5I0XA

Copper-bound m90i variant of uropathogenic escherichia coli strain f11 fetp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
153
Chain Sequence
b'MGFKEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPIVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
publication title Metal-handling and Receptor Recognition by FetP and P19 from Uropathogenic Escherichia coli and Campylobacter jejuni
rcsb
source organism Escherichia coli f11
molecule tags Metal transport
total genus 26
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5i0xA00
5I0XA 5I0WA 3LZQA 2O6CA 2O6EA 3LZRA 3PJLA 5I0YA 3NRPA 3NRQA 3LZOA 3LZNA 3LZPA 3PJNA 5I0VA 2O6FA 2O6DA 3LZLA
chains in the Genus database with same CATH superfamily
3MMEB 3MV8A 4OY9A 5C8JA 3MRIA 3Q2CA 3QIUB 5HGDA 5FKPA 2CRZA 3RHWK 2X89A 3HG3A 3F12B 1D7CA 4APQC 5E4EC 4RMVA 5I6OA 1F6AA 1E65A 1BF2A 1KIUB 4IJ3C 3PXHA 3BPOC 4E9XA 2CGZA 3D18A 4CW1B 4ANVA 4NHCL 4EVNB 5DZOA 2C1PB 3T2OA 4WHCA 2RAMA 1SBSH 1G87A 1F41A 1FDLL 1FL3B 1XR9A 5EU6A 5B3JF 1RZIB 3QNYA 2V2TA 1IBFA 2QV2A 2Y3NA 3ZLQC 4NNXA 1OT4A 5I28A 4D7BA 1ZGLP 2A6KA 3SY0A 2P8LB 2IWFA 3PCYA 2IMMA 1H3TA 3WY1A 3H9SB 5HY9B 3L3KB 5FHAL 2CBOA 3CSGA 1ED3B 3FQWA 2KPNA 2ZXGA 3OV6A 3SGEI 1HOCA 3VFNA 5J1AB 4XCCL 1BW8A 4XX1G 3V7AE 3DURB 3QJTB 3LDBC 4K3EH 1AHMA 4W4NA 1N2RA 1W0VB 2LOEA 4BQCA 2GTZA 3ZGHA 3FSOA 1ZDQA 3VD1A 1PEZA 2CLVA 2VAAB 4ODSH 1UGKA 1L7IL 2WBJA 4JPQA 3EGXA 1XQ4A 4HEPG 2JQZA 2DYPD 1SHMA 2M2DA 2FWLB 5JO5B 1BD2D 5EH1A 1I8LC 5EEXA 3UYOD 2L7EA 2QR0B 2CK2A 3D09A 2YQGA 1B88A 5JPMA 3UGXA 4KY1H 2PWGA 2ZYHA 3HMWL 4I18A 5F3HB 2BP8A 2YEZA 4R4NC 8CGTA 1X4ZA 2WNXA 5JPNA 2YAMA 3QRGL 1DANU 3QXWA 5BRQA 1DVFC 1OPGH 5B39A 5T3XE 2CO6A 1ZK5A 1ZTXE 3WJLA 3MLUL 5J57B 1I4FB 4PJ9D 5IT2H 1DL7H 1B0GB 1YNTF 4N6QA 2ZKXA 2BSEA 4WSJA 4X5XB 5DJ2A 1KNOA 5ALBH 5JW5A 2ITCB 5ABDE 2WLIA 1H19A 5H94B 4CVZB 1AIFA 5F3BB 3VD0A 2VABA 2WQUA 2C1OB 1DLHB 1VFBA 3FUKA 4M48H 1Q38A 5FOBA 1G7QA 1ZSDB 1MCJA 1T0MA 5GGUA 2IVFC 3R4RA 3SDDB 4L9LB 4M7LL 2FK9A 2J5LB 3EGSA 1BJ1H 2AQ1A 3NN8B 1FG2B 1E8ZA 2H2PD 4NLHA 4LMQE 4L3EA 2JKJA 3O8XA 4NQDB 1GYCA 3KDMA 1N0XH 4Q6YA 1KCSL 1H8OA 3AU0A 4ADJA 4N2BA 1KBGH 4B9KC 1N10A 2R27A 2VERA 4N2IA 4UNUA 5BS0A 5T33L 1YUHB 1BLNB 1JF1B 1U3HD 4OCNC 3GNML 2VUKA 3HR5A 5AAMA 3QHTC 3WUWA 4XMWA 3ZDYF 2FB4H 2WYIA 2G60L 3QDGD 4TVSa 3A21A 3O3DB 4H8HA 4J8RA 4NRYA 1GYVA 5TK2A 5EN2B 4M4RA 1MI5E 1NEUA 1I1CA 3UG4A 1A0QH 2PP7A 3ZE2B 2NY6C 2DM3A 2CDFB 4WI0A 1Y6KR 3SPVA 2Y06H 2V4LA 3BJ91 4FQCH 2EC8A 2Q9OA 4OLEA 4D0DA 2EUXA 3D7PA 2GUOA 4X80H 1WZ1H 3V6FB 2BIOA 2WQVA 3ETBF 3L2NA 1Y18B 5EUOE 3F7QA 5C6TH 4GAJL 1G6RL 1E4XI 1JPEA 4NQVA 3QB7C 2ZCLL 3V4PL 3GM8A 4JANA 3X2QB 3QAQA 2NX5E 1VB9A 4GLRI 3U7AA 1I3UA 1K3IA 2W9EL 4GO6B 1I31A 5F0MB 2COQA 5BZXA 5T5FH 1PDKB 2ZG2A 3C8HA 4P5MB 3ARFB 3KPTA 1JFQH 1AZCA 2VSCA 3MRHB 5D1XD 5CAYB 4L4VB 1BAWA 4LLUB 2J6EH 3NEOA 3VFVB 4PRIA 2GEQA 1UG9A 4G8FA 3IDIA 3FKUS 5D5MA 5ANHA 4Y16B 1SXZA 3KXFA 2Z3FA 3VXSA 4AYMC 2YPLA 3HHSA 2XQ0A 1JGLL 1JPSH 4CILA 3PRZA 3S48A 3P4OB 4QRQA 3K8LA 3TJPA 3UJJH 2WCGA 3KD4A 4LFHG 3U9PH 1OAYL 5EU6E 2VR6A 4L23A 5I19H 3BYTA 1QO3B 1LEKA 5I6KA 4ODVH 4N86A 2YPVH 1O7VA 4K9EH 4XO4A 5J1TC 3GMMA 3IYLW 1A7OH 1NGXA 5CR8A 2H32B 3QFDB 3DGCR 5HXMA 1MAML 4KMLB 4Y2OA 2I5YH 4XNAA 3O3EA 3LY6A 5IY5B 3WHXA 5CBAA 1YY8B 2F5AL 5E9DA 3SN6N 3NTCH 3ULUC 2PW2B 1FG9C 3POHA 5IW3A 2QPFA 3ULVF 3LRKA 1P5VB 4XNDA 3BDYL 2QPEB 4FFVC 1AZNA 3C5ZB 5GZND 4YC2C 1XFPA 2JIXD 3BGFC 4FN0A 4HH9B 2PCFB 3ROOB 1AQ8A 2CJTA 2L04A 2AV1B 2J1KA 3HRPA 1BZ7B 4JO3L 4K94H 3FB5B 5BV7L 2D4FA 3HRZA 2PPFA 4Y1AB 4OSUL 5GSRB 4JFEE 1HS6A 4LLDB 1T5WA 5EA0L 5C07B 4DGWC 1RZJL 4HSCX 5F93C 3IJYB 3T2NH 4KUCD 4JK0D 4GRWE 1SVCP 3LRSA 5DRXB 4PJHF 5F88B 1T1ZB 4BZ2H 1ND0B 4IMKA 3MOAL 4IRZL 1A7BA 3E0GA 4NCC1 1UA7A 4UAHA 1TUPA 4LSQH 4H44C 2Y1VA 2YAHA 4MCYB 3LS4L 4NFCA 1O7DC 3VFSA 3CVIH 4UOQA 5DJZB 4A2MA 3N1FC 3NA4A 1Q9LB 1HXYB 4RGNB 3ZPDA 1RCYA 4ZMVA 3ARED 3QEUB 1TU2A 3IKCA 3IWUA 1XTLA 3H6JA 4CC0A 1U42A 3T6VA 1QRND 5AB9A 1SPDA 4I9XA 3MV9B 3D0LA 3BZFA 1WC7A 2XXMB 2NQCA 1J1OL 4JN1H 6CGTA 5I1AA 1A9EB 1GC1C 1JZHA 4BA0A 4F8LA 4YQXH 5F6HI 4ELKB 5FUCC 3W37A 4CJ0A 3K5SA 1QA9B 4RFEB 1E27A 2E4TA 1L3NA 3S34L 1HIMH 1PD0A 1GPOL 1BQ5A 3GINA 5DJ6B 1A14H 5DJCB 2YKLL 4WIQA 2F68X 2H3XC 3VWKA 4MQTB 5L88H 3STZA 4Q4EA 4F37K 4AGNA 1S4IA 2CDEA 4H40A 1FNSL 3IDNB 3KPMB 3PWPA 5DHMC 3LKOA 3SQOH 4B3EA 1U95A 4MSWA 4I2XA 2X6CA 4Y1AE 2C3GA 3QZPA 2DICA 3QUKB 4JGMA 3TNNA 5A2BA 4N8VB 1TFHA 3QNZA 4XH2A 5DFWH 4OD1H 1PY9A 1BVLA 5TE6L 2R2CA 1QHPA 2VH5H 4RQQA 1SRDA 4R3SB 4AIXA 1PZCA 2KBGA 4NPJA 5EU7C 2XFXB 5FHBL 1EVTC 2NY1B 4M56A 3ZTJH 2DPKA 2WXKA 4R84A 5T3ZH 4HZAA 3S88H 1BF8A 1E8YA 1NCWH 1XCTB 3B37A 4FFTA 3RILA 3K6SA 4JPVH 3NCXA 3OGCB 4N8CL 4FHKA 1GGUA 5D4IA 5LXGL 1G4MA 3R4DA 3B9AA 1JN6A 4Y5XA 3VI4B 4PH8A 3RL2B 4NO0B 4XNMA 4OD2B 1ZKAA 3MRBA 