5I0XA

Copper-bound m90i variant of uropathogenic escherichia coli strain f11 fetp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
153
Chain Sequence
MGFKEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPIVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-handling and Receptor Recognition by FetP and P19 from Uropathogenic Escherichia coli and Campylobacter jejuni
rcsb
source organism Escherichia coli f11
molecule tags Metal transport
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
total genus 26
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5i0xA00
3NRPA 5I0YA 3PJLA 2O6CA 3LZQA 3LZNA 3LZRA 3PJNA 5I0XA 2O6DA 3LZOA 2O6FA 3NRQA 5I0WA 3LZLA 3LZPA 2O6EA 5I0VA
chains in the Genus database with same CATH superfamily
4HBCH 1UM6H 3QJHA 1DBKL 4NZRL 4P46A 1B3JA 1A6PA 3HPLB 4NWUL 3ME0A 1SJVA 5B4MD 3VD7A 4HIIB 2DAVA 3FCUB 2ZWYA 5FR3A 3NG5A 2VLME 3V2AR 1D7FA 1AJ7L 4XB7A 2JB5L 5I74B 3VRIB 2MTAA 2F5BL 5MP6H 4ZUTB 2H45A 2A73B 3O4LE 4F3FA 2W0FB 3P69A 4KGLA 1HHJA 5DHVB 4JY4A 4A37A 1DQJB 1J0IA 1DQTA 5IHUH 2ZWZA 5EZJA 3UIZA 1YEHL 5GRJL 5GRWA 1BJMA 3DVNB 4PTTB 2QPSA 1WZKA 2XN1A 4UZGA 5DRZA 2B1OA 4PWHA 5JIMA 4GAGL 1VGEH 5JUEL 5A16A 5CWSB 3JV4B 1HYSD 4AL8H 4Y1AA 2OAAA 1FHNA 3H9ZA 5EBLA 3CFEB 3VTMA 4KQ4H 3ARBB 4LCIH 4NM8L 5GS3A 5J11C 3GHBL 1QO3A 2ZSWB 1NCDL 3PGDB 5T1LB 3X1NA 4AEEA 3DGGB 3P9LB 2ZNWA 4OFDA 1OGSA 2Z3FA 2MCAA 4FXKA 4KMLB 4PP2A 2VZSA 2BERA 5ITBH 1ODUA 2HFEA 2V0AA 4MD4A 3NSCA 2HH0L 4EE2A 3PNRB 4UT9L 5G4OA 1R6VA 2BXYA 2WWNA 3CVHL 4MCZA 5SX5K 3VFRB 4FTDA 4I77H 6PAZA 1N5AA 2EE9A 3D09A 1Y6KR 3KZ8A 4UBDC 4GRWF 3TA3D 5JYMA 3BIAX 3K74B 3GMNB 1G0DA 1IBGH 5DR5L 4KAQH 5EZPA 15C8L 1IAIM 4B0MB 1T20A 4IGBB 3RL2A 1PZSA 2B2XL 3AWGA 2HRPL 4MA8L 4ORZC 4L8CB 3EJPA 2ENYA 1F6LL 1RULH 3Q3GA 4FLSA 4JFZH 5F6IC 5DMYA 2A6DA 2HTLC 3DOHA 1UJ3B 1AIFB 2MEJB 2VM3A 2X53A 3NZUA 4UQEA 5E6IC 4M3KB 1DVFB 2J1YA 4PRHD 3R7RA 1ZKAA 3QW9A 1CI5A 3ML9A 4PSRA 1PS3A 3TBTB 3HNTL 3IDNB 3QIBD 3HI5L 3KPTA 4JFSA 1IAIH 2QSVA 2DTMH 2X6MA 4D9LH 3HKZA 4JG0L 3L3GA 2IIJA 2WZPD 5IMMA 1KY6A 1MFAL 4P4KD 3TNNA 4PJXA 1SXCA 2ADIA 4GMSH 4MJ6A 4IBWA 3BLBA 1A6ZA 3WIIL 3BJ91 2R2EB 4CDHA 5T5FH 4K8RH 3MO1A 2XPGB 2O6CA 3WOVA 2P1YA 3MRHA 4ELMF 4GXUN 4N8PA 4JO4L 4LASL 1KLFA 1KXTB 3D0LA 2XZQL 3K2KA 4BFEA 5LCVH 3IFNL 5L88H 5BO0D 3GLEA 4P3CH 4BIKA 3C6LC 2VN7A 1NWPA 1T5XA 1U3HA 1NGYB 4XR8C 3MV01 5AB2A 1C08B 1PW3A 3THML 4Z3EA 5F0LB 5T33H 4K3DL 2HLEB 3MRDB 5FLUA 4BFKA 4P2OB 4XVSH 2C1OB 5ABZA 2GTZB 5INDB 3UPRB 1ZLUK 4M5YH 3BWZA 3APFA 3Q1EA 4FQXC 5I1HH 2ZOLB 1P84K 4PLJC 2UXVA 3ROLB 2NSQA 3L48A 2CRYA 4PW4A 1OCRB 3DO7A 4ZOBA 1ZT7B 3NACH 4Q14A 2BCMA 2RD0A 4Y1AB 1EO7A 1EFXB 1U4EA 2AV7A 5T3ZD 1E28B 2VISA 2J6EH 4BHUA 3H0TB 2XZQH 5EOCL 1IZKA 5KVGH 1IVTA 4MTMA 1G7PA 4UOW0 3FOMB 4XXCC 4JPIB 2N7AA 2VWEE 4WI3A 3UGEA 2Y7MA 1RUQL 3TEUA 1A7PH 4I18A 4LQFL 3MCG1 5E6UB 2WLIB 4FA7B 1QRKA 5T33L 5FYLD 2XWZA 2BRRL 1KYUA 2BS9A 4Q58C 4U1IB 4ZFOL 3NFSL 2EXWC 3LH9A 4XRCB 4R8WL 4L3AA 4XH2A 1VF5C 3L8QA 3RY5A 3WS6C 5FHAH 1O9WA 3RWIB 4JM0A 4AQZA 2JB6A 4CADA 4HLZH 1BZOA 3FTVA 1FSKC 5HBBA 4FYSA 3OLGA 4HOXA 1U2CA 3MLVL 2P8PB 4XVOA 3QUMH 4EIGB 2EAEA 4NHCH 4JN2A 3K2UH 1PNDA 5C0BA 4EQ2A 4LSTL 3CSBA 5CSZB 4P2CG 1A4KA 2AFNA 2HCZX 3IEAA 4PREA 2HA1A 2F5AL 1G7HB 3BAEH 1C12B 3VU1A 3WYRA 2GJZB 3DVIA 3WDHA 2FBJL 2X9WA 1SBSL 3LZQA 2N7SA 4MNGB 4X4ZA 4G6ML 4U1KA 3TBTA 2RH0A 2QPDB 3WY3A 2FQFA 1XGRB 3H42L 2AJVL 2QQNH 4OFPA 5E6SB 1JHTB 1Q9LB 3WAJA 2X0UA 1U9KA 3FSVA 4LCWB 2BJML 3TJEH 4PSPA 4OQTA 3UL4A 1TJGH 3CK0L 4UYPA 2WWOA 3CHQA 1ZLSH 2MCPH 2EKSA 1P5VB 1VRSA 4JN1L 2IH3A 4OZGA 5EH1A 2DM4A 3SO3B 3MO1B 4AW4A 3LD8B 4PWIA 1MCSA 5DCCA 2NPLX 4GG6E 4KRMB 5JR1H 1S7VA 4IS6B 4BZ2H 1KLFB 1KXTA 5F7HA 2NRDA 5E23A 1SHXA 2LGNA 5E2TL 3DBXA 1K6QL 1UD3A 2W9DH 1KJMB 1NOAA 1OEZW 1G9NH 3X2QB 4KXZI 2OMWA 1ZVYA 5A7EA 3K2MC 3K72A 4UT9H 1V3MA 1IQWH 5KVDH 3H2PA 3RILA 1KN2H 2VM4A 3BO8A 2HX9A 1KCVL 1T5WB 4XOEA 1N64H 4N5UA 1S9WA 2OX5B 1KFGA 2VLRE 4YN3A 4BZ2L 1GPOL 2DWEA 1FZKB 4A7SA 4IOFD 5IKCB 1JBJA 2WUBH 1TU2A 3DJSA 3PIQB 1EZVX 1O7VA 3RGVD 2H1LM 3ROLA 5HHMD 4IU3B 1COBA 2EH8L 4PW3A 1WS8A 4R96B 1M2VB 2YXVA 3KL3A 2O6PA 4YXKH 5EBWA 3DSFH 3QULA 5AOLA 4NNXA 1AHWA 1W6WA 1TNMA 2XKNB 4DW2L 2QSTA 4KDTA 1URLA 3TEXA 1GGTA 4P5TA 4XAWL 4Y16D 4BFBD 3CXHJ 2HX8A 2VZTA 3KPMB 4NRYB 4HHWA 2X3AA 4Y5YB 1ZLVH 5FUCC 2BC4A 1AO7A 2V7NB 3LX9A 4BCZA 3BRDA 1RKRA 2RQ8A 4WUUD 2EP6A 3L4VA 3W0WB 4QHMB 3RL1A 1HHGB 5CEZL 1BZ7A 2Y7OA 2OYKA 2DY2A 3I02A 2Q87A 4JHAH 4YEEA 4JRXA 5DR5H 2X4OA 1Z9MA 4G9FB 4RAVA 3NJJA 3LHPH 5C08E 4HCRL 4CN6A 1MCJA 1MFVA 4W9LC 3CZFA 3HVNA 2OQJA 5ICXA 1N2RB 4Y0GA 3WKNA 5EEXA 4J3SA 1EMTL 3TBYB 4EUPH 4QO1A 4HJGA 4N2NA 3NJKA 2HPTA 1FYTD 4BZ1H 1LD9B 2N4IA 4PQXA 4NO0B 4LVEA 1IC1A 2KYIA 4FQQA 1YEKL 5LWYH 1VJSA 2Q2EB 3L3JB 4YHIB 4EZMA 3WS3A 4JGMA 2FAUA 3OG6B 2GAZA 3T8XA 3Q8BA 4I87A 2QMKA 3DSNA 4U1KB 2YAEA 2ZE0A 1EMTH 2H32H 3NIFE 1AZCA 1FZOA 4YE4H 1TXKA 4YBHA 1E6OH 2GTWA 3L5HA 1SDDA 4WW2A 1MAJA 4UT9A 3WLWD 4C47A 2PYEA 4KO6A 5F2FA 1JK9A 3CGTA 3MUZ1 5KJ7E 3D50A 4G8IA 1J86A 2Q1EA 3NACL 1B6DA 1TQSA 