C8JB 3OXSB 2WD0A 5FO2A 3FT2A 1V7ML 2NY1B 3LZFL 2NZ9C 3VWJC 3FCUB 5F3HA 2JKXA 4JFYB 2EZ0D 4H7VA 4PJ5E 5ANMA 1EEZA 4TXVB 4BZ1H 6PCYA 1I3RB 4WI4A 5I6KA 5GZOA 4O02H 4JGNA 3SKMA 5B38A 1TMQA 1NCAH 1DEDA 3US0A 1KYDA 3OZ9H 4YDKL 1KC5H 4KK8D 1MCJA 1TVBB 4NWUL 2P24A 2GTZB 4PJFB 1MIMH 1TCRA 4GG8A 5HP5A 2C9PA 4JUTA 4J3OF 1I1YB 5H2BA 4Y9CA 2LHAA 4GI8A 1JYWA 3D87B 5JPMA 1AQKL 1VSCA 4GKOA 4HJJL 3IKCB 5ALBH 4NKIL 5T1KB 3FUJA 1CFVL 3GK8L 1L7TL 4EOWH 3DV6A 2HLFD 2CKNA 4Y1SA 4ETYA 1M6UA 1MLBA 3S3SA 3ABGA 3CSTA 3KHQA 4TL4A 2X7LA 2HJLA 2YPLD 4NC0B 5HYQB 2EH8L 4X4ME 2JJTC 5I6NA 3AU1A 4XRCA 1U8MB 2FHBA 5D1XD 5D1ZD 4C47A 3KGUA 4OZIF 2F8IA 4H88L 2ATKA 2FRGP 2PABA 3V4VA 1J10A 4Y1AB 5C0BB 5GGSB 3SQBA 2LR4A 1RMFL 3MLUL 1HYSD 3OC8A 3BRGC 4KO6A 4NC1C 2BS71 4POUB 4LRIA 4YXLL 4TPRL 4OVUA 1CBVL 1JI2A 2WUCH 4Q74A 3VGAB 1KCVH 1QNZH 4P2QE 4JVPA 4XNXH 4YBHA 5CCGE 2AAVA 3TCXA 3NTCL 3WNIA 4S1RL 1FYTA 2ZWLT 5MEPA 4TUKL 1V54B 1YY8B 1Z5YD 2Y7QB 3QFGA 4MYPA 3SE6A 4RAUA 4Z3FA 4HQQH 4X7TA 5C08D 3AB0B 4QLRA 5ACZB 4PJGB 4XNQA 2Y07H 3MLWL 3PP3H 3VG0L 1HCYA 1QSFA 1K2DB 3T0ED 3NA4A 4WNQB 3BIKB 2OP4L 4F33A 3NSCA 1G7MB 3UGXA 2A38A 5IF0A 1B90A 4Z77A 2EEBA 4WTQA 3VDBA 4L0YA 3EJJX 2ROXA 1MJUH 1MSPA 4Y4HC 1AGBB 2H1XA 5TDOB 4YEEA 1MCQA 3R1GH 4GUCA 5IFJA 4KRNA 2JKJA 2KZKA 3LRMA 4BQ9A 3LIUA 1JDAA 3MV9E 2WCPA 4AE0A 4WUUA 1VFUA 4Z7NF 1UADC 2FUTA 2Y24A 2MNJB 4FLRA 4QGTA 1E7VA 5DS1A 1CBJA 3GMPA 3B7YA 2NLJB 1T4KB 3UABA 2X12A 4U7KA 1ACZA 2DWXA 3ROLB 3O11B 2GT9A 1M7XA 1N59B 2NY0C 3BDYH 2YAMA 4HLZG 2X3AA 2WXQA 4LLYA 4D9RE 1Q9WA 2YBGA 1SDAB 2F5BL 5D7HA 2WVUA 4E41A 4NO0B 4X4YB 5IEHA 3WIAA 5F3BA 5IFAH 5KS9B 5EF1A 1XIWC 3ABZA 1YYLH 2AJ3A 2EEXA 2R69H 4K3DL 3KLSA 3ATAA 4ZRGA 3ZPDA 2HXAA 1CURA 2CMRH 3KYKL 5FAAA 4OF0A 5F1NB 2WXOA 4PVBA 2WZ6A 3GMQB 4YL4A 3DVNA 4Z7VB 2ZCLH 4QRSB 1UACL 3IXAA 2ZZUT 3CLWA 3HZYA 3C5ZB 4UDUB 4XX1E 3OTTA 3OXRB 2PCFB 3IJHB 4W9DC 1ZS8B 2CCVA 3GZOA 3ARZA 4X5RA 1B0GB 1EHAA 3W5MA 3V0WL 1TFHA 2R4RL 