4TNWK 4MA3B 3FTWA 3IAPA 3KBPA 3QIUC 5DJ0B 2CA3A 5DRWB 4Z78B 3QHFH 2L0DA 3OKNB 4MCZA 4XVUD 3C5JA 4NQTA 3BFWA 4A7GF 3WMPA 1FFOA 4PWHA 2WXFA 5D5ME 5CBEA 3QJOA 1HWHB 3FB6B 4G8IA 5D4QA 1E9PB 3QEQA 3KXFE 3L3GA 2HT4D 2BVEA 1UKTA 4GNKB 2EIKB 2EQDA 4HJ0D 4Y1TA 1A66A 3T77B 3D39A 3LKSA 4RIRB 5KYWA 3HI5L 4GKOA 2ZOKA 2WLZA 1WBZB 3REWB 4Y7OC 3GZPA 5FO8A 4XNYH 4LLWA 5FFGA 1B0RA 4P2RB 2Y7QA 5E2TL 3U6XS 3QFGA 3DO3A 4ODHH 1FH2A 1FFTB 2VDLL 4JO1H 5C9JA 1EA9C 1G43A 1URLA 2HA1A 1X9LA 4DN4L 3U46B 4RBPK 1QFUL 3RGVB 3ARQA 1EEQA 4XHJC 2VDOB 1C5DA 5DYOA 5T1KA 1T22A 4C58B 1UJ3A 2ARJB 3RZCA 2R2EA 4POZC 4TVPE 5I26A 5BZWB 4DGYH 4M7ZB 1Z1WA 2PMZA 3DHJA 2VN7A 4YHKL 4F9LC 2BP0A 1TZGH 3SKOA 3DV4B 5GISH 5FO7B 3MLPA 1IQDB 1OT2A 4FXTA 4ZXBB 4X7SH 2K6ZA 1N6QL 4TLTA 5DD5H 3B2VH 1Z32X 5SWQA 5BVPH 3ZE1B 4EO5A 3IT8D 2PW1B 1CD1A 2BERA 3RE0A 32C2B 4WU5B 1BIHA 2EKSB 1O9WA 4MLIA 3BZEA 3J2PA 1QG3A 4ECNA 4R83A 4DZ8B 3AADB 3PV6B 4ZDHA 4N1CA 4MQXD 4OLVH 3B7YA 3BW9B 3QYNA 2XIBA 4W9HC 1ZANH 1I3RA 4XXCA 1QLEL 2XY1A 3CFEB 4JM2F 4DPBX 4KITB 3CN0A 5A43C 4LARL 3TPKA 1U3YA 2VDRL 1ZLUH 4HETA 1XWVA 3BZ4B 4QTIL 5F7HA 4M43L 4J3OH 4ZPTA 4L48A 5HJBA 3CH8A 4L9LC 4LLQB 4P4KA 3QJHA 1YEFH 2J5LC 2DQEH 1DZ0A 2WZPD 1HE8A 3GXMA 4DKTA 5IVXB 5JOFA 4KKBD 4P2RE 5D8JH 1CJYA 3PWLB 3NA9H 2FX7L 4K8RL 4UQ3B 5ERWB 3LNFA 3DECA 1IGJB 1IVLA 3S36H 4X6DF 5LO7A 4XVTL 2FD6L 1BAFH 2WTPA 4M6NL 5D2NE 3QYMA 1ZHKA 2DWYA 1G9NH 1NH6A 3D85D 4PJEF 1NSNL 1PD6A 2ZXWB 5SX5K 3BI9X 2X09A 3FHEA 3SQRA 1CBVL 5C08E 3KBFA 2FTAA 5T3XH 1CTMA 1ZTXH 4TNFA 3NGBB 3RB5A 1HHHA 1AO7E 4Q2ZA 5DK2B 5F71A 3UOAB 2AEPL 3ULSA 4LGPB 4BKLA 4PVNA 3PWPE 3G5VB 4YIQB 5AUMB 2DYPB 1ITBB 2OZNA 5EC1B 3VG9B 4N0YL 5EN3A 5F0JB 4I2XE 4DIXA 2QFRA 5CU5A 1NA8A 4EQ2A 3ZE1E 4MX7A 5IUSA 2NYYD 1KFAH 3G7TA 1NCCL 4HV8A 5BW7C 3LZFH 1BP3B 4S11A 4UT9L 5JLZA 3BUPA 5M94B 4F7CB 1TOXA 4PJXA 1KGCD 5LGYA 3SGDH 4X7EC 5D1XA 4MXQD 4IM8A 2UY7B 5EIIG 3B1TA 4G7VL 4R4BB 3DSNA 3LNGA 3I2CL 3PU7A 2LABA 3ARFC 3B4NA 4FC3E 4PJ9B 2FX8H 4MNGA 3KPRD 1AXSA 3ZX1A 5DZNA 3QULA 4PLJD 1OM9A 2HAZA 4QJ5B 2XWBA 3BWZA 3LZLA 3C6SB 1D5ZB 5ACLA 2ISDA 2GQHA 3SOTA 4PCKA 1JK9B 4Q8BA 2MQGA 3PWVB 1KJVA 4Y16C 4ODUB 4BFNA 5KG9B 5JDSA 1RUML 4FP8H 4LCUA 1V8HA 1RL1A 3IBOA 4B9ZA 4XWOD 4KZDL 1CGTA 3Q44A 3GBEA 4PI2A 4ANWA 2HRPL 1EDYA 2HKHL 2P5WD 3ESPA 1S7QB 2DLGA 5EBWB 4NUGL 5HHVL 1OVZA 1RULL 2R0LH 1KOAA 4PJ7A 2Z4QA 4G9FD 1MIML 5I0XA 1HH6A 5C0AA 1JVOA 2V2WB 1FBIH 1CFSA 3PQYB 3BUYB 3CLEL 3W9DA 4YDKL 1EEZA 2WK2A 1RUKH 1HEZB 1XXDC 3AUVA 1TO4A 4IOIB 4A04A 4YHPA 2YJLA 3FO2A 1BD2E 5KUKA 4I48B 3TFBA 4ZZKA 3VQLA 3BP4B 3LMJH 4DT2A 1HSBB 2K9UA 4YHNA 3AACA 1U92A 1M2OA 2CBMA 3PP3K 2IFFH 3QGVA 4NQXA 5BMFL 2WLLA 3N0PB 3C5ZC 4P2OB 1SLUA 4QRUA 3GDBA 4EN3D 5DJAB 1FF5A 1K6QH 5D6CB 1YYLL 4ANUA 1HOEA 1URIA 3KLAB 1Q1JH 1IEBA 2XQBL 4G80A 4ETQB 2XVKA 5I8EA 1F5WA 2FLBT 5C0BB 2YMTA 2YGOA 5AWNL 5DD1H 3VXTB 1JK8A 2DY2A 5FECB 4TQEH 2CR3A 3G5XA 1RZKC 2OP4H 3P2TA 4YPJA 3FOLA 4GXVH 4MASA 1FNGB 1BQHG 4PY8J 4YNYB 1THCA 2BP5M 4UQEA 5I1HH 4MDIB 3CXHK 4JKPH 3FUHA 1OF2A 1JUFA 4JKLA 4DP2X 4OQ1A 2ATPA 2AXFB 2HTLD 3WN5B 1QRNA 4E0RB 1S5IH 2NY4C 2YD0A 3MACL 2YD4A 3T4AA 4PP1D 1V5JA 4RGNC 3QNFA 2BSRB 2O5ZH 5IF0A 1KGUA 4XN1A 1AMYA 3CQFA 4PUBH 3NSXA 5FYKU 4E36A 3APNA 1KTBA 3QDJD 4YGVA 3IGLA 3Q8FA 3VTAA 3FQ4A 3OSVA 3H85A 5K39B 4XC3H 2KT6A 2BRRL 4J3WA 1OP5H 1JZDC 2EUVA 3BUBA 4AIOA 2XQYK 1SBSL 3O6KH 3QDGE 4HJSA 1ZSHA 3CXFA 3BEVA 4TLUA 1N8ZA 4OZHF 3WL9B 1J5IA 4GRWH 1RJCA 1KIPB 2P7TB 4GG8A 3QQDA 3N9GH 4P49A 4G1EB 4AZUA 5J1SC 1RK1B 5CP7B 1PVHA 1X5FA 2CJ3A 3OXRA 4ONFH 1ZT4B 3SO5A 3M7OA 3KEDA 1I9JH 3VTTA 1AQMA 1CYXA 1S3KL 1W91A 3MO1A 1LWJA 3ESMA 1INQA 3VFMB 2KI6A 4YLQT 1B9KA 2JIXB 1R75A 4ODSL 5EUKB 1RMFL 4FRWA 3K2IA 4EDWH 5I1JH 4ZFZA 3UL4A 3D25A 1XEDA 4FQQB 3OLGA 5MERA 2UYLA 1KJ3L 2EDTA 4YJZL 4MQ7A 2NY1C 2PABA 4P9HH 3KM1A 4X99A 1PIGA 2EDMA 5DHVB 5D1XE 1NGWB 1AI1L 2D31B 2W0LA 2WBKA 3OMIB 3BUTA 4Y0GA 2G9KA 3P3SA 4KJYB 3IJ7A 4NC1E 1IB5A 3F5WB 7FABL 3S96A 1BYPA 5TF0A 5F7FA 3A3YB 1ZAGA 5DJDB 2FRGP 2A6IB 2WWOA 3UTSB 1TZIA 3ARBA 3G6DL 4WHDA 4DEPB 5IT2L 2DTMH 4O5LH 5CP3A 3K72B 1BIIA 3WDIA 2PKDA 1AGCB 1QRKA 5AALA 1ZGLM 4MD5A 4XCNA 3L6FB 1IC1A 4KHTH 1WT5A 3IU4L 2HLFD 1OO2A 2ODHA 1Z2KA 1UB5A 1N0LB 1WG3A 5MEOA 4KPHH 3V4VL 1H6FA 1KZQA 5AW6B 2DLHA 5DTFA 2DKSA 2IDFA 3L13A 1BA9A 4S1SL 2NNXA 5C7XH 3BMWA 2SEBB 2JSFA 1DQMH 1SDDA 3JT0A 4MBRA 5DWUL 1FQ9C 1L7TH 4HCIA 4ZI8A 4P2YA 1H0DA 4UILH 3D51A 1U8HB 2OMWB 1KBGL 4WTZA 5L6YH 4ZFFA 2ADIA 2EH8L 4FFWD 1BCIA 1JNNH 1EHNA 4ODWB 3LNEA 5KSBF 3RGVC 4IKKA 2EXYC 5FCUL 4CUCA 2CXKA 2HVKB 1UM4H 2W5PA 2OYKA 3CG8A 2FB4L 3D52A 3OAUL 5IK3A 1EAPB 1ZPUA 5GSVB 4KZ0A 5TQ2H 2DQHH 3VCLA 2ZIDA 4G7RB 4M7ZC 2BINA 3MREB 1HKFA 1SMOA 2NZIA 4DZBA 1E43A 3ZDXE 1A6AB 3SE9H 2QL1A 1AS8A 4G59C 4ZXBC 4P04A 1Q72L 1JTOA 4N6RA 3OHXB 2YO3A 1CD0A 1A0QL 5BRZB 3TVMB 3VDAA 2OMTB 1MVUA 2VLLB 