3A67L 5G4NA 1VGKA 4N8CL 4YBQD 2JXMB 3ESPA 2MIZA 1KJ3L 4LNRB 2CJUH 2BOLA 4GEIA 1A2YB 1MCPH 1QKZH 3LH2H 1I1YB 43CAB 5C71A 3QCTL 4PJEE 4HXBL 5GGUA 3PQYA 4XVSL 2EECA 3I3BA 2BY2A 1YUHA 4Y5XA 4Z3FA 1FLTX 2Z9TA 3LRSA 4HUNB 3WEOA 1HXMB 4LSQL 3WMPA 2XETA 1SEBB 3MRQB 4EN3A 3KLLA 5CSBA 1ZVSA 1FYTE 2LU5A 4L5FE 4LGPB 4M62L 2NZIA 3NRFA 1T5WA 1M7DA 4X5WA 3QJZA 4ZMLA 2RGSA 1KB3A 1UWYA 2CUIA 5E5LA 4MLIA 1YYCA 2VDKH 4M5ZH 4NN7C 3MNZB 3O0LA 3FU3A 2ENQA 3BKCH 5FYKH 3FTGA 5M7QA 4NP4L 1PZCA 1QPKA 1YPZF 3BSZL 2NNCA 3EJYD 5EZLA 2ZP9A 4HSAC 1A14L 3GI9L 4TPRH 1K72A 4OJFH 2N1KA 1IGFL 4ELMA 3HUJA 3MTRA 3FCGA 1JN6B 3QAZC 3SKOB 3K8LA 4LSVL 3TA3C 3WI9A 1E4HA 2CO6A 1YJDL 4I5BA 1YEHH 1CLYL 4KNSA 5GRJH 1UVQA 1CLZH 4QHNB 5JPNA 1AHWC 1PD1A 1UOKA 3PFQA 2UY7B 3MRLA 3P73B 1G1YA 4XCNB 4HMCA 3TF4A 1KCLA 5BOZG 1ETA1 4XC1L 5KW9H 1X6NA 2VOTA 5K1NA 4G7VL 2EDTA 2YIHA 1FG2B 1MHHA 3HZYB 5IEHA 2CH8A 2WKOF 5DJZB 5CEZE 2Y6SD 5CJXA 4BWTA 3U0WL 1DN2A 1S3RA 4KMQA 3KPSD 4QRPA 4XNUL 5BMFL 5BZDB 2CU9A 3SDAD 3VFUA 1KEGH 4K5MA 4A1RA 2E59A 3S8FB 1FNGB 3MRCA 2A6JA 5AKTA 1FNLA 5DK0B 1AXSA 5ILTL 5CKAA 1DO6A 4HIXH 5D2NA 1C16A 3CVHH 3GKWL 3MA9L 3UZQA 3H53A 3WS3B 2YUVA 1S5IH 2AEPH 2ZCKL 4JCWA 5A1AA 4WO4C 4ZFFA 1F18A 1HKLH 3TBVB 1UGNA 5KG9A 3B2DC 5E0FA 1RSFA 2VDOH 3QNYA 2IXQB 5FWRA 1GKEA 1RK7A 3S34H 2E6JA 1N6QH 2Q8BH 4PVLA 5IMKB 4PYHA 1OGTA 1AG0A 1U8KB 4GT0A 3MOBL 4HH8A 5A6LA 2BVOA 2BRQA 3H7LA 1ZA3B 2NX5A 3NZ8B 1O0VA 5B1BB 3S6CA 5C08D 3UJJL 4LKCA 2HX7A 4GW5A 5DD3L 3O41A 3GM8A 4YDZA 1NIAA 3IVKB 2BY3A 2G5UA 3C5ZD 3HMXL 4NNPL 1I1YA 2ZCZA 43CAA 3FFDA 5K39A 1VESA 5KJRH 3GKWH 3MA9H 1D6VL 2V5SA 2JKNA 1JE6A 2FYYA 3PJSA 4DZ8B 5B39A 2XWDA 4OZIF 4HFWB 4MD0B 2OTUA 1TZGH 3ARFC 4Z3IA 4N2KA 1SEBA 3MRQA 4ALAH 1NC4A 3A4FA 4M7JL 4KDTC 1SNRA 3VWJD 4UM9B 3LDBB 4L8SA 4M6NH 1MJ8L 2OJEA 1Q94B 3QZWB 3WN6A 4HPOL 1TQTA 2OMTB 1P4IH 3P2BA 3VGAC 1CWVA 3D4CA 3D3VD 2G5BB 1ETJA 4Q9BA 2DJSA 4NKQB 2X4RA 4JR9L 4M5SA 1BQHB 2B20A 4LARL 4AC2A 4ZXBC 1BBJA 4MMZB 1RZ8A 1GGBL 5GGRA 5GZNA 1PDKB 3OWRA 1TSRA 2AJZB 5J6HB 2HJKB 2W94A 3HUJB 1SHMA 4FL4C 3DPDA 4FXGB 4W9FC 1JYNA 3NSFA 4JQIL 2Y3NA 4XWGL 3BQVA 5K59F 1IM3A 3WIFA 2VYRE 3FT2B 4QXGL 1NGWB 2OMUB 3U82B 5A2KH 3L3HB 25C8H 1LO4L 3V10A 3NCMA 1MFEL 1CTOA 3PYCA 1GS7A 3MBEA 2E3VA 4J3BA 3S36X 2X2UA 4XZUA 4IK7A 4JFYB 3HZYA 5AWNL 4XI5C 1NCOA 1RJYA 2VMFA 3S37X 4Y5YC 5IEHB 4KHTL 1OSYA 2UYLB 5JDSA 5HYJB 2VLJE 2BO0A 5DD1L 5AAWC 3CPUA 5F7BA 4IMLB 1WF5A 4DPRA 4Z7WF 4P5SA 4DKFH 2A77H 3FCTA 2VIRA 4D9QE 4FNQA 4KRPD 5TFSH 5IQ9A 5A2AA 3EFDH 1U2HA 1FNSH 1E2VA 1MZZA 3T0EC 2BS8A 1AXSB 2DW5A 1L9QA 1MNUL 1LTXA 3SPGA 1F90L 2JKLA 3CQFA 2XXFA 2JTYA 3PF2A 1ML0A 1R3JB 2QHRH 4N1CA 1BFTA 2XXGA 4WIQA 1T1YB 3QUKB 1HOEA 3FJTA 5BRZB 3H1ZA 4OR1A 4BKLA 1AQMA 2D3NA 3Q1SH 3ZE2F 2JV6A 4IMKA 2HG5B 4EIBA 1QA9A 1DQLH 1CGSH 5DZJA 1DQQA 5C0RL 2ROYA 2DM3A 3O6FA 3O9WD 3OWEA 1T4KA 4YVUA 3SDDA 4EZKA 4U4IA 2EDEA 3PGFH 2JJTC 2WO4A 2XV0A 1XGPA 4DQOH 1S9VB 1H15B 2AAVA 5D4JA 5TFSL 5JW4M 1Z32X 2MMXA 3MJ7B 2IWGA 4HX1A 4WHYG 3UG5A 1MRDH 3ZDYF 2HT3D 4LLWB 5IOPA 4QRTA 1FL6A 3QPXH 5BXFA 3VFWB 2PN5A 2OSWA 4Y19A 3LIZL 2K3HA 1I31A 5I24A 4PS7A 1CD8A 1OP4A 3DKHA 1MEXH 2R39A 2Y72A 3KLKA 4LOEA 3ARFA 1M3IA 2NNFA 3EFFB 1SDYA 3L17A 3QJFB 2OMXA 2DMCA 1LP9F 5I76B 1RU9L 4YR6A 1TJGL 3T6QC 5EG6C 5AKVA 3U6RB 1KDIA 3U7AA 1UA3A 2BP0A 4IKKA 2R2CA 3OGCB 1SEQH 3QIWB 4JJ5A 4KPHH 2ITCA 5C9JB 1Z0NA 1TJIL 1X5LA 3MBWA 2YJLA 4BDVB 1G0YR 4HWZA 5LG6A 3CLEH 1ZSDB 1B0GA 4OLXL 3E8UL 1RZ8B 3MNVA 5JW4R 1J8SA 2J88L 4LF3B 4B50A 3KJ4B 4YFDB 3ZYJA 3DVGB 4R4ND 3M6DA 3O4LD 1D5IL 1HQRB 2DN7A 3HLAA 1QBMH 4ESKA 1AHKA 2AQ2A 3RFZA 1YMMD 3FAXA 1FFOA 4N9GB 3DO4A 3NJLA 1LE9B 5DJXA 1HESA 3QFJA 1QI4A 4QGTA 2ZYRA 5D7SH 1DN0A 4HXBH 5FUOL 3JWOH 5HVGB 2VMDA 4RGMC 1YDPB 4DFIA 3G5ZB 3INUH 4JFYA 4Z7OE 4Z7VA 1VA9A 4J3OD 5DQJA 5HYJA 4N8UA 1I8KA 4WWOA 4XMXA 3OR6B 2I85A 3O81A 2QDWA 4QRRB 3PWUB 1P1VA 3ULVH 3G7TA 1IAKB 4J39A 3CHOA 4H25A 3VRJA 2KLRA 4JZJC 4P2QE 3LV3B 4GQZA 3U4KA 2EDRA 3MZGB 4PCKA 2G4GA 3ZL4L 5BQ7B 2R4SH 3GIZH 4LP5A 4K3GA 1D5MB 2FB4L 3INUL 3L1FA 3PNWB 3WL9B 1REIA 3RWGB 2FHFA 4OCXH 3UAFA 3S8GB 4HLEA 3CFBB 4OIFA 4ADGA 2APWA 3S34L 2A9AA 4EBQL 2FBRA 4HUKB 3STLA 2AK4E 5D2NE 4ZPVA 1S2EA 1MJ7H 4YHPA 3ZKQD 5KVEE 4JVWA 5LDUA 3ZE1F 4F57H 3FK3A 5AB9A 1QAWA 3FQTA 1KCWA 4KUCD 4U3SB 3QG6A 1A6UL 1WFNA 1EGJH 3S36H 3KAAA 5DQ9A 4N24A 3WEMA 4AL8C 1ANUA 2HJFA 1YMHA 1WBZA 2IGLA 5DFWH 2H2PC 3ZKXC 1K6QH 1XGPB 1Z9SB 1H15A 3D9AL 1KPUA 1I7TB 3IDMB 1A4JA 1IBHA 1CGWA 3IU3B 3I75A 2P8LA 2WQVA 4Y5VC 2WGXA 1UB5B 1A21A 5F1KC 1SDAB 2GSIB 1FBIH 5C07E 2N01B 3CFJB 3IXAB 2IWKA 5CLZA 1VFBB 3UTZA 1BZ9A 2B4CL 2XYBA 1A9EA 4HGMA 2VLJD 1GOHA 5HI3C 5I6OA 3QE5A 2NT0A 2VITB 3H9SE 3C6SA 1IIKA 3H56A 4OLVL 4YR6B 3BEWA 3DDGA 2VE6A 4NIYE 2DL9A 3L3KB 1MY7A 1TQCB 2ZUUA 1D5XA 3T71A 4PVBA 1C5CL 5HVWA 3RJQB 3VGDA 3EYVB 3IDXL 4Y19D 1HCZA 3MKGA 3B5HA 5HDBB 5D1XA 3DIFB 3OJDB 3UAEA 2BVPA 3EH1A 2QLVB 3MJ9A 1E5BA 2LOEA 5H2BB 3L4CA 4ZTEA 4JKWA 1U42A 3CJJA 4LF3A 5TE4H 1DVQA 4FE9A 4HIEA 4DVBB 5H4ZA 4IBUA 3OSKA 2D3LA 2NY5H 2ZG1A 3QCUL 1FVDB 3ZDZE 3HJ0A 2OK0H 4M62H 1EVUA 