2Y6TE 1LEKA 3LQAH 1QRNE 1F2XK 1MFEL 5AL0A 2F7IA 4HWNA 4KJQD 3L3HB 2L3BA 5GGTA 5I1LB 3QCVH 3LN4B 5DC4B 1OAUL 4N6RA 1UWGH 3LAFA 4R8WL 4A66A 4KDTC 2VT0A 5C0GB 4F37K 4PG9B 1HOCA 2H6UA 3MTRA 1DJXA 1NUGA 3CSYB 1G84A 3RVVD 2XI9A 4GG6F 4XP9H 1BGXL 5LCVL 3BQUD 3BKMH 2ZXQA 3K6DA 4Y4FC 3SJVD 3HN3A 1E4WL 2A9BA 3V8OA 4G7VH 4GMTL 1AQHA 1S7TA 5L2KE 3NCWA 4XP5H 1NC4B 4OTXH 3Q05A 3CZFA 4MAUL 4M3JA 3BO8A 5FOBA 2ZSWB 2Y3NA 4AMKL 4JL1A 1NBYA 2YEVB 2OMZA 4KJPC 5DWPA 1HH9A 1GL4B 2D3JA 4UV4H 3D5OF 3AS2A 1KJ3L 4XPHH 2WBJB 2P5WB 3ARFA 4ODXA 3C12A 1JHTB 2OJZL 3CX5J 3CU1A 4EN3B 3ILDA 1E2VA 4JRXB 4HK3N 1T5WB 3KBPA 4Y9EA 4DQOL 3CVIL 1H5BA 4ENEC 5IB4A 2GEEA 3RTQA 3ZT5A 2JJWA 2Z0BA 3C09B 4ONOA 3HG1E 4PJ9B 3NJFA 3SE8H 3MKGA 4ZOAA 3O3AB 1LL1A 3CK0L 1GW0A 2LFEA 5ADOH 4QCIA 1N9PA 5EZJB 5F7MC 1R33A 3UG4A 3TJEH 4MCYA 1T89A 4IOFC 2P5ED 2VDMB 1BQUA 5KSBB 1M2VB 1GGTA 1QBBA 1RLBA 3E2HB 3AMLA 4YN3A 3P4MB 3HPJA 4GKNA 4JDZB 5FO8A 3RZWA 2W0FB 4PVMA 3VMOA 2J8UF 2VE6B 4ZUVA 2MCPH 3NEXA 4PJAB 1F4XL 5GHWH 4D0BB 3DGGB 3LXUX 3KLQA 1G43A 2FEEI 1QTSA 4XMXA 3O4LB 2VRKA 4I0PD 1MFVA 3Q9QA 2EIKB 3HBGA 3EOTL 3HMWH 1JDDA 2B59A 3U4AA 3DX7B 5CR8A 4ZSOA 4R90H 1RURL 2IOOA 2AAAA 3F64A 4KUZH 2N01B 3KH3A 3BD3A 1JG9A 4HU8A 1OTTD 5C0IB 3U0PB 4AQ1C 4F37F 2XN2A 2EEDA 1VEMA 2P43B 4LSTL 4Q9QL 3RWDA 3IB4A 4XNBA 4OW6A 3T04D 4LBAA 4XPAL 1A6WH 2WLHA 3NFNB 3RDTD 4F2ME 4C55A 4M8VA 5IBTL 1JVKA 3NT0A 4R2GC 1S4IA 2W80C 4E9RA 4DP2X 5CGTA 3UIYA 4GUQA 3DRTB 1F3RB 1CICD 4NN6C 3HZKB 3PWNA 4WLCA 1WFUA 1OSPH 3T3ME 5B8CC 4XBEL 2FD6L 1I1AC 5K9QI 2IWFA 1CDYA 4ZO6A 1A4JA 4EI0A 4KRLB 5DEGA 4P2QD 4ZYKB 2XTJD 3QW9A 1KIUB 2XG4B 4ONFH 2NQ3A 1SBBA 2Y5TA 4KDVA 4L3EE 2HVJA 4B50A 3C8DA 1W0WB 4L4TE 3GBML 3WUZA 2WQAA 3HVDA 5MENA 4GXUN 1EO8L 3INUH 4PY7A 4XOCA 1DYZA 5TTRA 2ETWA 3I9PA 3IJSB 4KTDL 1JBJA 8FABB 3QIUA 4I3RL 3P3TA 4NEHB 2HLAA 1GVIA 1EDHA 1IL1B 3P11H 4JY4A 3P9LA 3S37X 5AFAA 3EYVA 1KN2H 3LQZB 5I75C 1B2YA 1P7QB 4O2FB 2Q0ZX 4OJFL 1MCEA 1YJDH 5IB2B 