2H0JA 4ALAC 1GGIH 3I6LD 4X80L 4PHXA 1WZ1L 4KJQC 1N64L 3HC3H 3M7FB 2VIRA 5KSUA 1DQKA 1YPZF 1LMKA 1MFEH 2W07B 3BQUA 4ZQKA 2JKTM 2X10A 5HGHB 4MJIB 4XE0A 1ETA1 5JHDB 5SWSD 4GXFA 4KKCD 4N1HB 5T5FL 2N59A 3FQ2A 1CXIA 1QRNE 2UWEE 5T8IA 1UUSA 4MKMA 3GJFK 1JFQL 2FYYA 3MGTB 3IDXH 1ERNA 3NDZE 4TVPH 1N67A 2E46A 2J6EL 4P05A 5CO1A 3NSJA 3SBQA 1TQBB 4PVLA 3FQTA 2W59A 5LWYH 1FA4A 1FFRA 3NABL 5AD0A 3JZYA 3WHE1 2GCYA 1XF5B 1JPSL 1NAMB 4X4YA 3VD4A 3IJ8A 3BSGA 5JHLA 3EYOA 9PCYA 2Z6FA 3UJJL 2BNRB 4TN9A 4XMUA 5CD5D 4R7DA 5F7EH 4X9FA 3WIHA 5I19L 2ZX6A 2FCBA 3UBXI 5IEKB 1HNYA 1KN2H 1I7TA 4FZ8L 4NQCB 4X6CB 1SXCA 4ONGH 1ACXA 4K9EL 2VM9A 4R8WH 2XZCH 3MRLA 3NGBC 4WKXA 5CJXC 5DHXB 5E6ID 3V6BR 5MEQB 4Y1SA 5HVHB 1KV7A 1HNFA 1A6UL 4GQQA 1TEFA 2WAQA 5E2UH 4B9IA 4JO2L 2TRHA 1OGSA 1QWUA 3L4VA 1Q0XL 2LVCA 1NCAL 4G11A 2YSSB 1YN6A 4HLEA 3VG9C 1K2DB 3OKDB 3O4OB 1AACA 1BWWA 2ENPA 1PLAA 3LEVH 3VGFA 4KTYA 4P5KA 3DBXB 2FQFA 1QSEA 5LQBH 4N2DA 4ORGB 5DZPA 2QFPA 2BIHA 5AVTB 3WTVA 3F00A 3KPRA 4B6ZA 2AHIA 4Z7UA 4K94L 3NRFA 2VMCA 1KJ2B 4XXWA 1MVYA 2NY0D 3LXCA 1LO5B 4X2UA 1DFBH 4PJ9C 2VDOH 2WN3A 4FKHA 2G2RB 1SOSA 3Q13A 2BIPA 4W9GC 2QSCH 5DR5H 1EJOL 4OM1H 4BZ2L 1Q9OA 4LSQL 1JZ6A 2NW2A 3MBED 4HPYL 1QUNA 4P2QB 3REVA 1TEGA 4EOWL 3IU3A 2CJUH 3ZT6A 1KTLA 3CVIL 4PJCB 2I07A 3KGTA 4O58H 4ADIA 5AVSB 1ZIAA 4EI5B 3FONB 4G9FA 4XE5B 4JGUA 1N4XL 1E50A 1QVOA 3GMOB 4WDIA 4WO4D 4XCEA 4ZW6A 5CIPB 4TQ8A 1AR1B 2HZHA 3Q48A 5JDJA 3MKGA 4GPVA 3BRGC 2E7HA 2D7OA 1JS4A 3QO0B 3BD4A 2WXPA 2RTTA 3QZMA 4HKXB 1KULA 4RMQA 4JN1L 4EZKA 2NXYB 4P23D 3U25A 4BSVB 3K2KA 3S4SB 3QEHB 1WF5A 4OGAC 4DHLA 1LEGB 2O6DA 1MW2A 1NC4B 4OGXH 3WY2A 4J3XA 4BFFA 4HBCH 4QT5A 1HIML 5TPWH 2AI0L 3GS7A 2G2PA 3MX0A 1LILA 1XH3B 2Q0ZX 3RVUD 4E41A 3GZQA 4OLZH 1JNLH 2V7HB 1R3HA 3QYCA 1E6OH 1QFOA 4KFMA 4P2OC 2Q2EB 1YECH 3VXQA 5L88L 4OLUL 4X4XA 4OBRA 5GJTH 5KJ7E 1FYTD 1UEMA 2J8UB 4XP1H 5CINL 4NKQB 4X0KA 3NJJA 4PJFF 3M1BA 4P2CG 2ZSWB 5TDPB 3LQAL 3RX9A 1J05B 1E3ZA 1JP5A 4HIJA 4FLRA 1S7SA 1OF0A 4NKDA 5F1IB 2IGLA 4OGYL 2GITB 2BOBB 4LLMA 4GQ9H 2QDWA 2VQ4A 4HT1H 4N0FA 4ABVA 5IWLA 4PB0L 3T0DA 3TZVA 5GS2D 2VH5L 2VSDA 3GHEH 3H2PA 3UJTH 1ZVHA 1OWWA 4JDTH 4LCYB 4NQED 3QK0A 4FJZA 4LZKA 2VLKD 3GBNL 5FF6B 3HI1A 5B7EA 5T3ZL 1BZ9B 5SV4A 5CEZE 2D7NA 4HYTB 3AG3B 3GSOB 4LSRL 3U1SL 3WN5C 1JTTA 4JPVL 4HKZA 3QDJA 3ZO9A 1UXWB 2CLZA 4QJ3B 4WWKB 4OLXH 1ROCA 1UATA 5K93A 3BCFA 4RAVA 4G6MH 1O9VA 2YBRA 5EO9A 1GW6A 3OAYK 1NFDE 3QHFL 3DMMB 4UV4H 4ZS6D 3RGHA 4OF8A 5I18H 3D3VD 1ORQA 4Z7WA 1ZHNA 4RLDA 1I7RB 4IRJB 2ZG3A 2WCSA 3KWTA 1JV5A 2DV6A 3NCYP 1RV6X 1TNNA 4DCQA 3BN9D 2IPKB 2YGNA 2Y2WA 3IFLH 2H6OA 3GIVA 3MA7A 4EDXB 4HS8H 4QHPA 3S7GA 3W0WB 1OAZH 2ICCA 2VXQH 4JFDD 3H9HB 1SOXA 3ETBJ 5IEHA 1AS7A 2X7LA 4ODHL 4NIKB 2YXVA 4AYSA 2DJ4A 3UGEA 4LRIC 4JO1L 3NJFA 3L5HA 2FBOJ 2RD0A 4AJWA 1R24B 3QZWG 4AGPA 4J5VA 2ED6A 1U8KB 1E9OB 1JHLH 4DQOL 2X5PA 4XVJL 1T1XB 1TPXB 2XACC 3DX6A 5DEFB 4JFFA 4EN3B 4PGDA 1X5AA 1NLDH 2N01B 1BVZA 1F86A 2AQQA 1KGCE 1T03L 3WTTA 1WS7A 4OUUA 4WI8A 1GOGA 2IALB 2WXRA 1TZGL 5GISL 1MJ8H 3MCYA 2ZG1A 3FH8A 3ORJA 5C0FA 3DO7B 4X7SL 2NY5C 1EQWA 4CSZA 4QKXB 1NC2B 3ZDZF 5DD5L 1MUJA 3KPRE 4U1SA 3S3BB 1YMMD 4NERA 2YAEA 4BUHA 3L4WA 1NPJA 2Q76B 5BVPL 4LDOB 3GMPB 1JWUA 4TSCL 4ZOBA 2KZ1B 5L2JA 5CCHE 2AMUA 2I24N 5HJDA 2EIBA 2IJ0C 3OXSB 1OAUH 3VAEA 3DYOA 3UP1A 4Y8DC 1JGUH 3D9AH 3IM1A 3A4AA 3DOSB 4DGVH 4FNRA 2WXMA 4MYPA 5EU5B 5ENWA 4OLVL 4DEPC 1TCRB 2C9XA 5F1OB 1ZANL 3O4LA 4WW2F 2IQAA 3HAEB 3ARWA 1GGTA 5ANMB 2P5WE 2DQMA 3AREC 3IWVA 5E9AA 3KL0A 2XNAB 1H3WM 5KOMC 5IQOA 5IHUL 1NBYA 4XP6H 2UX7A 1OTTC 1JDDA 4DF9A 1GHFL 2H3KA 5I1GL 3VH8G 5EDSA 1P4LA 3TT1H 1P1VA 1FNFA 1YEFL 3W0WE 2DQEL 3VD7A 4NSKA 5EEWA 1ZLWH 3OSKA 4U1JA 3BHBB 5GGVH 3VSTA 5EB9A 3GBMH 5B38B 3MTRA 2DEXX 3S97C 3VFPA 5I6PA 4PBDA 5DMIL 3D2UD 3WHE0 1HXMB 3LD8C 4NDMA 3BPNB 3CVHB 1R3JB 4JFYA 1VENA 1EBPA 1ZHBB 2AEIT 3CPLA 4N5EC 1FJ1A 4PY7A 4LLAA 1Y6MR 3CXHJ 4UTAA 5GRXG 1OAQH 5I0DA 1A64A 3N40F 4O00A 4FQJH 1I8AA 4HCRH 1GCFA 1GY1A 4HPOH 3V0VA 1CTNA 3W1ZA 2D2CC 4KGJA 1NDTA 4UANA 5D55A 5DFVC 1KY6A 4QF1A 3WIFB 3JV4A 1U8QB 4BM7A 3JTSB 2R1XB 3N06B 2W81C 3TVMC 3GRBA 3SPGA 1KBBA 2Y72A 4GO9A 3OJMB 2AJZB 4NQUA 4YE4H 4DKFH 4KROB 3QIUA 4BSJA 5DWPA 5J9PA 2NNAA 1QI5A 2YUXA 2BSBA 3LZFL 2J88L 1E4KC 1MRFH 2NXZD 5IMMB 2E7CA 3B7SA 4HAGA 3FQ1A 2C1PA 2WZ6A 2IAND 2YZ8A 1MLCA 3VJ6B 4XI5C 1RZIA 3K80A 1G94A 4KXZH 4DP6X 5H35A 4PMEA 5D7LB 4WNQB 5D7IF 3RUGE 3QDJE 5CGTA 1DQQB 2FX8L 3FTVA 1F4XH 4FLOA 3H9SA 3LXAA 3L3KA 5HY9A 4EMZA 5HGAA 1TQBC 4U3XA 2X4SA 1QKZL 1JGVL 4ZMWA 3DURA 1UWEH 1ZVSB 1Z9LA 3VMPA 3HG1B 2I60H 2DMHA 3N40P 2WVTA 2BVYA 1W0VA 1WAAA 3U4BL 1FN4B 4FP8L 5DHVH 3PHOA 2O72A 3EAKA 2VAAA 3QCVL 3OBAA 5KYYB 5DCCA 5IMLB 2GPZA 1OK8A 4G6KH 5E6IA 3V0JA 3WO3B 2ZE0A 3U83A 4XTRD 3IDYB 5JO5A 4F9LA 1R5WB 3QR2A 3MJ7B 4XPFL 2R0LL 1HWWA 2J1YA 2QR0A 3B7UX 3HG2A 4B9JA 3IMWA 2DB8A 