5GPRA 2Q8AH 4JFXB 3ZRFC 1FZMB 2XVKA 5DJXB 2XOTA 3NOIA 1DVXA 2R56L 5F9WC 2EDJA 4RAHA 3PV6B 3DX3A 3HC4L 1JPFA 3GS0A 2DRUA 3PHSA 3LQAH 1A9BB 4KH9A 5EA0L 1GGCH 1T1ZA 5KVFE 1BFOB 4W4NA 2NY1B 2GK2A 2I5YL 5CGYD 4GSXA 1L3NA 2NY1C 5JW5B 4IRSD 4UTCA 4ALAL 4KOCA 4DVRL 3B9DA 2OFQA 3FSWA 4G42A 4RISL 1WA2X 3HI1B 3DK2A 4PJAA 3BAJA 1MG3C 3HG0A 4TVUA 2FEEI 4PV8B 3VRJB 1E4KA 3GJEB 4JHZA 5J6GA 2PPDA 1WC7A 2QVFB 2ATKA 2NX5E 1GHFL 3VFSA 3ECQA 2WXKA 5AW6B 3RWGA 4L1BA 2XN9D 1EXHA 1ZEAH 3FT3A 2OMZA 5FB8A 4Y4HB 3STLB 1JF5A 3CUPA 4ZMZA 1GGIH 3KGRA 4A55A 2Y2TA 4NJ9L 4N2IA 1KNOB 3QXAB 1JV5B 1E67A 1LO0H 2VKXA 4HJ0C 4HC1H 5E99L 5AW8B 1MCIA 1TQBB 1YEKH 5LWYL 4MWFB 5I16A 5B3NA 3IU4L 1P5UA 1ACYH 3SYAA 4JDZA 1KLUA 4XNZC 2P24A 2GY7B 2D4FA 2C4FT 5INCB 1GGIL 5GGSB 4KZ0A 1I7TA 2Z8RA 3IDMA 1P69B 3NDYE 5GS1C 4N3UA 4KJYB 4F37K 5BV7C 3DMMA 2IDCA 4JMNA 4L8SC 5HVHC 1CDCA 2WTRA 2YARA 2EXYC 4JANB 2E56A 4KZEH 3QI9D 5JO5B 3V0JA 4HALA 1CK0H 1EZSA 2R1WA 1T1XB 4PRIB 4UIKL 4BFOA 2XACC 3H3KA 4K2UL 4OQTL 3BGFC 1T3FB 4D9RE 1AXTL 5KVEL 5HGHB 4ZO7A 4Q0XH 1KBBA 2QSQA 5LGYA 5TQ0L 4XOAA 1R19A 4ZSOB 4M5YL 1BM7A 3IS1X 4QT5B 5BS0B 3CLFL 1SBBA 4NZDA 3A5VA 4LK4A 5D2LF 3CX5J 2Z4TA 4PI0A 3ZYIA 2ZXEB 4QJ5B 2WB7A 1QQDA 5MEPB 5IVNA 4B97A 1G5GA 2AQ1A 4JJHA 2ALAA 3BUYB 4G5ZL 2QV2A 4TNFA 3WFCH 1DQLL 3FQYA 3HRZA 4W1TA 1CL7L 3FUJA 3QI9A 4G6AD 2CA4A 4CMHB 4NEHB 1W72H 3KBHE 3LNHA 3SQRA 2VAAB 4MNQD 1HZLA 4FYRA 4GBXB 2E4FA 2HMIC 4XP9L 2X38A 2PWFA 2VUOA 5CZVL 1A8JH 3FU8A 3O2DH 5F6IB 3IDIB 3GBNH 4HXAL 4QY8B 1TT6A 3RVUD 1RIHH 2HXAA 2MQGA 2G3ZA 1IQWL 1T1ZB 3RKPA 1WWBX 2VC2H 3I2CL 3DVNA 4PTTA 5FUZL 5J12B 3HW7A 2WBKA 5HY9B 4ABQA 3HG1E 3NIDF 5DC9B 2XWRA 3FZUC 5AD0A 1ES0A 1MREL 1T83C 4OH2A 4U1NB 1NPJA 1T0NA 4Q6YA 2X1XR 4K7FB 1XR8B 4PLKC 3HI1A 3SYQA 1U8NB 2N59A 1GZPB 3CFEA 5CHNB 1S7TB 4OCSL 4ZDHA 5HDLA 1J1XH 3EYOB 4NAMA 3T1WA 4J3OH 5E1QA 5G55A 4TSCH 5E7FA 1HKLL 3UYPA 4H1LB 1KN4L 3DJTA 2ESVB 1OQOA 4U49A 3QUZC 3SHSA 4Q9RH 1SOXA 3KYOA 5DO8A 3ZHFA 3OAWA 1I3RA 3D08A 4PV9A 3RTQA 5JMRA 5D1QD 3DOSA 4U6HA 2FCBA 5J4MA 1NLDL 4Y4HC 3UBGA 3BAYA 3RNQA 4POUB 3IDUA 1Q0YL 4KUZL 5SWZB 1NCCH 3GS7A 2C9RA 2WLMA 3IETA 3QP3A 2ZOWA 3F7VB 3SGJA 3IJHB 3EFOB 5CUSH 2D31A 1IUZA 4GNKB 1NAKL 1ZS8B 3O3BB 5CLTA 3POHA 3S48A 3V9EA 1S9YB 1IMHC 1YQVH 1JNHA 2HVKB 2B1HL 4KO5A 1XCQA 4Y2LA 1HDMA 1P4IL 2YN5A 3IMUA 3EHBB 1JZFA 5C0JA 4NSKA 4F7KA 3CN4A 1UH4A 5KBKA 1C7SA 1FNEA 2B08A 3UBXB 4JANA 2MQ3A 4Y2OB 1DVFA 1U21A 2BWQA 4DOHE 2HH0H 1KGXA 2Z91B 2WGNB 4P3DB 1JVOA 4QDGA 3UTTE 2Z1PA 3VI3E 4P05A 1AR1B 1M7XA 3S4SG 1PZ3A 4N5EC 5BOJA 4GSUA 3SYPA 1EFXD 3GXIA 3ZO9A 3MLXH 3O4LA 4LRNH 4FCAA 2BSTA 4NAQA 3ZSSA 1U8IA 2XLLA 5E6YA 4BBWA 4B9PA 4L29A 4UINH 1TZ8A 3TNNB 1TPXC 4M8RA 2DQJH 4R97B 3V0VA 1YO4A 3K71A 3BC9A 3MREA 3QNZB 4XNYH 4LP4A 2BS71 3G6JA 2VNCA 4U3XA 1DQMH 3O3EB 4R90H 2ZAHA 2VDPL 1LK2B 5JOPE 1PMYA 1BFVH 1WBXB 4GSQA 3D0LB 3KDMA 3PGCA 3TU6A 2P5WE 1NMCC 4B5EA 2Y4SA 3QZLA 1O5DT 4L5FH 4D3CL 2AMGA 4IHOA 3C09C 5GS2H 1JWUA 2P8MA 4AYDC 2A1WH 2DEWX 4QAWA 3V0GA 3WIHL 3BWAB 5C3IA 1QSVA 3RDTC 4P2OA 5JA8B 4QHKI 2YPKA 1MAMH 2AXGA 1KTDA 4WAFA 1G6RL 2ZJSH 1BF5A 5E7BA 4PRPE 4KH2A 3MUUA 2GJ6D 2XU9A 1QSFD 3ZKNC 4QUOA 5HY9A 3UIYA 3TZVC 3DO7B 2Z7WA 5F9WB 3FUEA 3GXUB 1VZHA 4X6CF 5DRNB 1I82A 2WNGA 1MI5A 2JFCA 3LS5H 4LCYB 5DUBA 4WNQA 1SM3L 1ZEAL 2ZNXA 3V0IA 4XO3A 3DO3A 1NQBA 3LOWA 1QHPA 3B2VL 3GBMH 3Q8AA 5DJ6A 3RI5F 5HPOA 1Z3GL 4AW7A 5IHHA 4JPKL 3V4UL 1KIPA 5EC2A 3ZE0B 2AHIA 2Y7QB 2WLIA 4N2EA 4XVTL 1KYOJ 5E99H 2VLJA 4X6DF 4PRPA 1MRDL 3TNMB 1XGYL 3MV9A 2H2PD 4JQIA 4QHLA 4RX4D 5A3IC 1EHLH 1OTTC 4MBRA 3PGFL 4XRCA 4XP6L 3ML8A 2V9QA 3L9RB 3AGVA 1MVUB 5E2VL 1UXWA 4I0PA 5CZKA 3EGDB 3R4RA 1K4CA 3KBFA 1JF1A 2ZKYA 4RZCB 3PHOB 4DP1X 4CU6A 3VRLE 3LPOA 5E8EA 4QGYA 5TE7L 2LABA 4CC1A 1N59B 1A6TB 3BSHA 4O58H 1LEGB 4MNHB 2DD8L 1IKNC 2FO1A 4KRLB 4FULA 5JIDA 2ZYHA 4PRDB 3MV7B 2HKAA 3WFHA 4MA7H 1GPOH 4IBZA 1FVEB 1N12A 4X6DB 5IW6A 1FO0L 4KI5F 5I6KA 1J05A 4MCNA 4HHAB 4I4WB 3MV7E 2ZG2A 4MNGA 3DJZA 4UTAH 2GHZA 3N40F 5DA4A 1EDYA 1OO2A 1SLWA 1XH3B 4LDOB 1OP5K 5F96H 2CBMA 4NN5C 1Q9KA 4MQ7A 3UXFA 2EDDA 5HHNB 3MFFA 3HMXA 2HSIA 4ZW8A 2EABA 3VE0B 4FEIA 1UZGA 3ETTA 5C0AA 4U1HA 4X4KA 1U8IB 3DXAB 3L4TA 1E8ZA 1R1CA 3C5SB 1T2JA 5IJBC 4F2EA 2YWYA 3F84A 1IARB 4NGHH 2PPAA 2JK5A 3UFIA 4FLQA 4BRVA 5JXEA 4TLSA 2WLLA 3FT0A 5AVQB 2BHUA 1ZGLA 2HLFC 4XP4L 1SJXA 4W6WB 3EG9B 4Z7NF 3JYCA 3AT9A 1J5OH 3PGCB 2WWMC 3P3YA 3QEUB 3V4VL 1ZRUA 3LJ3A 2QQNL 3QDHA 5AUMB 5HJ3B 1NZRA 3FQXB 1TZIB 2FJFB 4HAFA 5ANME 3G5YB 2QGDA 3EZ8A 2QTEA 1QPXA 5TJWK 4X8JB 4YSUA 3VW3H 1E6JL 4RGMB 2JKXA 5DURB 3KL0A 4L3EB 5CFAA 2MCPL 1S9WB 1YY9D 4IRZH 3CK0H 1ZLSL 2LFGA 1HWHB 2B77A 3LKRB 5IGXH 3TIEA 1AQHA 2ZSVA 4IDJL 3S88H 2EKJA 1ZVNA 4YDMA 2BK8A 4PEEA 1T2QH 4L37A 4OFVA 1KC5H 3ALXA 1PY0A 1LXMA 1G1KA 4O02B 1TZGL 2KQNA 4H44C 4JQVA 1AHWB 1MI5B 5DUBB 2WLZA 4ZW7A 5IFAH 4M7KH 3QDJA 2D0HA 2Z0BA 1NBYB 1EGJL 3S36L 3I6GA 3CHSA 3KJ4C 4DAGH 1QLFB 5GGTH 5EC1A 4D0BB 2XN9E 3VXMB 3HC2A 4HKXB 4R4FL 3UGUA 1JFQH 4BQ6A 3EOAA 4E5XA 4RFEA 4EKJA 5C3TA 4W81A 1P4BL 5F9OL 4L4TA 5DF0A 3HZVB 3JUYA 1JERA 3EXJA 