2VISA 4WO4C 3WIFA 1EEYB 3CVBA 3P2TA 3RUGA 5TE4H 2EQDA 4K2UL 1OP5H 2DMBA 2GSGA 1X6NA 3BH8A 3C6EA 3UTPE 1KXVC 1BWWA 4OQTL 1BVKA 5MERA 3MJ9H 4XWOC 1XF3A 1OE3A 3L1FA 2F54E 5EORL 5FUCC 5J12B 5JZ7C 1LD9B 4A63A 4D7BA 4UM8A 4HFUL 3PDOB 1AKJB 3BWAB 1AZCA 4Q9RH 2OMTA 5JQIB 3UJIH 2VXQA 2K4WA 4HP5A 4L1BA 4PSPA 2EXWC 2HRPH 1QX1A 4GXVH 4PD4J 4A2HA 4APQD 1KLUB 5EZLA 5HGGS 4Z78B 1BLNB 1EGJL 1MZZA 4B3VA 2E4FA 1OGAA 4WFEE 5AENA 4Z8FL 1BZDA 5I8CB 4Y5YB 1DZBA 3MRLA 3N6YA 3GMMA 1XD1A 2EEAA 2FO4B 4GP4B 3I50L 2DKMA 2IALB 3QUKB 4L5FE 5BRZE 1ZTXE 4KZDL 1N67A 4XXWC 4FQXB 2GCYA 1ZPUA 2FEDD 3WY4A 3QWOB 4DGIH 1EHKB 5CSZA 3WJJA 4X0KB 3QUML 4G1EB 3SY6A 3DECA 4U1MA 4FAAB 4N8VA 3VFNA 3OKLB 1MFUA 3M8OH 3NH7L 3TN0B 3ARDB 3GS4A 3QR1A 3R0NA 1TENA 3GHBL 4P23A 1QRND 4U7MA 3Q1EA 4AZ8B 2W59A 3EYQD 3S3PA 1PDKA 3N43F 2BFVL 3K3QA 1BSIA 3BEWB 2JXMB 5I19L 2WBWB 2ITCB 1E4XH 2AQ2A 3CUPA 3D6GA 3I3DA 3WKML 3VQ2C 5I1IH 1JL8A 2B1AH 3OKKB 4R96B 1FAIL 3POCA 2SEBB 3SE4A 3V6FB 4OB5L 1QEXA 3MBEB 2ZWYA 2BS9A 1JZ4A 1I85A 1U8OA 3PHSA 5EU7C 2F53B 4NQXA 3KEDA 5FB8A 2P26A 3QJSB 2R7EA 1PZUB 3PUUA 2B15A 2W91A 5F1SA 4AIXA 3VRJB 2OTWA 3BCDA 4I1NB 3X13B 3WO4B 2AZAA 4L8SA 4QRBA 2IVFC 2E7LC 3C60A 2J2ZB 1T7WA 4KI5C 3QJOA 3MGTB 1ZGLP 2N7AA 1FIEA 4HC1A 3N1QC 3H6AA 4HUVB 1OCWH 1U2HA 4WWKB 3VWKD 2HFGL 4O02B 4WI7A 4M7LT 3SPVA 4WWOA 2V2WA 3AWFA 4G11A 1IZJA 2NY2C 2Y7NA 4YC2C 4FI7A 4IRSA 5JXED 1ZHBA 3T0XA 1HWHB 2LU5A 4TNWK 4BWWA 2NY5L 3QDMA 3KE0A 1A3LL 1QTYT 2Y2TA 4QOKB 3ZGIA 5IQ9B 3G5VA 1N5YH 5DD3L 4XXCC 1OLZA 2A6DB 4B9YA 1SVCP 4E0RB 3HG1D 2VDLB 3MXVL 5DI8B 5IIEB 2PYEE 3M6DA 2K7PA 4P4RA 1BQLL 1L9SA 5IW3A 3T4AA 3WCYA 2HKFL 1FZJA 1BZOA 3VRIA 2ZONA 3CVHL 1F6AB 1M05B 1UYWH 3ZTJG 3H7BA 3RRQA 5EEYA 3S37L 1H0DA 2B4CH 1MUJB 3CH1B 2JKIS 4N5EC 2VZ1A 2H6OA 5HDBB 5JW4R 4ZMWA 1X5LA 2G2RA 4DEPB 4GS7C 1NGZA 4S10A 4XNMB 4O00A 5E1GA 4DUWA 3UDWC 2I32A 2CA4A 4RMQA 3F58H 4I87A 3QQDB 2IXQA 3OR6A 4QXGH 4S2SB 5SWSA 2QQLL 3WFBH 1BREA 5D1QC 3ZRCC 