3FUDA 4CN4A 5F96H 3VMNA 5HVHC 1FBIL 4QXUH 1YEEH 3LPWA 1RUKL 1JZEA 5INCB 2BIQA 1N68A 4XP4H 1KB3A 3WG7B 4DK5A 2HMID 4X7TA 1NEZA 1XVSA 4AIZB 3O4OC 1T6WA 2R56H 4B27A 2ZUYA 3FULA 1X9RA 2GAZB 4IW4C 1IM3B 3WNPA 1I85C 4NUMA 1H5BB 4NYLA 3O11A 4EZLA 4NBXB 3L1OH 1FVEB 1L9SA 4FFZH 5IQ7H 1DJSA 5AVUB 5DZLA 5H94A 4CVZA 3EJTA 5E2VH 5FYJU 1I7ZA 2DQGH 4KOBA 1JZJA 2C1OA 1DLHA 1QNZH 2CUMA 5F1KC 1KCKA 4X83A 3HFFA 1A6TA 1MLBB 3HA0A 5JQHC 2Y36H 1OB1B 3SDDA 4L9LA 4IU2B 4FJYA 2OP4L 3VQ2C 4FA6A 1F1GA 5ESAB 3NN8A 4GXVL 4K7PX 2PCXA 2WINA 1WCQA 4NQDA 2R0WH 4OZIB 3EG9B 4U4BA 1XF1A 4J3VA 3KPOA 5I1HL 3G6JB 1LWRA 4JKPL 4HKJB 4IOFD 4K7PL 1HL9A 5I24A 2OJZL 3CIQA 1YUHA 1BLNA 1JF1A 1PF3A 3N85L 1FVDA 3EYUH 3I50H 4EI5C 3U6RB 3CFUA 3NIFF 1BDYA 4OFPA 3ENEA 4NO5B 5GZOC 4A2EA 1QQDB 3BLPX 3NPZB 3D2TA 4L0YA 4LCIH 4P23A 3O3DA 3AT8A 4FXGA 4ZSOA 1AR1C 1DUZA 1EXGA 1IGYB 1WZMA 3G9VA 4Z7OB 2VWEC 4HKBB 3GS4A 1ZGLB 4MFHA 5DJXB 4JHWH 4XC3L 2YWYA 5E7BA 2V7NA 2NXYC 2CDFA 3L16A 1KIRB 1WRFA 2YRZA 2HKFH 4BFRA 4PSPA 4I88A 3CV5A 4HJJH 2XTJB 3STLB 2IDQA 4DGIH 5BW7A 4JHUA 4GJTB 4L4TB 3R7RA 2H6UA 3SBRA 4ZMYA 4HOWA 2B1OA 3GXIA 2OMXB 1JPFB 2IBZY 1DVYA 1JXKA 3OLIA 2IPTL 5DHYB 1NGPH 1UZ8B 5E00B 5L4JA 3IMBA 1PDKA 3I6LE 1I9JL 4QLWA 4P5MA 3ARFA 2IG2H 1NAMH 3CMGA 4R7XA 5TF1L 1QACA 1B9ZA 3MRHA 4O2FA 2GSMB 3FAWA 3HNVH 4L4VA 4QRRB 5E23A 3VA6A 4MAZA 3JT2A 3VFVA 1Y07A 4YHZH 5D7KE 3UAEA 2VLKA 4EDWL 2YK1H 1XGPB 4KI1A 5SWSE 3B2DC 4JHAH 1DHKA 4Y16A 1CE1L 2B20A 3O2VH 2MIZA 1CYGA 2R9HD 2BJMH 3G6JE 3G04A 2DMGA 1HILB 3P4OA 4KKNA 3V5DB 4P9HL 2QQKH 4PGCB 1A6ZB 2ZAHA 4WWKC 1QO3A 1W8OA 4HGWB 1B4JH 3CSFA 4XOEA 2XT1B 4J6IA 1SZNA 3R1GL 4MDJA 3QR1A 2WWMD 2R8SH 3B7TA 3DMMC 2H32A 4Z7OE 3QFDA 1G4RA 2DTML 2I9LB 3DPBB 3KYOB 5IW6A 5KAQG 3ATFA 1HCVA 4S2SB 2VR4A 5HDWA 4IRJC 2XZAL 4EQ3A 5ADPL 3EF7A 5KJRH 4RZCA 2FJSA 3WD5H 4KHTL 3RI5F 2PW2A 3ASWA 4RMWA 1NIBA 2NY3D 5IFAH 4HK3N 3X13A 3HN5A 2IADA 3FTGA 1BGXL 4KPHL 1P5VA 4Y4HD 4FQ1L 3C5ZA 1JWMA 1KLUB 5TQ0H 4HH9A 2K45A 3A6CH 2PCFA 3ROOA 5C7XL 3TA3A 4CKQA 1J9RA 2Y7SA 4AT6B 1BZ7A 4AW7A 1L7TL 4GQZA 4WJ5B 1JRHI 1CVRA 2ZUSA 5CEZH 1K5WA 3RYMA 2FL5B 4LLDA 4YZFE 5L6YL 1LO2H 1DJYA 1M05A 1JNNL 2GJZB 1FFQA 3QUXB 4ZW5A 5C07A 4CMHC 4ZUUB 4HD5A 4XVOA 2B77A 4PWGA 4UUJA 5DRXA 1OIOA 4EN3C 1TPXC 1PAMA 1UM4L 1T1ZA 3MRNB 1ND0A 3MRCB 1YNTB 2CBQA 3NIDF 4UYPA 1F8TH 1XD1A 3BPCB 1W16A 2C3HA 4FTDA 4KWUA 2DQHL 5CIPH 1YMMA 3RKDD 5IM7B 1FVCA 2M83A 1GCYA 4OZ4B 4JPKL 3FW6A 3GF8A 1JE6A 2E7MA 1N6VA 5AL8A 5DJZA 3FB7A 5CGBA 4PN6A 5B3JE 4N90D 1RFDH 1Q9LA 3NIGB 3ZKSD 3OZ9L 4PW4A 3VFGL 1FZKA 5AFAA 1HXYA 1L9OA 3T8XB 5JHLH 1J87A 3QEUA 5HYQA 2F8OA 3DROB 1AP2A 3GSNA 4Y2DD 4PCYA 3HC3L 3WIHH 4ES9A 2H0PA 3D30A 1MFEL 3MV9A 3EF4A 5DC2A 2HTLC 2WYHA 2DZEA 1PKQA 2C3XA 3SSGA 5IREA 4ELKA 2DIJA 3FFCB 4FEIA 4X6BB 1QA9A 2D3VA 3DXAB 5EBLA 5EF2A 4J4PD 3FQNA 3SZKC 1H3PH 2QQNL 4ATTA 3VXUD 1MCPH 1DSFH 1MDTA 3WFBH 5ECGA 4QTFA 5D1QA 1K9TA 5J56B 2BSTB 2IPUK 3RVXD 5DJCA 4TVPL 3CZLA 3WENA 3D2UA 4XB3A 2W9DL 4P9MH 4MJ5A 2AJUH 5C71A 3IDNA 3KPMA 5HI4D 5LWYL 3HLAA 4QXTB 1IEAB 1UQSB 4QHKJ 3SDXA 3D4CA 3AUWB 1KBKA 3FH7A 1PLGH 5F7UA 3FT3A 3NK4A 1BOYA 2DWDA 3QUKA 4UNIA 1SM3H 4M8QB 3BPNC 4N8VA 4NM4H 1A22B 4MMZB 4O51B 4WJKB 3OKLB 1RUQL 2FR4A 2F7PA 5E8DH 4AQAB 5F7EL 1U2CA 1QOKA 2OQJA 4FHBD 4Z3HA 2BPBA 3K81A 4R3SA 1FYTE 1UD8A 2KHAA 1KN2L 3QIBB 1UWGH 4JDVA 5EBGA 2XFXA 3UAAA 3BWUF 4HWZB 3VGAB 1BVNT 1D7FA 4AOFA 3NQKA 3KLHC 1PZDA 3APCA 3OGCA 1YEIH 3CPUA 3VI4A 2IXQB 3RL2A 2ILLA 4NO0A 3EDFA 1QR4A 2JLLA 2WIIA 4KROC 5DJ0A 5DRWA 2YAFA 3MOQA 1T5KA 4KJPD 4NQEE 7TAAA 5F9OH 5KZCD 1CXKA 2IANA 3OG6B 2VLKE 2OTUA 2E8ZA 1Y6NR 5ICUA 2K3TA 2DEWX 2RMNA 1EXUB 4JFQB 3FB6A 4PS7A 5E6RB 4WGWB 4WVRA 5DC4B 1MCNA 4PG2C 1QUPA 4PJDB 5A40E 1YAZA 4HK0B 2X1WL 1IZKA 3DX9B 3CFBB 3VXMB 3ZDYE 3ALXA 3MLSL 4RIRA 1X4XA 4PQXA 2XUWA 3MRJA 5AYUH 1DFBL 2CALA 3REWA 4KVCH 4U6XB 5JXED 3JTBA 3D3VE 1MCIA 2L7JA 1SOKA 2RCSH 5DR5L 4GMTH 4OM1L 4UB0H 3F2LA 1FFPB 2WC7A 1JERA 1M2VA 2BWIA 3K2UH 2PF6A 4PTTB 4PJGF 2P52A 4YDMA 5CN1A 1M9WA 5SX4H 4G1MB 1XTMA 1OSZB 3VI3B 4IBSA 3U46A 1G1OA 2CHDA 4U1IB 3ATDA 1B6DA 4G6FB 4OCWH 4OKVB 3FN0H 2ARJA 5MEPB 3EZ8A 4JFDE 4PS8A 5BZWA 1MFAH 4OB5L 1E0OB 1RK0B 4AMWA 3IDYC 5FEBA 3IFNH 3V6OC 5I17A 3E2HB 4V1DD 1IQDA 3PIQB 1WQVT 3EO0B 3QPQC 3WJMB 4FD0A 5E1AA 5HDQH 4YBQD 4NHUB 4KK5C 3OR6A 3TJEH 1IBYA 2MPVA 5HYJB 4DKDC 3UIZA 2YQ3A 2PW1A 3WLWD 2Z7UA 4U6YA 3S5LB 1COBA 1R3KB 2OPCA 2EKSA 3CHQA 4HUVA 3HZ3A 1IGFL 2WUBH 1VGKB 4MD4B 5BO0D 2VDPL 2X53A 1H5BC 3BW9A 4DO5A 4GP8B 3QXTA 1AANA 4KK9C 5LGHH 1JNLL 4LQFH 1E6OL 1YMME 3CFEA 4G5ZH 4G7YL 5HI5C 1QPPA 3N5AA 4HA1A 4XP1L 1H8NA 3S2AA 4LPTA 3F01A 4GKSB 1RY7B 4OF7A 1GS7A 3C08H 4KC3B 1SEQL 3AS0A 1Z5HA 3S0PA 3RIAF 2CIIB 3S8GB 5CZRA 4BK5C 3F6LA 4LLQA 1HVXA 3HJEA 4JO5A 1T80A 3V95A 5FR3A 1GJIA 4HT1L 1I75A 3VXPB 3PWLA 2BNQD 4KKCC 5JMOC 3WKPA 3GHEL 4WTZG 2CHZA 5ERWA 