5IJKC 4AVKA 4P46B 1JOIA 3C8HA 4ATWA 5AZUA 5KYUA 3EJZD 3FPXA 1JGVH 3HR5A 4KV5E 5D7LB 4K8RL 3BH4A 2R0ZL 1HNFA 2YD7A 5EO0B 3KYMB 5L9DL 2ZUSA 2BOCB 3Q44A 2A73A 5TDPB 3WKYA 3WUWA 1FUNA 4CVXA 1X5IA 3B1UA 4FTVD 3VI3B 1W80A 2VDNH 4S10A 5GJSL 5IV2A 3QO0B 3UERA 2QPUA 1ONQA 3GM0A 4FNUA 2GC4C 4EI0A 4PJBB 4XN5A 1ZHKB 1T0PB 4B9CA 2PPEA 1MUJA 4OUUB 4FQ1H 4K8RC 3C6LB 4HKZB 3FRPB 1AI1H 5HDQL 5AFAA 4I3RH 4AIEA 2AQTA 4NXSA 5I5JA 2FH8A 5EV7A 1YAIA 4JG1H 4RVBA 5A16B 1E4XH 2AEIT 2XQYA 4NENA 4FQHB 1BVZA 2VXSL 4C83A 3KLHD 2VR7A 4L0YA 1Q9KB 4MQ7B 5ESQA 4AEFA 3EF7A 3W5NA 1DEDA 4UV7L 1AYRA 3P4NB 2GTWB 3KLSA 2ZXGA 3VXUA 1NOFA 1DQKA 5CEZH 1U41A 2PCFA 1UEMA 4JFOB 3Q6FA 3RZCB 3VD1A 3F58L 3WTWA 1WDAA 2WYHA 3SKNA 2HFEB 1IEAA 1OTUD 4HWNA 4MD4B 2VR6A 3QR2A 4ODHH 3V4PL 1VPOL 5E9AA 5IQOA 3LKNA 3BMVA 1EFQA 3D8MA 5BV7B 4WI8A 2YGOA 2TRHA 2JCCE 2LAGB 3OXRB 5HYFA 1YMME 1G7LA 4NKMA 2EVFA 2FZ3B 2N3JA 5GGUB 2A4ZA 5DMIH 2FJGA 3KPRA 4TS6A 1SLUA 2VSMB 3DV6A 3G6DH 4FNSA 5KYYA 3MOAH 4FQLH 4P4KA 5IVXB 4XVTH 1UQSA 3VMNA 3LRSB 2ZWLT 3L3OA 1I9EA 3N42F 4PCYA 3PXJA 2UZXB 2ADGA 2AMUA 1WSST 2J44A 4KTEL 2FJSA 5ICYB 3PWLA 3D05A 1E9OA 2IPKA 4DK3A 1OAKH 3MLVH 5GRVL 5D2LB 5L2KA 3QORB 3BCDA 4Y1TA 1TUPA 2QSCH 3HE6B 3LN4A 3PFUA 2NLJB 3I9AA 2QQKH 2PO6A 4GO6B 4GRLA 2F53D 5LUMA 1MWAH 2WTPA 3CZLA 2FWOA 5E8OB 2ZWSA 4JZNB 3C5JB 4Z7OF 4M5TA 3SKOA 4G6MH 3GB7B 4AJ0A 4IEFA 3TBSA 3MLTB 2CGYA 3ULVD 4HKXA 2IWEA 2PXYB 1S9XB 5IF0B 5HHOA 3X3GH 2R2EA 5MP6L 2F54A 3OKYA 2KDGA 2VDML 5I1KL 5JPNB 1PZUB 5J11B 4LCWE 3MRKB 2E9JA 4B9ZA 5LXGL 1A5FL 4APQD 2YEVB 5DD6B 1JD9A 4LP8A 4F7CA 1CLCA 5E00A 3LZNA 4XTRC 1PZ5A 4L8DB 3SGKA 3T04D 4Y89A 5KBNC 1YEGH 3QH3B 2NR6C 5E5MB 2AZAA 4XPGH 1YVLA 5KWYC 4OJFL 1BV8A 1VZIA 3VXOB 1SOQA 3OQRA 3N1QC 4YH6A 3QHFL 1MRFL 1TQVA 5JXAH 2APXA 1HQ4B 1UKSA 5JPMC 1MIEH 2GTZA 3CSTA 3UPRA 1GAFL 1BJ1H 4KZCA 4PJBA 5FS5A 2O6DA 5IW1B 3V6FB 1ORSA 2RCSL 4HAGA 1WCQA 2IOMA 3Q8EA 5D7HA 5I5MA 2IH8A 1C16B 3D2UA 3MOQA 3AS0A 2OXHB 2FNBA 1HH9B 5F89B 5IUSA 1P9MA 1BVKA 2VXVL 5F1NB 2ICES 4JR9H 4WV1A 3KM2A 1H5BB 4NCC2 5F7DB 5C86A 1UFGA 2AJSH 1FWXA 2MOVA 1WFTA 4MMXB 2BXZA 4QRSA 3D52A 5E4OA 3WFCL 1G7PB 4NWUH 4FNRA 2WP3T 4P2OC 3KPSB 4JQIH 3RVVC 4BFJA 5J5EA 1AZNA 1UATA 1JGUL 1TO5A 4DP5X 1ZD6A 4OI9A 1HZHL 4AM0B 4JQVC 1OE2A 1TDQA 4Z7OB 2CMRL 3D30A 4OBSA 3O41B 3GBDA 5IQ7H 2YEZB 2KMWA 1LE5A 4MXWH 5AW3B 3E6HB 4KK6C 5JHBA 4KY1H 4ZNEA 3ECWA 1RVFL 3HHSA 3ZE1B 2CBQA 1ET7A 5CR1A 4LRNL 4PRPD 5K1VA 3RB5A 4YAQB 5E9NA 4OU3A 4Y4FD 4N2OA 4HFWA 2H6PA 4MD0A 3WTXA 3E8VA 4DP2X 3Q5TA 1AD9A 1OHZA 2VLRA 1FFPA 5B3JF 2HG0A 4OCYL 5IJVA 4N90D 1MOEA 1NLBH 2GG1A 2XFXB 3O45A 3OHXC 4P4RB 1A4KB 3SZ6A 3UYRL 4HFUL 4H8QA 1DUZB 5D1ZD 4YSCA 1HH6A 5DD0L 1AMXA 2BFVL 3P2DA 1BVLB 2DQGH 4XNQA 5JOEA 4HWUA 3F12B 4FA6A 2MNWA 1Y18B 3IKCA 5M95B 1EEZA 2K78A 4BQBA 4BCYA 1NMCB 4HW6A 2JI1A 5C6TL 3JV0A 3M7FB 2H0JA 4PCTA 4G7RB 4GAYB 2PWHA 5KVFH 2XRAL 4GKSA 5I1AA 3ES6B 3UBFA 2XQBH 4MX7A 3VTTA 1S78D 1M2OA 2JJWA 2B59B 1MJ8H 3L3HA 2E0PA 5GHWL 1N7MH 4UM9D 3VWJB 2O6EA 4XODA 5I1GH 1S78C 5FWQA 4FFVD 2Y6SC 2WINA 5DK2A 1RULL 1B6UA 1Y6NR 4MSWB 3LSOB 2HRPH 3MV8A 1XGUA 4S2SA 1IVLA 2X42A 3BWUF 3FCBA 4HV8A 1RCYA 2YEQA 1VSCA 2HT4D 4QYAA 3CFIC 3GSOB 1J48A 4Q4EA 4FG2A 4NQTA 4GUQA 4MS6A 1RHFA 3LVEA 2VJXA 4B9KC 1JYWA 1F1AA 1TYEB 4NT6A 5D5ME 5EA0H 5HGGS 3EJTA 1CF8H 1NBVH 2TSAA 1EAPA 2E6PA 2IPTL 3TJPA 4IM8A 3GJFB 1AANA 1ITCA 1JIBA 1XGYH 3ELAT 5DEFB 5C08A 1IT9H 5AOIA 1IJ9A 5E51A 3U1QA 4GKZA 1ICTA 4P4KC 4RESB 5I30L 3FO2B 1BVOA 2JI2A 4Z0XA 1NANH 3PY9A 5IFHL 5E9DB 1MCEA 1ADQL 1XD1A 2YSTA 3ARXA 4BKLB 5AQ0A 2JI3A 3MJ8A 5H35B 4DH2A 1LQBC 1Y0LB 2ZX8A 2UZYB 4GO8A 2AJYH 3CX2A 5FHAL 4ZNCD 3KPMA 2OXGB 3BVNB 4FQPA 2P26A 4AQAA 5KUKA 5FFOA 3P77A 3C6LD 4RCAA 3SDDB 2HVBA 4JHWL 4ZUUB 1NCGA 4I1NB 4RGOL 3VH8B 1G6RH 2ZJSL 3X11B 3SDXF 4QHMA 4HC1L 4JAMA 3ARGB 3F2LA 3F85A 3HC3H 1BVNT 2WVSA 1A7OL 3BE1H 4LGRB 5I8KH 5LNDA 1AMYA 3BKCL 4JRXB 4ES9A 4DP4X 5IB4A 1PJ9A 1RZFH 2YZ8A 2X4UB 3BUTA 3PABB 5DUPH 1MFCL 4IJTA 3O3UN 3H3PL 1DQDL 2FX9L 2H0PA 1GMIA 3B83A 1JGLH 4UQ2B 3VWJC 1QOKA 2XA8L 3CFDA 2WC7A 2QQLL 4OGZA 4Y16B 2CPUA 1N0LA 3WJJA 5IB1B 2AJVH 2IEPA 3HC0B 3KPQB 4QRRE 1LP9E 1P4LA 3QEQE 4GIPD 4AXWA 3STZA 3W9EA 4A39A 3SE8H 4XXWA 4WUUB 3PU7A 1P53A 1I1FB 3TO2A 1HH6B 3DHMA 3GHEL 1F1GA 3MCYA 1PTZA 1ZY9A 4GQ9L 4OQTH 4BDVA 4NP9A 3CZSA 2F5BH 1CXIA 3PWNB 3NPSC 4ZFZA 4OFYA 2EJ1A 1ZSDA 3NQIA 3SCMC 2A9BA 3ZIYA 5K69A 1OPGL 3HC3L 4LOUC 1GJWA 4NZTH 5HHPB 4IOSD 1IKFH 4JK0D 1WUZA 4HT1L 1J7VR 1BECA 1AQDB 4KX7A 3DRTB 1MFUA 3QPQD 5LCVL 4IRZA 4JKLA 1EGJA 2EDFA 4P04A 1TITA 3RFZB 1P9MC 4W93A 4ONGL 3M8OL 4OAWA 3G5XB 3QPQC 2CSPA 5GGVL 1CD9B 1JI1A 4G7QB 3BUDA 4YSPA 1OL0A 1RIVL 4YBLC 4HGKC 4MSWA 4NO2B 3RUGE 4PWEA 3K1KC 4YXHL 1J8HB 4HIHB 4PJFE 2J72A 3A3YB 5E2JA 4N0UE 3SPIA 1RP8A 4KRPC 4YSRA 3G04A 2WZPA 4B9YA 3GRWL 8PAZA 3POCA 4OCRH 4GIOA 4G7YH 3X13A 1GRWA 2KS0A 2YD4A 2IGFL 4GXFA 4N90E 3SD5A 4CBPA 3NH7H 2YD1A 4WW2F 3TM6A 4YPGA 2YAOA 4GOSA 4HK3N 1KZYA 1F3DH 4H88H 4XPFL 4OIIL 4L4VA 2DYPB 2CCWA 2XYCA 4JO3L 1XIWA 5I19L 4QRQA 1CLOL 5MI0B 4DGIL 5AOMA 2OJZL 1TEFA 4AQEA 1FPTH 