4XMUA 2RGSA 2YKKA 1N2RA 2ESVD 4MD0A 2D7TL 5E6SB 3DVGB 4F8TA 5HYJE 3F12B 4UM9D 4C56A 1GOGA 3AUVA 1WIOA 4HXBL 4MWFA 5KEZA 3LZFH 3LHPL 2BHZA 4FCAA 3RWHB 4G2AA 5AAWC 1E6JL 5J3HC 1T6BX 5DQ9B 1T1WB 2OXGA 3P9MB 4B96A 3H53A 4U05A 2XJLA 3BLPX 3UADA 4B6ZA 3ARUA 3B83A 2WLMA 2FEEL 3TYFB 1QUNB 1ZT4B 5JW3L 1DVZA 2DTSA 1OKEA 4ETQB 4RGNE 5C0CD 2VLLA 5IW1B 2QZQA 1NCIA 3AMKA 1E50A 5EBMA 1S9WB 3RWFB 2AV7A 5DRXA 3GNMH 3LB6D 4OIIL 5GJTL 2OR7A 4ZUWA 3IDMB 1JZ6A 1WCBB 2Q6WA 1FLRL 3DROA 2J7LA 2R0LL 2PF6A 4W4OA 2C9SA 4IBVA 2V33A 4K8RH 4DIXA 1KTCA 3LS4L 5M7QA 3MCLL 1JGVH 2J8UA 2PPAA 4NFBA 4AGLA 4MJ2A 5KYXA 1BD2B 5CBEB 1IARB 3MBWA 2ZCZA 1DLFL 1TJXA 4IU3B 4JAMB 4S1QH 4L3ED 3TH2T 1JXKA 1IM3D 4DAGL 4TNWF 3PP4L 4R3SA 1F11A 4ISVB 3FONA 3L16A 2FYYB 2NX5E 3JZ7A 5EEUA 2OI9B 4NHUA 4F8QA 1UWEL 2P8MA 4UAOB 2M83A 5F97E 2VJXA 3OKDA 1DQKA 1Z5HA 1JZJA 1OQOA 2DJSA 2MEJB 2JKSA 3QI9B 4X4ZA 5IWLA 2H3NA 4XZUA 1RMFH 3UTSB 2C26A 1YAIA 4QDGA 1A9BA 3NESA 3GM0A 3KLKA 2J1ZA 3TTYA 1BXXA 4TPRH 4G7RB 1IILE 3LRGA 4B97A 3CSBA 1L9MA 4HUWB 3K2MC 4H1LB 4EI6A 5IMOA 3RIFK 3UTPD 3RWCB 4X7DC 4YSUA 3D3VB 1XH1A 5EU6D 2AGJL 1SRDA 2F54D 3MYJB 2DI8A 2D7MA 1G9NC 2D8KA 4NRXA 1BP3B 1HAUA 1DQIA 2J57A 2OAAA 4N6QA 3M1CA 4LSRL 1P1ZA 1WBZA 4NQSA 4DZBA 4IIQA 3ME0A 1PSKH 3Q1SH 4G42A 2CLRA 2WPGA 1D7FA 4OFPA 4Z7UB 3K4ZA 1ZLVK 1X5ZA 3DO3A 4YDLB 2CWRA 2QADB 4LQFH 4MZ3A 3T2PA 1K8IB 4UMGA 2FLRT 5FDWB 1H19A 4HS8L 2R1YA 1FPTL 1HYRC 1VCAA 3GHEH 2ZUXA 4FTVB 4WFED 5FYLE 5CZVL 4OF6A 2VW6A 4X6DF 5HDOA 2YGVA 2WHVA 1IB5A 1GS7A 5AWNL 3GJEB 1WG3A 3D12B 2UVEA 2X4UB 3H7LA 4ZXBC 3SCMB 5HHQB 2V5SA 1FO0A 1NDTA 3QRBA 1OGTA 4JDVB 3Q06A 4JZJB 3F7YB 4G7QB 3HRPA 1OAKL 3BN9D 4BUGA 4BD4A 1OCOB 2NY3D 5JPNA 5F6HI 4PRAB 3NSJA 5ESQB 3L2LA 5BQDA 1R0AL 3A6OA 1YN7A 4NZ8A 3GSVB 3IXTA 3FOMA 3W9DB 3ARGC 2ZNWA 1P7KA 4GAJL 5L9DL 3VW3L 3NYKA 1QTPA 1RUML 3I9GH 3Q5YA 5HGAB 4Y5VC 5EUOB 1P5UC 3V5HB 3PWPB 2JK5A 1CGTA 4UQBA 1WPCA 3K80A 1JGLH 1UACH 4MA8H 2MNUA 1DN0A 1RHHB 