4NQSA 5F1NB 2B9BA 3ZR5A 3ABMB 3MNZA 2A99A 5AOMA 1QSFB 5I6MA 3TURA 1CL7I 1PKQE 2DOCA 2DLEA 4N22A 2IH1A 4YOKA 1OE3A 2CRIA 2HYMA 4HAKA 4BFIB 5FO2A 1N19A 5LGJB 4ZTEA 4PRHD 3SYPA 1JZ8A 3OLDA 2WZ0A 3BT2H 3GUTA 4ZUWB 3LX9A 2XXCB 4HW6A 3KAAA 1BLIA 4MMXB 4XN4A 1KGXA 4J6RH 4UV4L 3HS0B 5DK2A 1HHKA 5T1LD 3MRKB 2JKXA 5I18L 3DJTA 4OZFA 3ZTEA 2F5BH 5AUMA 2BK8A 4X6EB 3TU6A 3P4MA 3SDXE 3P0VL 4O4YL 3L4ZA 4HJ1A 2XG4B 5EF1A 4PJHE 4PS3A 4ZTOH 2OMZB 3BWAB 5C0NC 4OFDA 4UDUB 3T0XA 4G6JL 5C0DB 1D9KD 4YSPA 4F7CA 3FSWA 3L1GA 5IVNA 1OAZL 3FFDB 2VXQL 3N44B 3GRGA 1K5NB 1YNLL 3RDJA 4AWJC 4UBDD 4PGZA 3NZSA 2DMKA 4JQIA 4R4BA 3E3QE 3E7JA 3DTXB 1QSZA 2EDJA 2BSDA 2PXYA 4Y5VA 3SB3A 4AENB 4HCGA 2EC9U 2DM4A 1HWGB 3EJSA 2YOCA 3RWFA 1MRDH 1JHLL 2VLJB 3PUCA 2UZXB 5HHQA 5ID0B 4NN5B 5EIIB 1JK9A 4WAFA 3PWVA 3LZRA 1LP9A 4A66A 4Q9CA 3FT0A 3T09A 4ODUA 5DQJB 5KG9A 2FQEA 2ZUUA 5AW2B 4JCMA 5L9DH 2WCPA 2JWYA 1UA6H 4PV8B 2FSEB 4U49A 4HIPA 5CU9A 1S7QA 2ITDB 3I6SA 4ODXB 1CQYA 4PR5B 2MCPH 4CMMB 3CUPB 5DA0B 1N5YH 5HHMD 1OAUL 4JKNA 3ZTCC 3RTQA 4AJYV 5A6LA 4UTAH 1JGUL 1JYVA 4DEWA 4DGVL 1HQ4B 4Z7QB 1YEWA 3BO8A 5IB2B 5IQMA 3EFDH 5EOCH 1I9IL 1WHOA 3PQYA 2ZICA 3BUYA 2KUTA 2D7PA 5MHSD 1TTCA 5LGKA 1HEZA 4OBSA 3BLBA 2CUAA 4Y4HA 5JR1H 5EF3A 1GYUA 2P80D 1UB6B 1IARB 4IOIA 1P2CB 3P0YH 1ZLSH 1M1SA 1MCHA 3KLDA 4KTGA 3UZQA 3BP4A 4NGHL 3GSWB 1HSBA 3B3IA 3Q2NA 2AZAA 4DESA 4DW2H 1Z3RA 4XBGA 5I74C 3DJSA 3KW7A 2Q8AH 3S98A 1CFBA 3MJ9A 1INEH 2QVFB 1Z9OA 2PN5A 1ZLVK 3RI5K 5D6CA 3MJWA 2JVUA 4FMVA 3KLAA 5AQ0A 1N7MH 3RWEB 3GBML 4NZRL 3CMOH 2WKOA 3BVDB 5J3HC 2JV6A 1BFTA 4MRBA 1JZ5A 5C0BA 5E8EB 4WWNA 3QUXC 4QRSA 4R96B 1KIQA 1OGPA 3TH4T 5IJVB 5GJSH 2Y1YA 5I0VA 1BJ8A 2QHLA 1FNGA 2VLRB 4NT6B 1IAKB 3W5NA 1SDYA 4YDVA 43C9B 4FQJL 2WD0A 2BWDA 4JM2B 4K07A 4MDIA 3AB0B 3WBDA 4KAQL 1FC2D 3L4TA 2J57A 3DGGB 3SE4C 4KY2A 2JELH 2VDNH 4KRPD 5CLWA 1SVZA 2J5WA 2PETA 2C9UA 2ZCZA 5FW7A 2EDDA 2C3VB 6FABH 5DVOA 2X1XR 3N42F 4QHUB 5C86A 1J8HB 5MEND 4JFZL 4PWJA 2BSRA 4YE4L 3CK0H 1MJJB 4K7FB 1YEHL 4C4KT 4NXKA 3SGEH 4UU9B 1S9YB 1LXMA 2N7BA 1QBLL 3SDYL 2K78A 4WFHD 2WVUA 4J4PA 1J9SA 5HHOD 3CSYB 5I1LB 5K39A 1MRFL 3KZ8A 4X6DB 1U8OB 5DVLA 1PPIA 3SDCD 1IKNC 4KI5D 1J8RA 4G8AC 4XZUA 2WB7A 4FQXB 4H5SB 4GEJA 4XCYB 4PJEB 5DEZA 4ZAKD 1K72A 1WBXB 2Z93B 4I0PD 2K6YA 4ZUVB 1LVEA 3EDDA 3WL9A 4R7VA 5J7CC 1FAIL 2WXOA 3BAIA 3WLBA 4M1CC 3KG5A 3QJQB 3EJZD 4AXWB 4HQQH 2P7TA 3AM8A 3B34A 1RK1A 5CP7A 5CJ8A 4MB5A 3H56A 1J9CT 1F1AA 4HS6B 5IB1B 3MBWA 1OW0A 5JQ6H 2AV7A 1AR2A 2I60L 2B1AH 2MQ0A 3AXHA 5FO9B 1PJWA 5EUKA 3Q5YA 2DLTA 3OKEB 4MMZC 4G6KL 3MPCA 4CSPA 3M17B 2N56A 2RQEA 4JS7A 2RGSA 2YD6A 5GGSB 2XWXA 3QIBC 3VSUA 1BBJB 1TG8A 3QSKB 4JZJB 1MJ7L 1XGYH 3VGAC 1T4KB 4X98A 1NFAA 4ZFQA 3PNRB 5C2BL 2D31A 2DBLH 4I3RL 1YEEL 3LS5L 2ZKHH 4JRYD 5I5IA 4NOFA 2K1MA 4RETB 1G7IB 1WCBB 3ZTJG 2VR8A 3MLRH 4MAUL 3FO1B 2A6IA 5D7JB 4GRMB 5D1ZI 3A6OA 5LBSA 1V27A 1EX0A 2BO0A 4ZS7H 4F7TA 2X6BA 2XVBA 3K72A 5IG7B 5DUMH 4JE0A 4W6XB 1LP9E 1HKLH 1EFQA 2IAMB 4FFZL 1S7RB 4X6DE 1NIDA 2VNCA 4FLHA 3WY3A 3L6FA 2VERN 1DN2A 5E2VL 5INDB 5JXEA 2DQGL 4OF3A 4OFQA 1KTCA 1AKJB 3CVBA 5KUMA 1QNZL 2IFGA 1SY6H 1BYOA 3MGOB 2HFEA 4AC4A 1VPOH 1F00I 4NPKA 2Y36L 5F0PB 3ZRCC 1INDL 1DBKL 1ETB1 1OAJA 1KENH 4JG1L 4H8WC 4TLKA 3NFSL 1GZPB 5IB5A 2WNGA 1L9TA 2ZWSA 2FBRA 3LKPB 5D2LA 4LP8A 3JTTB 4N1EA 3VXUB 4HWEH 1U8HA 2OMWA 2R2BA 5IHHA 4N8PA 3TWYA 3LXUX 1H15B 1MAJA 4ODWA 4UOW0 2P5EB 3AWEA 3WIIH 4NFBA 1U91B 3ULVC 5GXBB 2HVKA 3EYUL 3QPXH 4V1DA 1E4XH 4AQOA 4EIZC 3I50L 3M86A 4ENED 5GS2H 3LPFA 2D0GA 2K70A 4P0DA 5CLXA 4N20A 2ESVD 1TTFA 4AE0A 4LCIL 4GLRH 1MFBH 4U3SB 3MREA 5CXPA 3TH3T 2N1KA 1KWGA 3E2HC 1A6AA 2ORBL 5I1CH 4DP4X 3K5RA 4HF5H 2WB1A 4TM9A 3ECVA 3OHXA 5AL0A 4FQ2H 5EUOF 5B1CA 3UH8A 3TVMA 3GUFA 1RZ8B 1MREH 5AG8A 1A1OB 2HKFL 5GS0L 1BZDA 1GOFA 1SHWA 4WCYH 3RWGB 1FGNH 1L5GA 1ASQA 4RAUA 1SFHA 1FZMB 2OJ1A 1AY1L 1NJ9A 3JSSA 2W07A 3QG7H 1E4KA 5KVFL 1I3GH 1WA2X 3LKRB 1CDYA 3PDOB 4MJIA 5HGHA 3TIDB 1MCQA 4OJFH 3MNVB 4AL8H 2W65A 1JXFA 3RDTB 2KPWA 4JRXB 4N90E 5AYTA 4G9DA 4RRPG 2VE6B 2Q7YB 3S35H 5LJYH 1NGPL 3E3QC 1HCFX 1KN4H 3ESOA 3RBGA 1VERA 5T5NG 1NUDA 1DBJL 3FT9A 3X12B 4QRPB 3CU1A 1ESOA 1GOHA 5D4HA 5EHFA 3MGTA 2NXZC 3HNVL 2E7BA 3TASA 2ZWLT 4FTVD 1NICA 2A0LC 1U8MA 4NO3A 1IGCL 3ZL2A 2AEOA 4F15B 2YK1L 4OFIA 3QPKA 1HK6A 2H3NB 3QUMA 4CDGC 4W81A 5I8CA 3O2VL 3FT4B 3W3BA 1BBDH 3TOPA 3QWRD 1XF5A 2IMNA 4J3OG 1F56A 3GGWB 5DUBB 1P84K 3RIAK 3VXUE 4B60A 4L29B 5DQDH 3T1WA 2AXWA 3QCTH 1KXTA 1OSPH 2IOOA 2EIEA 1NGZB 3WEOA 1D2OA 2BVUA 2AQ3A 2BNRA 2Z9TA 4MHHI 3BKJL 2NW3A 4A2HA 1NFIB 4CU7A 1WWBX 5EIVA 1TTRA 4Y4KB 3UG3A 2CMRL 5GGTA 1WD9A 4NQCA 1YEDB 4MMXC 5MEQA 2R8SL 4P3WA 4UIKL 2HT2D 2B4CC 3W11C 4ZMQA 3TBTA 3HS0C 4RGOH 2JCCB 4Y19D 3P0GB 4LL1A 1MIEL 4BH7A 3EOYG 4BEIA 1D9KA 1GS8A 1XGQB 2YSSA 3D48R 5KJRL 3NSCA 2DQCH 1K2DA 1VADB 4F7PB 3KR3H 4Q7DA 3SBWC 4PJIB 3I9GH 