3GSQB 5FO7B 4Q9RL 4NZUH 3D87B 2C9QA 4FG6C 2QV4A 2K6WA 1XXFC 1XCTB 3G6JF 2K4WA 3CFQA 1M53A 3SOBH 4AQOA 3JV6B 3BVWA 1MCWM 3DX7B 4W9EC 3ZHNA 4CVZB 4F58L 4CVWA 4KJQC 1NCCL 2B16A 4L9LB 2ARJA 1M1SA 1JN6A 4KGJA 1X9QA 2PPFA 3IPBA 3V6BR 4BEIA 5I17B 3IJSA 2CO6B 1R34A 2HJFB 1T22A 2O5YL 2J8UB 4ZUUA 4DO5A 3H2QA 1AGFB 1FV1B 3AXIA 4PGEB 3K7UA 1BM3H 3HOGA 5DJ2B 4YHMH 4WUUE 3H55A 1KLGA 3ARGA 4NAJA 3IJ8A 4XHJD 4YDJA 1FG2A 1MHHB 2XBDA 3KNBB 5IB4B 2ZP0T 4HJJH 1G7QA 4KTYA 3RVWD 3GK8H 4OLYH 2ZZUT 4ONOA 1FO0A 3MXVH 4CC0A 3QK0A 2N56A 2NYZA 3WNOA 2HFFA 1VFBA 1WFUA 2AEQH 3Q6GL 4PY8I 3RGVC 4TL5A 3UYRH 4CSPA 4OGAD 2ZUXA 4Z18A 2DQCL 1NGZA 2EIMB 4PG2A 3RP1A 1H3UA 3T0EA 4F9PA 1FNGA 5DUMH 3APNA 4OSUL 1VHPA 3I6LE 3VFNA 3MFGB 4ADJA 2NSMA 2OULB 3BWSA 1ADQA 3QDGD 4QPEA 2PCXA 3A4AA 5PCYA 3LHAA 4WUUA 4S1QH 3L3DB 1F5WA 1JTPA 5EU5A 1HHJB 5DHVA 3D9AH 2WNXA 3P11H 3GD1C 2Q7YB 3TBVA 3DIFA 2Y36L 4HZ1A 1I9JH 1S7RA 1DFBL 2P5PA 3QUGA 1F86A 2CKBB 3E6FA 4RNRA 2EZ0D 2VN5A 4C8XA 1CFMA 3CDGA 3FB7B 2M1KA 1JNNL 2CBPA 2R2BA 3FL7A 4HIJB 4BH8A 2XDHA 3OB0K 1FCCA 1B0IA 2BVOB 2SODB 1XSKA 1FZJA 1PU0A 2XVBA 2Q6WB 5KYXB 4M00A 2DBLH 3PGDA 5T1LA 1ACXA 4ONHA 2CPCA 4HJUA 2J3SA 4DO6A 3SGDH 1NC4D 3ELQA 4M1CC 1KT2A 3MRNB 1JGIA 4GP4B 3CVIH 3DX0A 4DF9A 3U9WA 2ZUTA 1J88A 3LZOA 1BWWA 4F91B 1SPDA 4ZO8A 5I8CB 5EULV 2CLRB 5ENWA 4LPTA 3ARPA 1ASPA 3W56A 5GZNC 1ZE3H 4LAQL 1FH2A 2LLGA 4NNYA 3TV3L 4FRWA 1KEMH 2GK0B 2G0KA 4JKPL 4HPYH 5T3XH 4JHUA 5CEXA 1WISA 5E6ID 4YPGB 3F58H 4TUKL 2BPBA 5B8CC 3TEWA 3FKUS 1NUFA 1JCVA 2G5BA 3WKPA 5T5FA 1PEWA 2YSSA 1U58B 1FGNH 3KH4A 2OCCB 1Z3RA 1R3LB 4WU5A 5FHBH 2DH2A 2BMKA 4JG0H 5DC4B 3L6FA 1KF9B 3OKMA 1YYLH 2YAHA 1KGJA 1BQ5A 3UCQA 1ECZA 1HL9A 3HI5H 2E86A 3OKEB 3GSXA 4OD2B 2R1YA 3SPCA 5I16B 4LSUH 3TFKC 4KKZA 1GZQB 4KMTH 1LVEA 1IM3B 5T3ZH 4OLXH 2CNYA 4OIAA 1QVOB 4X7CC 4Z9KB 2YMOA 5D6CA 3PXHA 3STBA 4G9FE 4UQBA 2QVKA 3O8XA 3RRQA 1D5IH 2AXWA 2E6QA 5CGTA 5DJ2A 2NNXA 4IYKA 2YLKA 2CLZB 1LLAA 4P2YA 3IJYA 1FC1A 4TSBL 5KSBF 3TO4A 3VXSE 3BGFB 5FM5M 4FFYA 3BFOA 2X6AA 2DQTH 2PTUA 1EDQA 2ZX9A 1LWRA 3D25B 4FXGC 2K9FB 4LLDA 2NW2A 5ALCH 3UZVB 4F8PA 2F1BA 4ZOCA 5DTFA 5FGCB 3SDDD 5ACZB 5EHFA 3D4GA 4DP0X 4LIQH 3WJLC 4JGNA 3JVGA 1A7NL 1FIGH 2W5PA 2XTSA 1RJLB 3TA4D 3ARQA 3VFNB 1NGYA 3IJ7A 1AYOA 4NLHA 2C9PA 2CRMA 5EORL 3EXLA 2CD0A 4HD9A 3L3DA 4JFDD 3RYMA 2X70A 2V2WB 5AW1B 3TEYA 3QDAA 3GSRA 2OZ4A 4H0HB 4EI5B 3U1SH 4F7PA 5L8LB 2WXGA 2BHFA 1XBDA 2A74C 2A9NL 1J8KA 4FYQA 1T0OA 4AZ8B 3E6FB 3EDDA 5D5MA 1AZRA 5CZXC 2DH3A 1ZT7A 4XXDB 4HDIA 3PWVB 1PZAA 4LKXB 1MH5B 4C58B 5K5YA 2XTJE 4U2YA 4QXWA 3QFJE 3EHBC 2PW1A 1NJ9B 1S7SA 1P6AB 1ROWA 1UH3A 2XX0A 1QWHA 2L04A 4F27A 5E08H 4QY8A 1R47A 1CI3M 4JFUA 1L0XA 3EHBD 3TFBA 1BAFH 1XAUA 4YNYB 3DUSB 1K2DA 3QQDB 2GJJA 1XIWC 3V4VH 4B53A 1N10A 3FQUB 4PG9B 2DLGA 3R0NA 2GYSA 4NLAA 4ETQB 1QD0A 2WN2A 1NICA 3EYSH 3PAZA 4X6CA 2Q86A 4U1IA 3PLYA 2CLRA 4UF7C 4ANKA 5JW4Q 3H7BB 2APFA 3FBQA 2JKWA 2FL5A 2NCMA 3HNVH 3QIBA 4BH7B 4CVUA 4NM4L 4PJXF 1HS6A 4X9GA 2UZIH 4B6ZA 1WD8A 4H1LA 4NZRH 4HJSA 4P8QA 4UB0L 2ENSA 5AB0A 1N7ML 2JB6B 3N04A 4W6XB 5DVMA 4CADB 1C8PA 2J7LA 1E5CA 5BS0E 4IKNA 4ZD3L 1P7QD 5I0VA 1A7BA 4YUEH 2MOGA 1L7IH 2EUXA 1V7MH 4EZJA 3HN3A 1RH8A 4XNYL 4NDMB 5F0MB 4G6FD 3MBWB 5F7YC 2EVHA 2O5ZL 2VRAA 1G7IB 2GEEA 2WUCH 4BSWB 1NFAA 2BM3A 2VDPB 2O72A 2HFGL 2WLYA 3WN5C 4P5KB 4KK9C 3PREA 3MUGA 4OI8A 4Q6IB 3AREA 1AE6L 1UADC 3QUXA 4PWGA 1RURH 4UB0H 3SEPA 2WY3B 3DVGA 4XAKD 3F7VA 4ODXA 2D31B 3GO1L 1IGTB 1A6VL 1T21A 3B6SB 1RZQA 5LO7A 4N25A 2EYSA 2EYRB 4WHCA 5D8JH 4TUOA 1IE5A 4O02H 3JWOL 4NSKB 1EO8L 2NY2C 1IBGL 1R3KA 2D03H 4IQHA 3KWWA 1F02I 1XH1A 2IADB 1NBCA 1AR1C 3CZEA 4KJWD 5T1DH 1OWRM 4XNXH 4HPOH 4M93C 2VR8A 3SBRA 3N9GL 1P7HL 2JIXD 2AJUL 3I6SA 3P9MA 3T9WA 4Z7QF 4EDWL 4NQEE 3D25A 4HWBL 4YHNA 4QRRA 2DL2A 1S7VB 2OPCA 3JWOC 5CSGA 1F11B 3GMQA 4IS6A 5DTFB 5DUML 4MJIB 5KS9F 3QRBA 3CC5B 3WJLA 1L9PA 5BUAA 4TTDC 2Y7NA 2W60A 4LOUD 3RBSA 4A6YH 2J8UF 2JKTM 2ICEB 1BAGA 4K8RD 1D5MA 5HHXL 2NY6B 1HSAB 5D7JC 5TDOA 4NN7B 1KCRL 1THCA 2OMWB 4GW4B 5DVNA 1R24A 2GBTA 4Q9QL 3NN8A 3VX1A 4MNQA 1KBWA 3CDCA 4NB7A 3OB0H 3HAEH 5D7IA 2F7QA 4X4MA 3W0WE 1QRNE 3ETSA 1K8DA 4GAJH 4KK8D 2DWEB 4FFYH 1UURA 1LK2A 1CB4A 1PX3A 1X5MA 5T5NG 1QRNB 2AK4A 1XF2B 2BIPA 3NJXA 4JO1L 2YAMA 2AXHA 2VLMD 4IU3A 4R96A 3EO9H 5FA3A 4XI5D 4U3SA 5M94B 3ATEA 5F8QC 4LKXA 5DEJA 1PZBA 4N2CA 3RGHA 4Q52A 4X7TB 5IHZA 2BZ7A 5FFGA 5FYLH 4B9GA 1W72B 5BUGA 4F15C 3VDBA 2XTLA 2J8OA 5EZOL 2X3BA 3ARBD 3F83A 4YSOA 3DUSA 3W1ZA 2XZAH 3L1OL 3JWDH 5FECB 5L4FA 1AO7B 2R0LL 4N1HB 5DFAA 3FH7A 2JF1A 3SDAB 4F7TB 1XGZA 1SZNA 2YOAA 4Y9FA 3AGWA 1I7RB 5B38B 4PJ7B 3QWOA 3B2UD 3DROA 3MX0A 2IFFL 4PJIA 2A2QT 2YXFA 1JHLH 1SFDA 4A2DA 1TYRA 5C0FB 5JA9A 4MA1B 5EN2B 1ZAGA 4DPBX 4OM0L 4PJ9A 5HYSA 4WY7H 1WT5C 2NUPB 1U3HD 4BZYA 3PL6A 4ZMOA 3NCBB 5CJXC 1N2RA 1D2OA 4WSKA 4U1MB 2X09A 4NC1C 1E7VA 4HJGB 4FMVA 4Y88A 4BZ2A 4AQ1C 5CU9A 3F00A 3ARWA 4XNUH 1T0MA 3VCLA 5BMFH 1KYOK 4QHLB 5TGBA 3C9NB 4B9JA 1CICC 4TLKA 4URKA 5D1QC 2F8OA 3MACL 1QSFB 4YHIA 3V0WH 3VSUA 4NKDB 1X7TA 1NUDA 4PRNA 4OBRA 3UAJC 5IG7A 2YD0A 4ZFQA 