2QTVA 3DMMD 3BP5B 4I0KA 3D2UA 4G8EB 1OAZL 2V4LA 4XMLL 3T2OA 2WB7A 3N0PB 2QHRL 4K94L 3WY3A 5E6ID 2BSRB 1CFQB 3BKYL 3PDDA 1FVEA 1YEGL 2XN9B 2MQ0A 5AZ2H 2IV8A 1S5IL 2HN7A 3MX0B 1BQ5A 4LOUC 4NJ9L 5AOMA 2MNWA 2JQMA 1FVCB 1G7IB 1NFIA 3QNFA 3QB7C 4ERSH 3QIWD 3LMJH 1CK0H 4L9LA 4K9EC 1VCBC 4GEJA 2I9TB 3L13A 1X7SA 2EIJB 3A22A 4PLJC 2RQ8A 5AALA 3DIVA 1XXDC 1BGXH 1J9RA 1TEYA 1LK2A 1IFHH 2CGRH 5KYNA 1RIHH 1E4WH 2CM5A 4JFEB 1GHFL 2PYED 2XKNB 2QQNL 3P54A 3OM3B 1PJWA 4PGBA 2DQTL 4K7FB 4WW2B 4M4RB 5GSRA 1D9KA 3ZOAA 1JYNA 4XNZC 1J8HE 2X6MA 5T5FA 7TAAA 3RKDC 1R24A 4B5ZA 1UOKA 4EPSA 1A6AB 4OCRL 1FE8L 1TLKA 2FB4L 5DJ0B 1O7DE 4XO3A 1NDMB 2E56A 3CZSA 1KGIA 1Q1JL 5C0NC 4PR5B 3C5JB 3QJVB 5I1CH 4AGPA 3G04B 1AJ7L 1TTFA 2GHZA 3QCTL 4FQJH 3T77A 1EO7A 5SWZB 1F90H 1U2CA 1INEL 3FF7A 4DQOH 2CPUA 1L7IH 1N70A 3PL6B 1M2OA 3C5SA 1G1CA 2J43A 3PGDA 4JPQA 1R3LB 3A4FA 4YSQA 4OSUL 4OCYL 1M6OB 1ZT1B 3OL2A 1NCCH 4G9DB 1L4IA 3BWUC 1YPZA 1OTUD 4KXAA 1W2KT 1LO0L 4G80A 4CU7A 3QJHA 2X05A 2YKLL 1CO1A 1WFNA 2E9JA 3VNZA 1IAOB 1E30A 3ARWA 4U6VL 3KXFA 5EN3A 3S96B 2CLZB 2JJSA 5K9QG 2OBGA 2IDSA 3EO1A 2X1OA 6PAZA 4AY0A 4AIZB 2P80A 2NXZB 3FRPA 4LMQI 2JE8A 1AQ8A 3TS8A 1KXTB 4XNDA 3GIVA 1ITCA 2TRHA 3DVFA 3QT2A 4U6HB 2NSXA 1B2WH 4OJYA 2A6KB 4CVXA 1W16A 5IJVA 2IF7A 4IBZA 3H4HA 1T7VA 4B9GA 4Z7WF 5EC1A 2DLHA 1IGTA 3BI9X 5F6IC 1J1OH 1JK9B 1LHZA 5ACZA 2LTQB 4PW3A 4S0TD 3ZK0A 3OHXB 2NTFA 4RGMC 3H9SA 4OKVA 3B5HA 5AOLA 3L5XL 5KVGE 5DD0L 2PTTA 4PRHB 4OM1L 4XPAH 1KYAA 2APTA 2FWLB 1GKOA 5K1JA 2AXJA 4Z0BH 4AGQA 1HHKA 1T1XB 1M3IA 5DCCA 5FKPA 1KZQA 5DA0B 5DZOA 5I1AB 5IFHH 2ED6A 1G4MA 1DJHA 1U3NA 4HFWB 4NYLA 4QHKI 1Y6KR 4D3CH 4FXKC 1IEAB 3W2DL 2YIHA 1TJIH 4NIKB 4V11A 1G6RL 2R56L 3G5XA 3SY0A 3VXNB 2VCOA 1CMOA 3GXNA 3ATDA 4NQTA 2MQCA 1XGUB 1ILSA 3H56A 2EC9U 4ZMYA 4KK5D 4QHMB 5C0EA 2AQQA 3EH2A 2JJTA 3ZTCC 5T3ZE 4XOAA 1T03H 1G7PB 3EO0A 3I2CL 1XCQB 4Z3EA 3IJEA 1M1XA 3IDUA 4HCGA 4LCWE 4HOZA 3KPLB 1BBDH 1E4HA 3PXJA 1PKQA 2J4WH 2X0VA 