3PGDA 1R19A 1I85A 2GJ6B 1KB5H 3EZJB 3DBXA 3LCYA 3QC6X 4JQXC 3S3JA 4H8WH 4ORGA 2EEBA 1TJXA 1WAPA 5IOKA 4AUJA 3V4LA 1NDMA 3QO1B 1KEMH 1KJ2A 1DN0A 1KTRL 2E86A 3LRGA 1FORH 4JPWL 5GRJH 1LO5A 4H7VA 1L0PA 1LO2L 1LK3H 1IAIL 2UZIH 3PWJA 2ZWZA 4XO8A 3TIEA 2G2RA 3K6DA 3QJFB 1K4DB 5GS1A 5FS5A 5IKCB 1SF5A 3D8MA 2A7BA 1F8TL 1DUYA 4NN5C 4MNHB 1XGTB 4P2QA 4F27A 4UT6H 4JHZA 1NCJA 5DT1H 1YA5A 1KTDB 1AHKA 2Y3AA 1OM3L 4HD9A 4PJCA 5KS9B 3WTYA 4WEUD 5I6NA 4TTDD 4EI5A 1T2QH 3P9LB 3UGUA 5CZVH 5GZOA 4U1MB 4OZHE 2CO3A 2C34A 2DLFL 3GB7A 5JHLL 5BO1H 1U8JB 2DIBA 1I53A 3EYVB 1MJUL 3WIHL 3EGDA 2P80A 4HLZH 4MJ6A 2D03H 4NWUH 3U2JA 1KT2A 4HWBA 4CU6A 5KSBB 5D2LE 2K7PA 3MV7B 4BSVA 3S4SA 2Q3XA 4UYQA 3BVNA 3QEHA 4P06A 1F45A 1OP4A 1DDTA 4M61A 1DQLH 1H3PL 2CLRB 2CNZA 2LFGA 1DSFL 3WFZA 1RVFH 4K9JA 4V1DE 3WEXB 2RQ8A 1XH3A 3HPJA 1EZUA 2V7HA 4HWNA 3GJEB 4DFIA 1QBAA 1ZEAH 2UZYB 3LNDA 4W9IC 2B5IB 4P9ML 1S9KC 3CAFA 2AJUL 5HHNB 2J8UA 4RMRA 2YSTA 3PF2A 4GSDL 3LRLA 2ZSWA 5TDPA 1J05A 1T5XB 1PLGL 3IDUA 4W93A 1CZ8H 2VT0A 5F1IA 2VITB 5L8JB 4FLQA 2GITA 1J5OH 1SM3L 4NM4L 4LAQL 4XPBH 3L95B 5E1QA 5IHLB 1A7QH 4FFYH 2TAAA 1O6SA 5E8DL 5ESQA 5EEZA 4E42A 1X7QB 5C09D 5HDOA 3F3HA 1A6PA 4JM2C 1UWGL 1NMBL 5HDLA 1J5DA 1U33A 5MENA 2KERA 3AB0C 1PYWB 1PU0A 3UROR 2VQ1B 1ZV5A 1CXHA 4ZMAT 1IC4L 4B95C 3EUUA 3GSOA 3VG0H 5C0EA 2CPCA 5JW4M 5E08H 4ZX4A 3UJIH 4L3CB 3WS6C 5D5MF 2C9QA 4EXPX 2BNQE 2VJ8A 1S9WB 5HJ3B 4LP4A 4HSAC 2XG5B 3Q2WA 5DQ9B 4PCSA 2R9HC 4G43B 4NNYB 3DMMA 5F9OL 2ICWI 3E38A 4ZAKA 4HHAB 1A1MB 1EHLH 4IRJA 5DK3A 2NDGA 2X4QB 4LKCB 4PRHE 5FGSA 4PRBB 1ZDSA 3KWVA 5FK9A 5C0GB 3HZMB 1VZIA 4GRLB 2CU9A 2Z0BA 5HHMB 4FQXC 2OYPA 3UYPB 4BUQA 4QXGH 5HJGA 3ZSTA 1LO3L 2VMEA 3KGSA 5AYUL 4YDIH 3U7WH 3NCYS 4LB8A 1U9KA 1A47A 2OXGB 3ARGD 1QEWB 4KVCL 1R17A 1A6VH 4R2GD 2B3RA 2KLTA 3F85A 2E47A 3O6ML 4XN9A 1Z5YD 3BVWA 5J5EA 4WLCA 4NI3A 4LVOB 5C3TA 3OB8A 3VUAA 3DVNB 5GGVL 5HGBB 3V6ZB 3K2UL 2DQUL 5JZ7C 3JWNE 4LASH 3ZTNH 2J12B 4L1SA 4LCVA 1GKEA 2IBGA 1R24A 2HP4A 5LCVA 5CNHA 1DP0A 3PJSA 2I27N 2CXGA 4K3HA 4ZG1A 4MA8H 1U8KA 1E9OA 4YDJB 4JFPB 4OCWL 2E27L 5IFHH 5DEFA 3FN0L 4IS6B 1YPZE 3RBSA 3HBZA 5I16B 4TQPA 3RLSA 3EH3B 4LBEA 3ME0B 1BF5A 2AQRA 2WXGA 3HZVB 4K5OA 3QZWB 3AQYA 3V4PB 4JFXB 3LSOB 3P73B 1AZRA 3O2DA 4JZJC 4QAMB 1GKOA 1NC2A 1NBZB 1QFWI 1EIBA 4I3SH 1GXEA 3TJEL 4L0ZA 1J5CA 2Q76A 2CUHA 4PIBA 1TNMA 3GMPA 5BRPA 2A74B 4ZTPL 3RX7A 1P7BA 3UTQB 1NGQH 4IMLA 2QVMA 3QUYD 3F58L 2QJDA 3OXSA 2YS4A 4E9RA 5I76B 4PS4L 5D7JC 5A3ID 4Z7NE 3V0AC 2XRAH 2WO2B 4Z9KB 5F7LB 5LGHL 1TCRA 3BP5B 4N0CC 3VU2A 1MG3C 4NJAH 2P8MB 2MQ3A 1K8IB 3HAEA 4PJ6A 1GSMA 2IAMC 2OKMA 2ZOWA 5ANMA 3UCQA 1T1WB 1MCDA 3HN3A 1YUKB 4IBZA 1X5YA 4PG9B 2GTWA 2D9QB 2ETWA 5HHME 3CH1B 1WEJH 4AVHA 2WHVA 4Q6IB 5JYLA 5TFSH 4L8SA 4BKTC 3FCTA 2VJXA 1D6VL 2CR6A 5KOVC 2V3FA 3GJFH 3EFFA 1N5AB 3NZ8B 5MHSE 5CKGA 4UDTA 1UD2A 1P4IH 3BHBA 1MQKL 3I9PA 4DKEH 5BXFB 3VXRB 5DLLA 1AE6H 2DTSA 3ARPA 3CVHA 1R3JA 1RLBA 3CN2A 4O9HH 3DTDA 1KYDA 1DYZA 1OWRM 2PP8A 3ZK0A 2R1YA 3ARYA 4GOSA 4WUUB 3KGUA 3R19A 4C83B 1W6WA 2OSXA 2Q6WB 2X70B 1ZWIA 2OL3B 2FO4B 1KBPA 3WIFA 1T04B 1BMZA 4YWGH 2QPDB 1S8DA 1MHPH 4KRMB 4LCWD 2F5BL 3EOAB 2R1XA 3HNSH 1YEGH 2AJZA 1Z7JA 3ZKMC 3S3SA 3O6FD 2MCG1 3HS8A 5FYKL 3ET9F 3RVTC 1HHGB 2CJSA 3EDKA 3QJSB 4ZTOL 4GIAA 2NUTA 2E75C 1EZVY 3FF7A 4OQTA 3DKHA 3GQFA 1A25A 3JYBA 3U4EA 3RDTC 4PG2A 3TF7C 2JJVA 1BVKA 4QAWA 1GC1L 5MENE 3RP1A 4U6HB 4XOBA 3PHQB 4FTVA 4NJ9H 4PGJA 4Z6AT 4WNQA 3WKML 1PD1A 2WXHA 4JZOA 3T4YB 4WFHE 5FUOL 5HHOE 1OOAA 4E68A 2CHXA 1AGDB 2Y2YA 3I84A 4LDLB 4NIYE 2A9NL 4F15C 3DSFL 3BXNA 4KI5E 4R5VA 2HJLB 4Z76B 4YN3A 3CHSA 3HG1A 5LNEA 4FA8A 2X38A 1QYGH 2YC1B 1JPTL 1FN4A 5L9DL 4GO8A 1ET5A 3OMZA 4D0CB 3ZZQA 1YRKA 4HUWB 2VSMB 4YR6B 2X12A 4U3HA 4KFZC 1IGMH 1IM9D 2MCPL 4Y4KC 3V6OA 4KKAD 4N2NA 4UTAL 2QHRH 5ALCL 4RA0C 2X3CA 4LOFA 5D71H 5AZEH 3KCWA 2HT3D 4XB7A 5EOCL 5FV1L 4PJFE 2Y5TA 5JA9A 1FIEA 3RWIA 4F33A 4HEPA 3JVGA 4ELMB 4I77H 1D5XA 3QUGA 2NY2D 4B9FA 5JR1L 2XFGB 3QORD 5FM5O 2MSPA 4ZMOA 5IHBA 1ZLSL 3BP6B 2VZOA 5EV7A 4UINH 1XF3B 1N12A 2K8QA 1TJHL 3L9RB 5CN2A 2E7LC 3P11H 1QTPA 2RALA 3ZDZB 5B3NA 1I9RH 4JRYE 4EJ1C 2JXMB 4AVIA 2J43A 1HL4A 2MQCA 1BVNP 1HZLA 3GRWH 2OZ4A 1N7ML 1OP5K 3EJQA 3VO0A 1KF9B 3CMOL 1MLBA 1YQVH 4BFOA 3SEPA 1OB1A 3VFOB 2CKBB 1YDPB 4B9YA 3ABZA 4XP5H 4H1LB 1FYHB 5GJSL 2WMPB 4JL1A 3VM7A 5FUZH 3RJOA 3EG9A 5DRNB 2N0MA 5GGRA 1X7TA 4IRSA 4ILDA 3UC0L 1E2ZA 1UXSA 1ETZB 2EYSA 4HKJA 3KWUA 1UA3A 2V5YA 3MFGB 1GL4B 4W4OC 4AQ1B 3FZUD 5CFAA 3M1CA 4MS8D 1I1AD 2JELL 2VDNL 4ODTL 3U6RA 4XR8C 6FABL 2IDUA 5C0CD 3CNKA 1RERA 4NO5A 1YEKH 5EEUA 1T3FA 4GUQA 3KPLB 1HC1A 1FSKB 3D06A 3MHZA 4AW4A 3CK0L 1DBAH 5HDBE 5ICZB 1RHFA 4QD2E 3TN0D 1HX0A 1DVSA 4N2CA 1ZGLA 5DJXA 2EDOA 1C1EL 3GLZA 3ZKNC 1NLBH 3K4AA 5CF3A 3BVUA 5TGBB 3L3DB 4A7SA 4RGMB 4OVUA 4BK4A 3U9UB 1L0XA 2ESVE 4BD4A 1Z66A 4YL9A 5DXWA 5H37H 4L4TA 