1YZZA 3O4OB 1WZLA 1NEPA 4IRJC 3NIGB 4X83A 5C0EA 1ZGLP 1N18A 1NAML 5L2KD 2AK1L 2WKGA 5E8EB 1DVFD 1M7IB 3VFGL 2D2CC 2EYSB 4LOFA 3WFEH 3RX7A 1TEYA 2QGEA 5FAAA 1HVXA 3ZHKA 1MDAA 1MCLA 4W4OA 1TOXA 4AQ8A 2H2SD 1SDDB 3DUUB 5LGJB 1JI2A 4PJIF 1QACA 3HUJF 1MHPH 3QHFH 3MYJB 4JKKA 4GMTL 1U8OB 4X6DA 2IADA 1BQLL 4GQ9H 3K6DA 3PP4H 4QRAA 4P07A 4P9MH 3U36A 4I4WA 1TEGA 3W39B 2AXFA 5D1XE 3FT4B 3FQ2A 3TN0A 3M45A 3MBEC 4AJYV 3ULSB 1KTRL 4F9PC 3FTYA 2UX7A 5J6GB 5C6WH 2W60B 3E1F1 1PFCA 2ZG3A 3N43B 5CIPH 4DERA 3VYOA 2VLKD 2OL3A 3F65A 4JFHD 4U6YB 1G9ML 1E42A 1DDTA 1DQDH 2FX9H 5K9QI 3FU0A 2M8XA 4J2QA 4Y4HA 3S5LA 3RQ3A 1BZ8A 4P57A 1GIGH 3L3IA 1QR1A 1MWAL 3F7YA 1TLKA 1MREH 4PLNC 3ULUC 2CJSA 3E3QE 4P2OD 2AI0H 3FRUB 5EZIH 3HHMA 2Z4QB 1GL4B 1IC4L 3IFLH 3JTTA 2DMHA 4J3OC 3I85A 3PP3K 4M1DH 3QJOA 4F20A 3GMLA 3GI9H 1HZHH 4TPRL 5A2BA 2G9HB 1RV6X 1WAEA 4UTBH 4YBQC 2M26A 4E42A 2WJ7A 5JHDE 2VDNL 4ELMB 4GBXC 5HYJD 3PRZA 4Y8DC 3X3FH 2VERA 3BXNA 1RIVH 2MKLC 2ITFA 2ZWNA 2J2ZA 1FORL 5I1DB 1UM6L 3JWNG 3TZVB 5EDSA 2E8YA 2LTQB 1H6UA 3HBQA 1HWGB 3X14A 5IM7B 3U0TB 2JTDA 4QXGH 3VXSB 3ZXAC 4AYFB 1XF3A 5F1SA 4J8RA 1NBZB 2X89D 4L1DA 1IQDA 3L5WB 1KWKA 2HTKD 4UOQA 3U9PL 2WXLA 2XQYG 2QR0B 3FFCA 3ZZ1A 3DV4A 4XPAL 2XG4B 3SCMB 3E3QC 3TVMD 1B2YA 5EN2A 2CUAA 4AH2B 1NBYA 4IBTA 4JM2A 4HGWA 4OF3A 1KIQB 2CG9X 1X5ZA 3CLFH 2CHZA 4MA1C 5EBMB 3RWFA 4PBDA 2DQUL 1G9NL 3H54A 5C0CA 2G2RB 1MJUH 1HSBA 4NZUL 3QZBA 1QR4A 4L4TB 4ONFH 4QNPF 4Y4FA 1J1PL 1CZ8H 3QI9B 1AS8A 1OSZB 1CE1H 4H8WC 5J13C 1G6RA 4QNPE 5E1GA 5KYUB 4HK3J 1L9MA 1HHIA 5D7LA 1KPVA 4HKJB 1VEMA 3PL6D 4P5TC 5C0EB 3QNYB 4J2XA 2PCYA 4RGNE 3BUBA 3KYKL 4KXCA 5CM1A 5I71B 2PO6C 1UOVA 2HTLD 2PW2A 2XPZA 2C3VA 3FOLB 3L4WA 3O2WL 3VI4A 5HPMA 1KULA 4XCEB 4NIKB 3MRFA 4Q8BA 2SEBA 3R06A 4EDWH 1ZHKA 2YKLL 2UX6A 1INDL 3V52H 4KKNA 3FBKA 3B9VA 1CIUA 1YEFL 5I26A 1OM3H 1YY9C 2BIOA 4P3CL 2NW3A 1NSNH 6PCYA 3DX8B 3W39A 5E2WL 4FN0A 2ROXA 2ODIA 2AANA 3KYNB 1NCHA 4HJ1A 5J6SA 2F53B 3FQNB 3T3PE 1UENA 5EU7E 3U4EB 1IEBA 2P5WB 3T3MB 4XMVA 1IGJA 4FC3E 1LYQA 3WTUA 5GS0H 5EU6B 1NEZG 4JFOA 3Q6FB 2D9QB 2YD6A 4I1RA 3F5WB 5AVYB 2PP8A 4AMXA 1ZMYA 2XZCL 2XTJD 4OB5L 1NPNA 2OKMA 3ZZSA 4G1EB 5CD3B 5CMAB 4G5AA 4MJID 3F7YB 2CKNA 3FMGH 3WMQA 5ID0A 3PUUA 1OSEA 2CBTA 1WE5A 4G3YL 4JRXE 5ISZE 2Q3AA 1P0SE 3GRGA 2H4EA 2FJGB 4Z5RB 1FRGL 1LDPH 3D39E 3FSZA 2H0FA 1EA9C 4OZHF 3V55A 3NCWA 4QAMB 2OZNA 3QCTH 1CTNA 1U8JA 3HE7D 1T6WA 3LH2L 2YA1A 2CO2A 5C0DA 3X12B 5DS8B 2KERA 4A2LA 3E8UH 4Z76B 3MLSH 3IKKA 2QQQA 2PYED 4MS8C 1A3ZA 1IC5H 3Q0HA 1F4XH 1NGWA 2OMUA 5AYUH 4LBEA 2Z31B 3LRHA 4N20A 4FHJA 3DK0A 1Q9OB 1BLIA 2WIIA 2NDGA 2C7FA 3BP5A 3K2IA 1C8QA 1Q9WB 3B8YA 4C4BA 4TQEL 2Y07L 5DU7A 5JDSB 3ATAA 5K9OB 5FM8A 1QKZL 4NQXA 4NC1E 5TH2B 1ODAA 2MHAB 3BSGA 3FCSA 3JUZA 4L29B 4X80L 3TBSB 3OPZH 3V5HB 1N70A 3V0VB 4EZLA 1S9XA 1ZK9A 2ED7A 3IU4H 3A0OA 1E8XA 1RK0B 3KPLB 5CBEA 1U8HA 2PWDA 1VADA 2FR4A 4LSSL 4ZX6A 1ITBB 1K3IA 2BSRB 2DEXX 4LHUG 4O00A 5F7AA 1E5AA 1OSZA 3T0BA 3ARRA 3BQUB 1WBXA 3GIZL 3HPLA 1H8OA 4LLMB 4K94L 4LDCA 3SY0A 4EIUA 3K5RA 2I32A 1HINL 1N6UA 3CPLA 4QHUA 3ROOB 1N4XL 4WHTA 4J8QA 1A7PL 1GW6A 4LQFH 1IKOP 1YNKH 4WFGD 3T77A 4DTGL 1YUKB 1Z9OA 1BQUA 1L6ZA 1WWCA 3NAAH 4MMYB 3H6JA 1XEDA 3OAYH 3IDYC 5E70A 4X0NA 5HHME 1MFBH 3LXUX 1CYGA 3O4OC 4NPYA 1O6VA 3U4AA 2NR6A 2IFFH 2WXOA 3GHPA 1S9VA 1KJ2A 3FN9A 2XICA 2JE8A 4PU2A 4APQB 4JO3H 2CR6A 2ZOTA 4P23D 5IBLC 5CINL 4X6BA 3IAGC 3QUML 3TCLA 2K0RA 4P9HH 5FYLE 4Y19B 4O51B 3PCYA 4WW1A 5EIIG 2P5WA 4X6EA 4S1SL 2XWJA 1RZIA 1OWWA 3ARFB 3QG7H 4MZIA 4FG0A 1PF3A 5EOCJ 3F5WA 4C57C 1CS6A 4Z7VE 2Q3ZA 3ULUE 1CFSB 5DD3H 4E41B 3VVWA 5FKAA 2BNQE 1RPUA 4NYLA 4HS6B 2WOBA 4F24A 1MW3A 3AT8A 5KYWA 5JW3H 1ZPLA 2ITCB 4OT1H 3D06A 1OB0A 1UXWB 2Y22A 3NZHL 1CE6B 4I0PB 4WSJA 1HHHA 3FUIA 4HWZB 2EIJB 3FTSA 1O6SA 3PHOA 1LL1A 3T2NH 3DX4A 4Z7WB 1SJHB 5IMOB 3Q06A 4I7ZC 3DETC 4PLKD 3GWJA 2FUQA 4ODWA 3VFOB 4AGOA 5C0DB 1JFQL 4NC0B 2HLAA 4TRPH 2EIZA 2WXHA 2DS4A 1WAPA 2VUYA 3NFNB 3UTOA 5I9QC 1QNIA 2DQMA 1OP3K 4FX5A 4HMDA 3VYPA 4EVNA 4HHAA 5JMOC 3CZKA 4N86A 4ATTA 3J07A 4W9IC 1DN0B 2RACA 3IPFA 4NQEB 3VXRB 4L23A 4DCQB 2VMEA 1DDHA 1O7DE 1PKQB 2GJ6E 2GSGB 4JO2H 1LGVA 2I9LB 1JJUA 4PW9A 3L4UA 1XMWA 3MFFB 4APXA 4S1DC 4CILA 1OW0A 5IQLA 1UUNA 1TENA 1EEYB 1B9ZA 1IAKA 2ZONA 4F8OA 3CSYA 4MJ6B 1Q90A 1E40A 3FSOA 5F97E 4X9YA 4RWYL 4V2CB 3US0A 4JHVA 1SY6H 1L6XA 2FSDA 4MB5A 4Y2DB 3CFKB 3BSZA 3PWPE 1A6VH 5GGQL 4KTGA 1RJZA 4WFGE 2WINB 4N2LA 4M6AA 3KEDA 5C0CE 2BVTA 1S7WA 3TVMB 3DRQB 4MGXA 1JMXA 1KELH 1DBJL 1NCJA 4FKHA 1WHOA 2C1PB 4ZPVB 3EH2A 4F93B 2WW8A 5IFJA 4X7SL 4KNTA 1PNCA 4G82A 3ETBJ 3D3VA 3T77B 3FQTB 4TVSa 1PG7X 3RTLA 3UTQA 1PY4A 3APDA 1EUTA 4PRID 4RRPG 4MMYA 4QTFA 4FYTA 3PV7A 4FGMA 4YXLH 1UWXK 1TMCB 4GKZB 4GYBA 2IAAC 1DTUA 1PJWA 4KQ4L 4LCIL 4N0UA 4RWYH 5GZND 4PAZA 2FIKB 4CL7A 1LO4H 5C7XH 5KYNA 2CDGA 4WW2C 2LT9A 5I1EH 5K9JH 1RUPL 1W0YT 3VXNB 2H41A 3TCLB 3ZPDA 3FN3A 3WE6A 3Q5OA 3Q8CA 3N1PC 4PJCA 2EO7A 3PAUA 4OCWH 5D4HA 5L8KB 1RZIB 4JQXC 2QDVA 4XGZA 2DM2A 1HL4A 4YHZL 4N0FB 3P77B 2BCKB 3I74A 2ATPA 1GYAA 4G3YH 4KMTL 1OGAA 3A6CL 4DGVH 3L5JA 1CGXA 