5GISH 3MRFB 1YO4A 2BP0A 4PGJA 1U8NA 4Q4EA 2WIMA 4JVUA 3C6LA 2AITA 4DKEL 1CU4L 4Y16B 3HEIB 3HN5A 1DE4A 5K9OB 4PV1C 1F4AA 4X4XA 1UGNA 1V7NH 4TNEA 1FC1A 5B3SB 4G5ZH 1A9VA 4Z95L 4K2UH 1WTLA 4I77L 3C5ZA 4EQ2A 4GLRH 3L3OB 4Q6IA 1DQLH 4TLUA 1KXQA 1UUNA 1JWUA 3UP1A 1J9TA 5EORH 5L4JA 1L9TA 1F13A 1U8LB 2BP8A 4DERA 4L1TA 4N2BA 3WE6B 1S5HB 3WDIA 2F6AA 2BNRE 3HAEH 4KX7A 3VXME 3P02A 3WTTA 3P73B 1QR1B 1F6LL 2DD8L 2VDKL 3OLGA 4KKCC 5F3FA 5LBVA 1GGBL 4RBPH 4EVNA 1JPFA 5G4OA 3EG9A 1KN4L 1WQVT 1WT5C 3FHQA 4OGAD 3WSQL 5DU7A 1EGJH 2XQYG 2TAAA 3MBXL 5D9SB 3WGVB 4QRPE 2YJLA 1ID5I 5DHVA 1B9ZA 1BZ9B 4OLUL 5CILH 3SKUD 5I24A 5LGHL 2CK0L 1RCYA 2GJ6D 3OMNB 4WDIB 4Y8DC 5DRWA 3WFDL 1DQQA 3B56A 5EFIA 4Z7OF 2WZ0A 1DSFH 4XC3H 3UBXI 1G7JB 2KC0A 2Z93B 4JPIA 3B5GA 5C2UB 1E8WA 1UZ8A 4GSRA 4OZFH 1CE1L 4N2EA 2G0LA 4HPYL 4X6BB 3OMAB 5ACLA 4YGAB 4PJIB 4BSWA 5IMKA 4OZIB 12E8H 1TETL 5E94B 1Q9KA 1JHTA 3TF7C 2EABA 1NBCA 5A2AA 2D7NA 3UTQA 1U95B 4KVNH 1DN2A 4EIUA 5BVPH 3HTLX 3MJ7A 1N5AA 2JCCE 5FHAL 2F1EA 1HH6A 5B3NA 3HG0A 3N44F 4PJCF 4WI9A 3ZE0F 3GBLA 5I19H 4E9TA 3WJLC 3O3AA 3Q3GB 3WKMH 2HWZH 3IDJA 5E70A 4AEFA 2YHGA 3TEZA 4TVUA 3BCFA 1HL5A 2AW2A 2CDFA 4CVZA 4PV8A 2XRAH 5I74C 4O58H 2FJSA 1B0WA 3GXUB 3RTLA 3MFFA 2FK9A 3IMBA 3EGDB 2X4NA 2H2SD 3LPWA 4M6OL 1XBDA 2VLRB 5G4MA 2Y23A 4XT1C 1EX0A 1J8HD 3NFPB 4NZTH 4D0BA 4HPOL 4KDTA 4RCAA 4ELMF 2R0KL 3NGBB 4L8DB 1MW0A 2KS0A 3L5WB 2DWEB 1LO4L 1Z9SA 3IK2A 5C0JA 4RVBA 3PXHA 4LSQH 2V2XA 3CHQA 1LP9A 3O9WB 3OGCA 1ZGLM 4L3AA 3LRSA 1EHLH 1UC6A 1L9QA 3RBGA 4GO9A 1C7SA 5DVNA 4Z7NB 2G75A 3P4LA 4NT6B 1WAEA 3UJJL 3MRMB 1Y18B 4FKEA 4FYQA 2B2XH 4KKBC 5C0IA 3U0PA 2DQIL 3KPNB 3MXVH 1MRCL 1V3KA 4FI6A 4JKKA 4J6IA 2J8OA 1DVTA 1GGYA 1A8ZA 2VN6A 4FQ1L 5JUEL 2XU9A 4NM4L 3TYGL 1AY1H 2HKFH 5I8EB 2WQWA 1J1XH 1MJJB 2EXSA 5D2LA 4JHAL 2WNWA 3SBRA 4HKZB 4XPTH 3WFCL 1BOGB 1VB9A 1RJLB 4JCMA 3TO4A 5I1KL 5IQ7H 2IH3A 2ZAGA 4YXKH 4YHOL 2VXSH 3L7EB 3G08A 3IPBA 5ESVB 2R2BB 2F74B 4LEEA 3O41A 