3KW8A 2FT7A 5AOLA 5JTWA 2VOTA 1E40A 2OMXA 2GK2A 3PS6A 3UCRA 3EXJA 4RH4A 3QQ3A 5F9JB 4P3DB 3RWCB 4MJ4A 2B5IC 3TBWA 3UYRH 5E00A 1MOEA 1DQJB 3AMLA 5JQ6L 2HG5B 3NFNB 5JIIA 1AC6A 1DTUA 2R1WB 1TT6A 4N68A 5B7FA 2B1AL 2EH7L 3POCA 4HUKB 4XPAH 1J0IA 5D72H 1IZJA 4X8JA 4QRRA 2EVGA 1OT1A 3FUMA 2WXLA 1PIFA 4PJXF 2FO1A 2KYIA 2R2HB 3O2WH 2WW8A 2OMNA 2YWZA 2ZX9A 3BAJA 1P84J 2BW4A 2VRKA 5F44A 2KQNA 3HPLB 2MPAH 3IGFA 4O02A 1F13A 4F8NA 1IBDA 3CBJB 1AGEB 3QZBA 4DVRH 1HILA 1CICB 1XGYL 3V5DA 1QLEB 1QNIA 3E80A 5TDOB 1LE5A 5FFOA 4PGCA 4ZD3L 3G5ZB 2OULB 2FT6A 2LQRA 1MWAA 2R29H 2ZKHL 3QJZA 4Y89A 4FTVE 1BXXA 3MZGB 3MROB 2DI8A 1JJUA 5I9QB 2VDRB 5DZJA 2A3TA 5E70A 3FTXA 3L8QA 2FYVA 1DJGA 3UPCA 1QW8A 3ILEA 4MCNA 2A77L 3NDYE 4KTDL 4UQCA 4GAAA 5EO0A 3DVFA 3KYOA 2APSA 4J7RA 4FL4B 2PO6D 2DW5A 2CG9X 2P43B 3C6LB 4S2SA 1HKLL 2YZ1A 3EYFB 3HC4H 2AQTA 1MXDA 3FQRB 1CYWA 3OKKB 5HYSG 5EEYA 4D94A 4JHBA 5EDXA 1OZTG 4PJ7F 5FV2A 3ETSA 2WXNA 4H4NA 3KYMB 1MCEA 4BQBA 3V0DA 4A68A 1XV8A 4KJWD 1BFOB 1KLUA 3RPKA 3NZHL 4QHNB 4XX1E 3L7EB 4Y19E 1KENL 3US1A 1SNRA 1KXQE 3HZYB 3VD5A 4AT6A 4C56D 4M3HA 4LVOC 4WJ5A 4TUJA 4FQLH 4HWEL 1XF2B 2AK4D 2YEQA 5AOJA 2FL5A 2GJZA 3H6AA 3QUXA 4B7IA 2BC4A 4H26B 3WIIL 4HOZA 2XU9A 5KYUB 3MRNA 4GY4A 3ARDB 5GQBA 3BPCA 3U0WH 1M3IA 4UM9D 5AKSA 3ZYIA 2OFQA 5IM7A 5DURB 4RRPM 4OZ4A 3ULAB 2UXGA 5I1CL 4DKAA 1HQRA 1WSST 4ANXA 4HF5L 3QUYA 3MC0A 4PP2B 5FHAH 3SE4A 1EEYA 1A4KA 2HTKC 4FQ2L 3TBSB 4XCCH 3O9WB 2ZXCA 2R15A 3BSZA 4YSTA 2OTWB 5D7IE 2OCCB 3T8XA 2A74C 2ALWA 4WCYL 1FGNL 3DROA 2MHAB 4YXHH 3CZFB 1BFSA 4G5AA 4MMYB 1YJDL 1X7SA 3ZOAA 2ZUXA 4RNRB 1L7IH 1A4AA 3S35X 5GGTH 4KRPC 1XGRA 4OJFL 1S78D 1CGXA 3FFCA 2XWTB 3JWNH 4XNUL 4X6BA 3S35L 3DXAA 1KN4L 4HJIA 4ONHB 1QI4A 4I4WA 3TFKD 3U2SB 2KC0A 1K8DB 5F70A 4JN2B 3EBHA 4Q6IC 3HMWH 4MXWL 1KCRH 2BSTA 2MNJB 2YA0A 1TJGH 5DFTA 1RLWA 2KS0A 1IE5A 1ZLEA 3L2LA 3APDA 2NT1A 4QXTA 3GLEA 5TH2B 1IEAA 4JJHA 1BBDL 4X42A 3MLUH 4PV9B 3ARUA 4J8QA 1NL0L 4LEEA 4TOYL 5T1MB 5DQDL 3Q6GH 4FQHB 2AAVA 5EIQA 1Z3GH 3QCTL 1SJEB 5K33A 1A5FH 4M8QA 4NBYB 3HNTL 4O51A 1ZY9A 3DX8B 4AQAA 4LCWA 1FFNB 1PTZA 4M7LH 1VESA 2LLLA 1I1YB 1E5ZA 4RGOL 3CN4A 4GS7B 4QYAA 3LH8A 5I2IB 3SJVD 4QKTA 2ZWNA 3C9NB 4L5FL 1KCSH 2IXQA 4U1HB 4XGZB 4PRPD 5BV7C 3KPSD 2ZX7A 4IIZA 2O61B 5C09E 3QISA 4HHWA 1AZBA 1D7BA 1WWAX 3I9GL 4Z7VB 3DC0A 3FT2A 1SJXA 3IGAB 1DSWA 1KB5L 1RZJC 2XA8H 3GSNL 3B5TA 1G7PB 5FDWB 1IC5L 3EH2A 4HMCA 2G60H 3QIWD 3IJHB 2P24B 2F58H 4M5YH 5KJ4A 2BLFA 4PJDA 4XPHH 5D6DC 4HK0A 3DX9A 3CFBA 4ZMTA 1GZHC 3NIFE 4CC4C 1FORL 1C7TA 4OT1L 1LMIA 1LK3L 1Z9NA 4KKLD 4LBAA 4ZK8A 1RP8A 2ZTBA 3IF1B 4N28A 4PI0A 1ZA3B 4E5XB 3ZIYA 5D1ZD 2F53B 1A3RL 2P48B 1FFPA 4EE2A 1H6UA 1BAGA 4GAJH 1G6RH 5CN3A 4G1MA 3SDAD 3H7BB 1T0NB 5DT1L 3V4PH 3VI3A 4X9BA 2YOAA 4X0NA 3RWDB 1IM9A 3MR9B 3QZOA 4U1IA 2Q3ZA 2W9EH 2EXWC 3VX1A 1F42A 1T2QL 5CZVL 4DOHB 4UQ2B 2A6DB 4UZGA 3CDZA 1RK0A 4TUKL 3IBEA 3QFJB 1I8MB 2OSLB 4ZX5A 1GH7A 5BQ7B 4K4KA 3WJMA 3EO0A 3DTUB 3FCSB 3PAYA 2PLTA 1YMHA 4NHUA 1S5HA 5B4MD 1LDPH 1RIHL 3L81A 1G7JB 1KPUB 1TQCB 1BQUA 1JGLH 1ONQB 2YA2A 4RCAA 1QI3A 1E3FA 3KH3A 2QADD 1RVFL 1VGKA 4MD4A 1RH8A 5KVDL 1OAYH 2AAAA 3UAFA 5L2KB 4KHXL 1RHHB 4PJAA 1EO8L 5HD8C 3KPQB 1RK7A 2V3EA 3F8UB 4MZ3A 5K9JL 2P47B 1WWCA 3P4LA 3PHAA 2F54B 1N6UA 4GKSA 1QTYT 4ZZFA 2X4NA 5DS8B 2OJEB 2ZKYA 1YAIA 4LO9A 1CZ8L 1MAMH 2N1TE 3I02A 4NXSA 2CIIA 5E6SB 3U4AA 3KVDD 5I0YA 2OTPA 5E95B 5KEZA 4XPBL 1DDHB 1A7QL 3HE6D 5A2LH 4DVBB 3KLQA 3VXPA 2OAAA 2N3JA 4MD0B 5DMGD 5F1NA 2H47C 3DHMA 4XP9H 1QSFA 3BDYH 3IDJB 4QPEA 2IIJA 5C0CA 3IGKA 1SJMA 1BFVH 4G6AC 3CE1A 4AQ1C 2FJFB 2Y6SC 4BFIA 1G1KA 1KDJA 5LGJA 1DO5A 5ICXB 4AV4A 3VG0L 2QDVA 4H8QA 5ABAA 2DQFB 4B7LA 2YD3A 5BV7H 1KC5L 3UJIL 5A2AA 2WLNA 4OSUH 3QI9B 4PJ5B 4ZUWA 4YFLF 5E8OA 1FSKC 2FZ3A 4NC0B 3T3PB 3MXVH 1AXIB 4QYOB 4RA3A 3TNMB 3C12A 3V9FA 1DFXA 1WO2A 1FNAA 1M1XA 3NJIA 3MRKA 2QBWA 1IL1B 3ECQA 2HKAA 4XMKL 5SWZD 4FNLL 1EHLL 2YQBA 1EDQA 3O2DH 1NPNA 3BUDA 1NFKA 1QZ1A 1TKWB 1D6EA 3WGVB 4AUUA 2XG4A 1REIA 3IFOA 4RGMC 3EBGA 3B7RL 3AY4C 1PZ5B 4QXGL 5IQ9B 4FF9A 4OCXL 5E2WL 1HINH 3BWAA 3NIDE 4Z77A 1NKOA 2WQSA 2HT2C 4N0UB 2XV0A 4RMSA 4UDUA 4FI8A 4YDIL 5C0DA 5GRZA 1D7DA 2X2UA 4LCWE 1BG1A 1TLMA 1IAII 3HUJA 1E3XA 1F90H 4LASL 3DTXA 1MCRA 3PXJA 3ZTNL 1WA1X 1MZYA 4AENA 3MV8D 2AJXH 2B7DT 4PGBB 4MA8L 1FE8L 3FU7A 4JFOB 2EDWA 5K1JA 3ZT7A 1NKGA 2NR6C 1DBBH 3ATBA 5ID0A 4YFLI 5EIIA 3O3BB 4H0GA 2IBBA 1EGJA 4CBZA 4Z7UF 3J27A 1GPOH 4MBOA 2X42A 3FUEA 4F2MB 4OF5A 1T6BX 2BWQA 3JV0A 3HCVB 4QUOA 3RNQA 2PPEA 1CG9B 1ZLWK 2YKLH 1D3CA 3N1QC 2JKNA 4U4IA 5AW3B 3LRMA 3HB3D 2FSEA 1TZHB 4DNLA 1FNSH 4I3SL 1SN5A 3FDWA 4X7FC 2MEJB 4UOJA 1RJYB 2ZUTA 4AITA 3G5YB 2V8LA 4ODXA 5IW1A 1BEXA 4YVUA 3CUPA 4KDVA 2PO6A 1QWNA 2OMVB 3FOMB 2B1HL 5TTRA 3GTNA 4YHOH 1HQ4A 2AGJL 1I1AB 2XRAL 1XSIA 3NJXA 3T0ED 5IB2A 4QGTA 2PPAA 1E2VA 3B83A 3GXUB 3EO9H 4FL4C 3NK3A 1JZIA 