1L0PA 4MQTB 5EB9A 4FFWD 5EN3A 4YXHH 3T8VA 5KYWB 1YYLL 2WNKA 5EOCH 3V95A 1I1RA 2NY2B 5FW6A 3LXBA 4AT6B 5AOZA 1ZT1A 4XOBA 4XWOC 4OLWH 4NFCA 3RWIA 4EI6B 1O6SB 1MCQA 4DO4A 2BVPB 3MYZA 4JM2C 4KK6D 1JCKA 2VQTA 4NX0A 2QVMA 2YK1H 4GUOA 4RFNB 3H9YA 3KH3A 4JM2D 3BYTA 3P4OA 2Y24A 4J4PC 4JLRB 2F15A 1SQMA 1SXZA 2HLAB 3C5XA 3ILEA 1SY6A 4XC1H 1MUJB 4OUUA 4H2CA 3MCKB 1PLBA 3R18A 3MLWH 4PREB 5F1IA 3CMGA 4HUMB 1Y07A 2BHZA 2P7TB 2K8QA 3EJYC 2HRHA 3I3DA 1BFOA 2FQEA 4G6KH 1R46A 4C83B 1TNNA 1TVBA 2MPAL 3BIKA 2WPGA 4BGLA 1DJYA 4PJDE 2GSGA 4HOWA 5BW7A 1AOHA 3EJUA 5SWQA 2ERJC 3HB3B 2JB5H 2WM0A 2JH2A 4F7MA 3VXUB 4HS3B 4XPTH 2NT1A 4A2MA 1L9TA 2AP2A 2GBUA 5F6HI 1Z6JT 5IVZB 5L4JA 1SMDA 3CSYB 5SWZD 4FFVC 3MLZH 4OD3L 4YFLI 4YSDA 3H85A 3DX6A 3P3UA 4Y2DA 1QBML 4TKWA 3H3PH 4G80B 3MLPA 1JD7A 2AAAA 2EUVA 4TNVF 1FL3A 2G0LA 3MGTA 4FXTA 4KRPB 3J7HA 5FIEA 1DO5A 3AG2B 2MFNA 2HT2C 4RGND 4B7IA 3DRQA 2OP4L 3SKMB 3ILQC 3THMH 3NIFF 3GEFA 3GSWA 5CJOH 1MNUH 4YE0A 4DEWA 4XOCA 1QFWL 1VEOA 4KHXH 1F58L 4TNWK 5EU3A 3RZCD 4PUBH 3EGSB 5F3HA 1AG6A 1OLZA 2OX5A 1R5VB 3CMOL 3QDGB 3B9KA 4ZQTA 1TU2B 1JDAA 4QRQB 2YO3A 4H20H 2DIAA 4OCSH 4G1MB 5JTWA 3AS1A 1CLZL 3KVDD 1G7MA 5EBWB 4LO9A 4JZOB 4RAUA 1J8HD 3D0VB 2P43B 3BWUC 5KVDL 1NDMA 3DX7A 3D33A 3QQ4A 1JGEA 3REWB 3ZOAA 5LJYH 1SXAA 4P5TB 1DUYB 5I28A 1QNZL 3FHQA 4K23H 4L3EE 5CZRA 4KDWA 4ES8A 4IEFB 4A7TA 2YD5A 5ILTH 2W07B 5I1JL 4XMWA 1BMWA 2F7IA 2PXYA 1EDHA 1VB9A 1WP6A 3O6MH 4DHLA 4ZX4A 1Q0YH 4KUZH 1UACL 1OF2A 4FDWA 3HFMH 3HG1D 3OAYK 3QUMA 3WBDA 1BZ7B 3AQYA 4LAJH 4UTBL 3SGEI 3T1FA 1EEQA 1MLBA 3OKNA 3WHE1 1EUUA 5K59E 3KNBA 1TTRA 3LRKA 2CJTA 4H8PA 4M7ZC 4QWWC 5C2BH 2XJKA 4AVIA 1AHMA 1FFNB 1FH5H 5JQIB 4LRIC 5I1GL 4GG6A 3F6LA 2GC7C 2DQEH 3L81A 3GXPA 4RQQA 2OQJB 3LQZB 4ENEC 1M1XB 4JO5A 2L7JA 1PVHA 4IMKC 4AKPA 3MXWH 2B1AH 3ZUCA 4E68A 3OL2A 4OJCA 4HUVB 5ISZB 5I73B 1BAFL 4N8VG 3NA9L 3T0WA 1TZHA 4NO0A 3DSFL 1SBSH 2VB5A 2QPEB 4LOVA 3NIGF 2BNRD 1A6UH 1MCHA 4NO5B 3VWKA 5A6MA 5EF2A 3ALPA 4IIQB 4E9RA 2VLKE 3LB6D 3MR9A 4P2RE 4RZKA 4XX5A 1B0RA 3DSNB 1YMMB 1TJHL 1P2CB 1QABA 1UT1A 2OSLA 4HUUA 3NPSB 4ZFOA 3TCXA 4GAFB 4HIQA 4WK4B 4KROC 1MIML 1Q1JH 2CXGA 2UXFA 3ZHLA 2IANB 4HJJL 12E8H 4PJIE 1PYWA 4KROB 3AB0C 4FL4B 2EXSA 4PTUA 3PDGA 1T0NB 3TA3A 3FU9A 4YHML 1H3GA 8FABB 3LN9A 4N2BA 5T3XD 3KXFB 2DJUA 2WWKT 1BPLB 4GJTB 4UUJA 3VXRD 4A63A 5AW4B 4RBPH 3PWJA 3R8QA 4GKOA 4NPKA 1G6VK 5DD5H 5FO9A 4PVNA 3GXFA 2XIBA 4PJ7F 5KS9A 1EHAA 1NAMB 3WIHH 2DLTA 2V3DA 4ZMXA 1S5HB 3QDMB 3HBGA 1UTDA 3CN1A 2ADJA 5KVGL 1NFDA 5EO9A 1HXMA 1S7UB 5CP7B 4YWGH 4BK5A 5T8IA 3G08B 2DZEA 4YJZL 4OGAC 4LZKA 2WANA 2B9BA 1EV2E 2DWDA 5EU3B 1HOCB 1KTLB 2HB0A 1R33A 5G5DB 3V7MA 5ALBH 4ELKA 2C3WA 4E9TA 2D3JA 3H9SD 1L9SA 4LFHD 5IT2L 1BYNA 3ZMRA 5ICZA 3GUTB 3V4VB 1ZA6B 1K5NA 5DJDB 3SBWA 1TETH 4CU7A 1U93A 2DQDL 4WU5B 3WCYA 2EVIA 4X9BA 3FO9B 1DJHA 4ABVA 1WZMA 2MKWA 3L6FB 1HINH 1UD5A 4G43B 3V4PB 2I27N 2R4RL 4MBOA 3QUZD 4NWTL 1DUYA 3EADA 2WXMA 2R23A 3ES6A 1OAQL 4WFEE 1YQ2A 1DQIA 3CX5K 4RDQG 2YR3A 1F56A 4O2EA 4M02A 4NQVA 3VWJA 1UVQB 1CVSC 3M88A 4QHNA 1NUNB 4XP1H 4BCXA 4BINA 2ZICA 5DK2B 3IDYB 3EGXA 4N0YL 4OLWL 3G9AB 2CM6A 3DDFA 2BVQA 4F5CE 4ZBJA 4J12A 3QNZA 4HV8B 1T7WA 2C4FU 2WO3B 1OPGH 4PJ5A 3QRGH 2VWEC 3GSOA 4LLDB 1IC5L 5FK9A 4NUMA 2GCYA 2Z35A 1Q0XH 5A3ID 1NC2D 3SBQA 3SIKA 5KOMC 5BUPA 1E2WA 1J9SA 4HIIA 2PWGA 5FUOH 4G8GB 2R9HC 4AYSA 4LMQI 2MPVA 1AFVH 2WYZA 1CFNB 1TZHB 3HMWH 4YIQB 3S4SB 3VD0A 2BDNH 3TT3L 4AITA 3K91A 1SYVB 1JG9A 1NIBA 1F42A 1XCXA 5F7NC 4Z0XB 4OVVA 1YMMA 4RDBA 5TQ2L 3LEYH 3KS0H 2VDMH 4LB8A 1DP0A 4WK2B 5C09E 4BUGA 5I1KH 4WHYH 3RHWF 3OHXB 1E6JH 4XBGA 4FCHA 4WNJA 3BISA 4S0SD 2JWYA 4PWKA 3CU1A 3GRWA 3JBG7 4J28A 4U4BA 2DLEA 2BDNL 3V5DA 1KV3A 5DJAA 1CIDA 3K4ZA 3S3BB 4P46D 3BUIA 4IBLT 3RY4A 4AEIH 1ZA3A 2H1PH 4FXKC 5EOTB 1MPAH 3MRGB 1GGYA 4C56D 5E24E 1TIUA 2Y07H 5C07D 1MCOH 4NI3A 2XCMC 1YPZB 1KIPB 5EC2B 1ORQB 2C9UA 1SUHA 3HPJA 4NOBA 3SJVD 2WIMA 2J5LB 3ZRSA 3GYRA 1YA5A 4HXAH 5C09A 3CVBA 3PABA 5ADOH 2CK0H 2V3FA 3VXUD 4FTVB 3IBEA 1NGPH 1NAMH 4FQXB 2DQGL 3L7FA 3UTSA 2D2OA 2FL5B 4BH7A 3MLUL 5EO9B 1H6EA 4H20L 1KCSH 5ES4B 3BEVB 3OKOB 2LW3A 4V33A 4TL4A 4H13C 2RJMA 2DDQL 2COQA 4XN9A 5LBSA 5T3ZE 3ZKND 5IB3B 2VDRH 5GIRB 1N0XL 3US1A 2CBOA 3QQ9C 2CIKB 1MCKA 3A6BL 2KZ1B 2Y06H 3BAKA 5J89A 1TJMA 2X4RB 1MWAA 4OSUH 5DEZA 1F1DA 3SJVA 3UJTL 4UV4L 1DQVA 4MMZA 1WWAX 2YPLB 3DI3B 3FO9A 4XCCL 1KIRB 3UO1H 3AREB 3QUXB 2A99A 3T4AB 4WI9A 2HJKA 4FXGA 3HR6A 3BYYA 2Y36H 3IDNA 1VCBC 1RUAH 3LEVL 3B6SA 4FHBD 5GGTA 1NH6A 1J10A 2P48B 2FT8A 4ABWA 3GSNH 2CKBH 3O6LH 1J1PH 1W8EA 3G5XA 4HETA 4DKEH 4HC1A 2DM7A 2QKIB 3GEWB 4BRJA 1A1NB 1U6AL 4TUOB 4IHBA 4U1LA 4PGZA 2DDQH 4WWKB 4ODSL 1P7QB 5GJTH 1PG7H 1A6ZB 4OT1L 2W1NA 4OCXL 1S6NA 3TWYA 3ESVF 1XIWD 3OLIA 5HI3D 3BD4A 4CJ1A 3I9GL 3CBKB 5ABDE 5LKNA 1E4JA 4Z0BH 3T0EE 3O6KL 4WGKA 2VJ8A 2J8HA 3OD3A 2D7QA 3CC5A 4QXTB 3B7UX 2VDRB 3QORD 5MEQB 1JTTA 2CM5A 3HG1B 5FM5O 3JV5A 1T5XB 1U3HB 3QS2A 2PP9A 4YIQA 4GKLA 5AUMA 4I0CC 3S5YA 4X6FA 1GJUA 5SX4H 2FJFA 1A64A 1PX4A 2Y7LA 4IBSA 5I19H 4MNQB 1YNTF 4X8JA 1MIMH 2ZWKA 3QIWC 2Y2WA 4PJFB 3L95A 