1H8LA 3QZOA 3IBOA 4P5RA 3OJVC 1QFUH 2YRZA 5GGRA 4QRFA 4KQ0A 4ZW7A 4E9XA 3VFRA 1T2QH 1UFGA 4GUPB 2BH0A 1I1RA 1BAGA 4NPJA 1F97A 1UXMA 3FAXA 1SLXA 2NNXA 1RSFA 2G5BB 3C6SA 4CA4A 3EHBB 3VA6A 1FDLH 1FFOB 3DJ9A 3IAPA 4KWUA 1F4HA 2EVFA 1GAFL 3FTGA 3EJZD 5CP3H 1XZ0B 3H3BC 5IROD 5SWSE 1NAMH 1WIPA 4UTAA 3DIFB 3S34H 3ZE2E 3K6IA 4PB0H 1NBVH 1XFPA 2PXYB 3DXAD 4GG6B 4C56E 1PLGL 1PZ2A 4YUEL 1AQDA 5EO1A 4FERA 3SBPA 2VZ3A 4S1SH 3U30B 4AQ1A 4XB7A 2AXGA 4R7DB 1HZHH 3CFDA 3P77B 2OR9H 3RB5A 1FI8C 1P9MC 4KXBA 4KY1H 4PW4A 3BX7C 5J6GA 5KVFL 1GGCL 5GGUA 5EBGA 5IUCA 2EYRB 3S5LB 4Z0XA 3MQIA 4KQ3L 3LNIA 3VFWA 4FEMA 3G9AB 3GMOA 5DDHB 3REVA 2IAMD 4LCWD 3RVXD 4B9ZA 4LEBA 1BLNA 3GZPA 1I1AA 3V0FA 4W70A 4XN2A 4GMSL 3NZHL 1H6FA 4GRLD 1HCFX 2GK2A 5DEZA 4I4WA 5C0RL 1LNUB 3RGVB 3BIBX 2JQAA 3QR0A 3JYBA 2IH8A 3LH8A 3L95A 3MNWB 1G0YR 2YO3A 1GJUA 3I6GB 2OTPA 4POZD 3U4BL 2IH1B 5K9KA 1UD5A 3KS0H 2C4XA 3QIBD 3F2LA 4M5SA 4FXGB 4H8PA 4ORGA 1DQTA 2AEQL 1ZLEA 1EMTH 1RIVH 2OMWB 2W9EL 2W0PA 3L45A 5TPWL 2BNRD 4UUJA 3V5KA 2Z4TA 4AV4A 1VADA 1N10A 1HWGB 1NKOA 1HQ4B 3K7UA 4YHPB 5BCAA 5FW6A 2X4TB 5I5RA 3S3CB 4U3XA 2A77L 3S9DB 2IPKA 1FPTH 1MEXL 1A9EB 5D5MF 2B39A 3W38A 4QRPD 5CLZA 5CZVH 2HVKB 4OLWH 5FO7B 4YAQA 3ARTA 5EUKA 4MD5B 1AANA 3JT2A 1FNFA 3OKMA 3FQ2A 3QORD 5TDNB 5TH2B 5C0AA 1ET7A 4X5QA 2GTWB 4I88A 4MA7L 2O61B 5LN8A 4N2LA 3BUDA 4BDVB 5ID0B 4CGTA 4RMTA 4RA0C 2CBTA 3HZVA 3MLSL 3VXSA 3FCBA 2MSPA 3C9NA 4FQHB 3B5TA 2YGPA 4OF3A 4V2CB 3MV01 5DHYB 4A7TA 5GGRY 4OLZL 2N0MA 1YEDB 1XH0A 2BNQB 4IBTA 4MX7B 5E7FA 1LJMA 5AUMB 1R0AH 5A2CA 1AHKA 1I3VA 5IQ9A 3BFQG 2BWIA 1KT2A 5D4HA 1JPEA 3CC1A 2BVQA 4GAJH 5DUPL 2CO2A 5DI8A 1DDHB 2H3XC 3UEZA 5EBLB 4RSYA 2EXYC 4NUGL 3SQOH 3E6HA 4M7LL 4TSAL 3VACA 4BHUI 1RFDL 3BSZL 3VRLF 2CHDA 4F24A 5BO1L 4FNLH 5E1AB 4HBCL 4GNKB 1JPTH 2APVA 3DVIA 5FKAB 2H1PL 2NNFA 1MUJA 3HE6D 3AT0A 1L9OA 5JMRA 1RU9L 5BZXA 3WD5H 1YEGH 4GQRA 2AXHA 1KB5A 5E5RB 3SHSA 1A4KA 1R3IL 4PRPA 1YAZA 4GBXD 2ICEC 4GSXA 