4PS3A 2V7HA 4M8QB 4F1SA 2D73A 5JHDB 2X40A 5BRZA 5HXMA 3QEGL 4CVZA 1EERB 1OQXA 2VT0A 4PJHE 3W37A 4Y7MA 1X7QA 4KI1A 1QA9B 5C70A 4MXWL 3OF6A 3BAXA 3QJRB 2OLDA 4L37B 4QCIB 4YFLF 3MODL 4D7BA 2H32A 2QLYA 3ILQD 4G70B 2VL5A 2BNRB 4CSTA 2VISB 4ZPTB 3WLBA 1XTMA 3BP6A 5FYJD 4X7FC 3P30H 2OYLA 3LKQA 3GDCA 5A40E 2MNJB 2X10A 4A7GF 2HLFD 2BW4A 2DYPD 3EJZC 2NY6D 4WKZA 2YC1B 2BVEA 4IRSC 4JB9L 4KOBA 3VM5A 5KBDA 1OK0A 1FGNL 1GYUA 3QXWA 4I18B 2ZAGA 1TG8A 6FABH 5FECA 3G5VA 3KMDA 2VSKB 3IFNH 2MPAH 4YWGL 1BGXL 1BOGB 4KJWC 5AENA 4YC2C 1DFXA 4AENA 1AP2B 5K9QG 2YPVL 4PN6A 6TAAA 1NBQA 2IQ9H 3VXQB 4KNQA 1D9KD 4PJIB 2H8PA 4HJEA 4DEPB 1NKOA 1WEJL 2LFEA 4XBPA 1F90H 2X6UA 4R2GC 3KBEA 2VDNB 4CGTA 1CPUA 5JIKA 2HRLA 5C07A 3IAQA 5CEYA 4UT7H 5EO0A 1LWHA 1RD6A 2ICWA 5E56A 4LEXH 1URIA 1T7XA 1TETL 2E27H 5TDPA 3OX8B 3RNKA 2LU7A 4JJ5B 3VQ1C 3WELA 5D6DA 1T0MB 3BAWA 2EH7L 1HIMH 4FQCL 3QFGA 1MF2H 1I9RH 3QEHA 4HF5H 1GC1C 4HKZA 1G7HA 3ASWA 3LIZH 1QZNA 2AXJA 2ZCHH 4MZ3A 3VFPA 3F01A 5I75C 3IDJB 4DFHA 2WBJA 2YPVH 4NQSA 4NI6A 3IBOA 4LRIA 4OM0H 5IJCC 5CJ5A 2VW7A 5F72S 5I8EB 4BQ9A 4L1LA 2DIEA 1P84J 1AR1D 1G9EA 1A1NA 1FL5A 1G1OA 1QW8A 1IV8A 4LCWA 4LEOA 4XMPL 5F7LB 4Z3HA 1NOLA 4WWKA 3CHRA 1A0QL 5DHXB 4CN4A 3G5ZA 1IGIL 4O4YL 4UI2A 3T6WA 4ZFGH 2BNQA 3C8KA 4EKXA 3NQKA 3TBWA 1PZ2A 3GSUA 4KJPD 4I0PC 4PM1A 2UWEF 4Z7IA 3LRLA 5IB5A 1UOLA 3FT4A 4AGPA 3BAEL 3NK4A 3MU3A 4IKJA 2G3NA 3U9UA 2GK0A 3CN2A 4KKQA 2GBAA 3GBNL 2X1WL 4W9CC 5D1ZB 5B1KA 5K33A 3VI4E 4A7GA 4Z7QB 5CEXB 5J0BA 2O61A 1FHGA 1TTUA 2PCPB 5DMKB 2EQDA 1KB5B 4U6YA 2R69L 1MSPA 3UEZA 4GINA 4H2AA 4LDLB 1MDTA 4ONGH 3WFZA 5C92A 3VG9B 1PSKL 4P9ML 2ERJB 2ZUQC 4P59H 2BNQD 3IE4A 1I4FA 4UM8B 4AV0A 1XT5A 3BSZH 2JCCB 3QORA 1JS4A 1MAML 1VFMA 1XBRA 3P3TA 5D7KD 3FU5A 3MXWL 5CJOL 5HHQB 3KHOA 1VENA 2R1YB 3TV8A 1EK3A 5HDBF 3ULVL 1N5YL 3U7WH 4OKVA 3T4AC 2WZ0A 3NABL 5FCUH 3KJ6L 5CLWA 3BP6B 4AY0A 2IDQA 1AXTH 5GZOC 5KVEH 1ZHNB 5KSAC 2ENPA 4UQIM 1IB5A 3GI8L 1RHHA 1GKOA 3ZX1A 1BX2B 3ZDXE 5BJTB 2X4NA 1HE8A 2YC1A 1KJ2H 3WKQA 1BIIB 5DXWA 3I75B 3UBXG 1NL0L 1J11A 3WUWG 4M43L 2F54B 1OM3L 4Z78A 2A38A 2ZF8A 4I18C 4R7NB 5JOFB 3X14B 1XX9C 2XQBL 3W0WA 5L4MA 4AYFA 1CDGA 5HI5D 1TFHA 3UTTD 3GKZA 3I02B 4OIBA 3RB7A 4NUGH 1ZXKA 1PZ5B 3B1TA 5E6ZA 4JKNA 3V8CA 1F8TL 4DUVA 4ZOAA 5AVSB 4U6XB 5C07B 1IL1B 5CEYB 2AQPA 2N7BA 4UV4H 5C0AE 2OI9C 3NCYS 4KJQD 1TTGA 1N5YH 2XY2A 3TBYA 3D6GA 1RZJC 3RFRA 2KKQA 4YDVB 4B27A 2V2WA 3L54A 1ASQA 3SDCB 4JY4B 1ZTMA 2K1MA 2WZ6A 3AM8C 3OJDA 4CSSA 4IW4C 3DX1A 4PUBL 3BUQA 1T80A 2ZTBA 3PDDA 2R7EA 4I88A 2PR4H 5CIPB 3BIBX 3CDZB 1AAJA 4GRWE 4TSCL 4U31A 2A83B 2G75A 2B3RA 4XO4A 2WBJB 1DJSA 3V0DA 3SYOA 4IIZA 4MVBD 4LLYB 4JRXD 4W9JC 3PHQB 1ZT4A 4IRJD 4PJGF 3VI4B 3P9LA 5I1CL 3H9HB 4U6VL 1DVFC 1A9BA 4M7KL 5E4EB 4EI5C 2B4CC 2PYEB 5ESAB 3T2LA 3ENEA 4Y4KC 4JFDB 1MI5E 1BSIA 2FJUB 3W57A 4Y4KB 3ARED 3QUXD 2DQHH 4G8IB 1BWMA 2VLKA 2ED9A 2NW3B 2WBXA 3DXAD 3II1A 4N5ED 4PJXE 3TBWB 4JNXA 2P44B 4G42B 4HK0B 4BK8A 4MCZB 1Q1JL 3UTPD 1RUKH 2Z7ZA 3GMPA 1QLEB 3FU7B 3PQYB 4NRXA 3U30B 3MBED 2A6KB 1KENH 4ZAKA 4Y5XB 1UB6A 2WUBL 4FERA 1Y6MR 3BPOB 1MFCH 2YRLA 3BZ4A 4NDMA 1QP1A 2GY5A 2GKIA 4FJYA 1FFPB 3INOA 4GEJA 1DVSA 8CGTA 2NNAA 1NINA 4FFZH 1JV5A 2HFGH 3ARDA 4HBQA 4OCMC 2NYKA 3VXRE 1I8IA 4HLZG 5JW4N 4BWUA 1ZV2A 2A6IA 2CK2A 5T3XE 1DVYA 1VKXB 4QYOB 1EJOL 5FGRA 2YD2A 2R8SL 1HHKB 2DI9A 2OA9A 3KGSA 1MHEB 1WG3A 4DKFL 1KBGL 4KK5C 2QEJA 3OBAA 1WVZA 1X5JA 5TE6L 2HN7B 1IU1A 2IDTA 1K3ZA 2PYFA 3KR3H 1S4IA 3L9EA 1BX2A 3Q43A 5BJTA 5JHDD 5DJ0A 3SGDI 1NDTA 1MI5D 3MSPA 3LDBC 3V0FA 5EEZA 4CSZA 1RXLA 2OCJA 2B59A 4XWOD 2IQ9L 3CVHA 4POYA 3RGBA 5JO5A 2Y1ZA 3MRIB 4R7NA 1O75A 1FIEA 4FD0A 4OLZL 2XTJB 4G8FB 2J21A 2YK1L 4Y4FC 4UT7L 1FVCB 1Q9OA 5HI4C 3LKOB 3MRHB 3TJHD 3U46A 1C7TA 3K6FA 3KDPB 3VGBA 1U8MA 3AABA 4K5NA 5I2IB 1TF4A 2X6CA 2OSYA 2CZNA 5DJZA 1SXNA 1GHFH 2R4RH 4AX3A 4OCLC 5HGHA 3IGLA 4BXVA 1CGSL 1JXDA 1XXDC 1BFSA 2IAMB 1ZWIA 2MHAA 4YGVB 4YS4A 4PIBA 3LCYA 3LKPB 3OQ3B 1BG1A 1BQSA 5KZCB 1EAPB 1VADB 2V9UA 2FR4B 3PJLA 3JV4A 4OD3H 2FUTA 2WV3A 4XB8A 5IHBA 2J5LC 3I84A 5D2NB 4X4ME 1VDGA 4ZOEA 5KANG 2ITDA 4Y5XC 1CT8A 3HS0B 3FH5A 4KKLC 3FO2A 1K8IB 4A68A 1MCPL 4FS0A 1V54B 2BOBB 5KG9B 3EOBA 3EJCA 4GS7B 3WD5L 2WQWA 2JQAA 4Q6KA 2IF7A 1E28A 4KKLD 3F05A 3CSFA 4K3JH 4LLYA 4NKOA 3BZDA 3T0VA 3ZQXA 1E4WL 3QRGL 5AAMC 3PHQA 2VW6A 2R2HB 4OGXL 2VR4A 4L8BA 3ZRCC 4U1GC 2VLRD 1N19A 3DIDA 4E41E 3ZE2E 4HEPG 5E94B 3RUGB 4TRPL 3T3PF 1H3PH 5B1AB 1J9QA 1FNFA 3ZL1A 3VQ2C 4AIZB 4NQCE 3RPIB 1N5AB 2R0LH 4JMXA 5CJQH 4LBAA 4ABUA 2FECL 4PJ7A 2E47A 3KD4A 4JW3A 4APQA 3GMNA 3U6XA 3SY6A 5AYTA 1XR8A 3MX0B 1OLLA 4R4BA 4X6BB 3VI3F 2CALA 4JO4H 4UWQB 3BQUD 5F44A 1FORH 2G3XA 4X5XB 3FQRB 1JK8A 2X12A 2X9XA 4G5ZH 2F8IA 2RAMA 1D7BA 1EEUA 2A6KA 3TBCA 3S5LG 5I73C 1CDBA 4KXBA 2FYYB 3OPUA 1KTBA 3ABGA 4UZSA 4XVUD 1UJ3A 1JPST 1FAKT 1M57B 1IBZA 1Q72H 1CD1B 4HU2A 1H8LA 1CGTA 4K3JL 5AW5B 4OGYL 1SHWA 3TBBA 2PKDA 3E38A 3SE8L 5BV7H 1YAZA 2DTSA 3GFUA 2IV9A 4DN3L 4QOKB 5MHSE 2KZKA 3WO4C 1M56B 2EEDA 1X5HA 4PRNB 4DIXA 4MXQC 1QEXA 4K71B 4P23B 3RWHA 3KGTA 1KJ2L 5CINH 5ITFA 3BAIA 4LVNB 4YHKL