3QQNA 1AYRA 2VDRL 3WTVA 1QO3B 4Z23A 5KUKA 3EFOB 3RGHA 1JMXA 2X9XA 4QI3A 4M4PA 2E7LA 1R6VA 3A6CL 2CBQA 4U1JA 5SV3A 2D2OA 4NKOB 3QUYD 1KPVB 4TVPD 1VACA 3OC5A 3PHAA 5DD1L 3D4CA 4NKMB 3JWNE 3LDBB 5L2JA 4GAYA 3ESVF 1MIEH 5DHMC 4F57H 5ITFA 2CDEB 3B9AA 3BWUF 4LRNL 2X1QA 3C8KA 3OPUA 2YEZB 3PGCB 1X5YA 4NX0A 4LVEA 4G7YL 5KYYB 3IDMA 4XN4A 5AG9A 5L7XL 5FV2A 3B9KD 1SXBA 4X7CC 4HAGA 3VXQB 4BQBA 2ICWB 4M29A 4HKBB 5CEYB 3U4KA 4D9LL 2PCYA 2ZWZA 1Z6JT 5C07A 1P4IL 4IU3A 3UG5A 1QKZL 3MA7A 4OSUH 4FMVA 4G6KH 4U1LA 4HHAB 3RX7A 3ULUD 4FLHA 4OCYH 3K8MA 4KPHL 1NCTA 1P5VB 5DO2D 3QEHA 2YBRB 4KJWC 4P04A 1AD9B 1MVUA 1QSEA 1UD4A 4OF8A 1PD0A 5I76B 4TUUA 3MCKB 4A6YL 3EGSA 3FQUB 4I2XA 4PJFE 4YZFF 4ZNCD 2UZYA 4BE5A 3DK0A 3KYOB 4UBDD 2ZSVA 1SXNA 2HTLC 4U6VH 3M86A 4KNQA 3ZR6A 5H37A 2HRLA 5DJCB 2WXGA 4HIHA 1HFUA 1MHHA 2LAGB 2X2UA 3N43B 4IRJD 4L8BB 5B1JC 4G82A 4HZLB 1HL4A 2XWJB 5I6OA 4FQLH 3BEVB 3V4PB 3TT1L 4P2OB 3LSOB 5F7NC 1AR2A 4KROC 5CJXA 3AADB 5KW9H 1NGWB 4EIGB 4ILDA 5FV1L 3BAKA 3KWVA 4RESB 1BZ7A 1YPZE 2YD1A 1A0QL 3I6KB 3PE9A 1H3XA 1RUQL 3DTDA 2YSSB 5I5MA 1RZKL 1RJZB 1NMBL 3B6SA 4Y1AE 4F8LA 3V6OC 1VF5C 3CG8A 3DRQA 3QH3B 4JG9A 3VI3F 2X70A 4WFGD 4YJZL 1MDTA 1KJVB 3BH9B 1OAQH 5FDWA 1XSOA 2CIIB 1XGQB 3HAEB 5F7BA 1MWAH 4MAYC 1UVQB 3LXCA 4FTVA 1AXSB 3W0WA 4X5WB 3IGFA 3J2PA 4NRYB 3VFPA 5EA0H 2AVFA 3W2DH 5GS1B 3ETTA 3MGAA 3KPSB 4FEIA 3HIZA 4PJGE 3OF6D 2WAQA 3O3BA 1ROWA 4LEOA 1ZSHA 3K1KC 4XC1H 4BA8A 2NY5C 1LO2L 3COOA 2Z7YA 3HE7B 3VWJB 3U0TB 5T1LA 3EDDA 3M17A 2XICA 4UYPA 3L9BA 3DO4A 5D8JL 2F19H 4OD3H 1U8KB 4LHUB 5F70A 1SJEB 1NGPH 2FDBP 3LN9A 2CUIA 2AK4B 4IEFB 4YBLC 3ETBJ 4M1CD 4QD2E 2E7HA 5KVDE 1WEJH 1DBAL 1ZHLA 1XL6A 1KIRA 2M26A 1KF9B 5DJ6A 1ODAA 3UBXG 5BZWA 4BUHA 4N2HA 3D85D 1WK0A 3QNXB 1KPRB 3FRUB 3MLTA 3SDAA 3V5HA 3D9AL 5LBSL 2BWQA 1PNCA 2WXKA 3NRQA 1F1DA 2ZOLB 3DC0A 4HJGA 4K73A 3B9EA 2OL3L 4BEIA 1Y7VA 3A67H 4FZ8L 4RQQA 3BP5A 5KSAA 2K70A 2C3WA 4D0DA 1V55B 2WZAA 5KS9E 2Y5QA 3BUBA 5I0ZA 4JHWL