3C6LC 1YCSA 2GC4C 5F2FA 4K8RC 5IROC 1XIWD 1XD0A 4F5CE 1P2CA 1Y7VA 1S7WB 3IXAB 2HVJB 2X2YA 2IDSA 1WEJL 3TH2T 1DVXA 2NPLX 4I9WD 3GSWA 5TFSL 4JPIB 3DUSA 4BSWB 1L9QA 3IK2A 3EXLA 3NYKA 2I26N 3SPIA 4GBXB 5FYJL 3VXNA 2A83B 3FQUA 3KVQA 5FWRA 2Z91B 1P4IL 2X6AA 1DVZA 1UADC 3RWEA 3W9EB 5BOZG 4JQIL 5E8EA 4OM0H 1S9XA 3ISWA 4UM9A 1AE6L 4R96A 4TPRL 1F97A 3WFHA 5I8OL 5IJVA 3BPLB 3ES6A 4NPYB 2YLKA 2VLRA 2B3IA 2VZTA 2OXHB 3FYEB 2FATH 2BSED 3ARDC 4IOSD 43C9A 2L3BA 3CDGB 4Q9RH 3AFLA 3MDJA 3RPIB 1WP6A 1AKPA 3L4CA 4PJAE 5E2TH 3DGGA 1K85A 1MHPL 4CADB 4OZGB 2G5BA 4RWHA 3PL6B 2VDLH 3WS6A 3O9WC 1BQHA 3MUZ1 4LDEB 2X4TA 1J8HA 2E8YA 4DN4H 2DM2A 4K7FA 4FG2A 1QFUH 1A7NH 4A2GA 4HS3B 4L3ED 1CFQA 4UU9A 1S9YA 35C8L 3JUYA 4Z95H 3ARXA 5I1LA 4PJGE 2M1KA 3SGJA 3S4SG 3BX7C 2R83A 1IX2A 1YG9A 5BCAA 4YHKH 5BS0D 4YSRA 1FV1B 5C0CE 4H0IA 4N2AA 4FQXA 2GI7A 3PE9A 2PNDA 1WPCA 3EHBB 1PG7W 1WBXA 2Z93A 1F3DH 2ZYIA 3RU8L 4LXFA 3K74B 3X17A 1N6QH 4QGYA 2VO8A 3KYKH 4U1KA 1W0WB 4NB7A 4RSVA 4AXWA 1XZ0B 4Z7WF 3QA3B 3EOBB 1SMDA 3RNKB 1O6TA 2YA1A 1KLFA 4BQ9A 2WNKA 2JJTC 2N7SA 2XN9A 3CFDB 4GG6A 3MJ9L 4MAYD 2JB6A 3T65A 2H8PA 5FO9A 1M6UA 1QLEH 5HP5A 4ERSL 3II2A 4WY7H 3IETA 3P2DA 4PLOB 4LARH 3KWWA 2VDRH 1DJZA 2B9AA 2PYEB 2E76C 3CDYA 4QTIH 3M17A 4FI7A 4B9GA 1IGML 2F15A 4W68A 4Y4FB 4NQQA 2QZ5A 3QDMB 1BBJA 3OR7B 4JZJA 1U8IB 2QHRL 3KPSA 3NCMA 1OTSC 3V0FA 1OGAB 4NZJA 3HUJE 5J6HB 3LIUA 4GS7C 2OYMA 1MFMA 1VKXA 4BIKA 1EERB 4I77L 4KXAA 3ILQD 1T21B 4ZT1A 3IS1X 3FPXA 3IJEB 4OLYH 1BOGB 1G7IA 2FD6H 3VRJB 4PRID 3FO1A 2DD8H 3GMQA 4GRMA 4M6NH 1U8LA 3H4HA 4JG9A 2YMOA 3ZHDA 3VXSD 2YPLD 3GSVA 5JORA 1EFXB 3P11L 1P7QB 3T2LA 4L18A 2WVSA 1B2YA 3C75A 3P54A 3TBVB 5F21B 1HHJB 2F2HA 2YAPA 1L9NA 3AT9A 1AKJA 3CZJA 1EHAA 1S6NA 3L3HB 3MGOA 5FYLD 1NDGB 3WE6B 4NRXB 5AB2A 2LAAA 1FZJB 3G08B 1U58A 4IGBB 1WTLA 5FKAB 4I1RA 4RX4A 2ZNWA 2Z35B 4QR7A 4GP5B 1PSKL 3PJNA 3B2UD 3JTTA 5CZKA 3QXAA 1JNJA 2OR7A 1K4CB 1G0DA 4G8GB 4A2DA 1CFMA 4P46B 5E9DD 2ADFL 3C60D 2LE9A 4PTUA 4PLKD 5B7MA 1MHHB 1MQ8A 3MKKA 1U91A 3BKYH 2WQ8A 1RKRA 4G7VH 2YD2A 5HI3C 1D5IH 4HBQA 2NNRA 3WEAA 2JNZA 1QPKA 1SF3A 2H6PB 3I2CH 4JREB 2BHUA 1UXMA 4C56E 4U3SA 3GEFA 3QBTB 4GFTB 3TBYB 3VQ1C 2ZX8A 1EXHA 1L6ZA 2AK4E 5ICYB 4XXDB 3K71B 2CM5A 1Y1UA 5E8PA 4CRPA 2ENYA 3UC2A 1RZ8A 1NLBL 3PAZA 2VJ0A 2CE6A 3RWGA 2PYFB 1BYNA 1UD3A 3PABB 4PJBA 1FZMA 1RUMH 1TQCC 1DVTA 1IFRA 1MWAH 4MB3A 3TGXA 3MRMB 3KPNB 4YH6A 2D8KA 4M62L 4GUOA 1NCIA 3IRZA 3PDOA 1TYRA 2HKHH 3TIDA 5CEYB 3Q3GB 1HH9B 1E7VA 3RDTA 4JRXA 2WZAA 5HHVH 5EFIB 5LBSL 3HC0A 1N18A 3DVGB 1KFGA 2Q7YA 2VE6A 2EEAA 2EP6A 2VN3A 3HE7B 4HZ1A 3GBLA 2Y7OA 4NENB 3X3FH 3UZEC 4QRPA 3LEXB 5FGBC 4XPAL 2A38A 1P69B 4EUPB 5C9KA 4F9PC 3CVCA 2GSGA 3J07A 4W9FC 1NCDH 3HZKA 2XLLA 1OD7A 3O2WL 3NCWA 1NUFA 2VXUL 5EZOH 3SYAA 3OKMA 5B38G 2NY7L 4NN7B 2HRLA 2H45A 1N9PA 1RZFH 2E9BA 2X4RB 3FN3A 4FXKB 5AVVB 2GBUA 2MPAL 3AG2B 3GGWA 4ZO9A 5ACZB 4L29A 4DVRL 1FO0A 3CFMA 1NGZA 3D87B 4BGLA 4ENZA 1WFUA 2ZOLA 2XQBH 1OTUD 3V0EA 1TQTA 1GVIA 3QXDB 5D7SL 5KSAB 4TSBL 1KTKE 1MFDL 1LK2B 2EE0A 4Y4KA 3VWKD 1DBMH 3BAWA 4LESA 1WAAF 3WFCL 1CE6B 4NZTL 3BZ5A 3VFRA 5CGYD 1JRHH 3NSFA 1RUPH 3UMTA 2JCCA 4BZ1A 2R23B 4GG6E 1CFNB 1MH5A 3L3IA 1KBWA 1G9HA 3HC4L 1DCEA 1ADQA 1BXUA 4F7MB 4G3YH 5EU4A 3QWQB 4RDQG 4PJIA 4UCFA 4X7CC 2NNFA 4KRNA 2GEEA 2K4WA 2BXYA 2GJ6A 1RXLA 3KNBA 5B1JC 4W6WB 1IIIA 3RQ3A 4M7LT 2HT3C 3LJ3A 2EILB 2VB5A 3KJ6L 5J89A 3BWUC 3WNIA 4IBUA 2EDKA 2XKNA 4IYKA 3SJVE 1ET7A 4PJ8B 3MNWB 4TUUA 4PRPE 2V3DA 3QO1A 3QUHA 4FQLL 3LVTA 3FNKA 1ZLVH 4WV1B 2ZP8A 1P5UA 2BRRH 5C3IA 2F18A 3T1FA 4KTEH 4BA8A 4F57L 1GIGL 3DX7B 3QJFA 1K4DA 4C54A 5DI8A 3QQXA 4P5TD 2AKRB 2GJPA 3V10A 2D73A 4ISVA 5F9WB 3U0WL 5K9KA 1XGTA 2WOYA 3QEQD 2CBTA 1S7XA 5FW6A 3MLTB 4W4OA 4X8CA 3QUML 4LSDA 5KS9A 3D39D 2V5SA 1NWPA 3GBDA 2WLJA 5CCJA 1ORSA 3LPPA 1WZLA 3P9LA 4TUOB 4U1MA 3ZRFC 3DK0A 1S3KH 3T0EA 4LHUB 4OD3L 4XAKD 3CX5K 5I1KH 3W38A 3EYVA 4QHMA 4YXHL 3KJ4B 5IR1B 1BMWA 1KGJA 1XIWA 1RMFH 3MRQB 5IIEB 2X9YA 2RBLA 1I1AC 5GGTL 4C4KO 1F4AA 1A7PH 5EPMA 4HIHB 4L1TA 3P69A 3L17A 4EKJA 4M8UA 3FRPG 1KJ3H 1ZK9A 3RVWC 1CK0H 5T1KD 4F7EB 2CPUA 3RZCD 1MI5B 3EOTH 4QI3A 5I1EL 2CLRA 4L8BB 4F92B 2F6AA 1X9UA 1UACH 4UT7L 1AI1H 1KCRL 2W9LA 3HBQA 3CZEA 3ZE2F 1QX1A 3GJEA 1TJGL 2V5RA 4KKQA 3S3DB 3SCMB 7FABH 2UZYA 4GBXC 5EUOB 1C5CL 2BX5A 1IT9H 4JFVA 3TTSA 2J72A 5HHNA 4FNTA 3SE8H 4J27A 3G6DH 5SV3A 3EDJA 4K9EC 2NX5B 1T5XA 2X1OA 2Y07H 1S9VB 3FTSA 2ID5A 3OD3A 2HN7A 4IOSA 2VITA 3Q6GL 4JGJA 3UAJC 1AQDB 1Z3GL 1A5FL 5AAWC 4HGMA 4AYDC 1G7HB 1YLBB 4Z0XB 3L95A 3BPLC 4LOUD 1ULVA 1VSCA 3VWJD 3IU4H 2WLYA 1U3JA 1X7QA 2HX7A 5C6WH 3V4VH 4YE0A 5I5MA 2R7EA 3LKNA 4HX1B 4KMTH 2XJKA 2APFA 4P57B 4S1SH 1PYWA 3UERA 5FKPB 1Q9KB 1TVBB 3H53A 3NAAH 3K0WA 4QO1A 3C2SA 5DWUH 3PL6C 2W60B 2IGFL 4OTXH 2PWFA 1M7DB 4K94C 4P4KD 1S9WA 2XBTA 1JFHA 2EH8H 2XG5A 5DQ9A 5J6GB 2WGXA 3RTLA 1TJIL 4G43A 4U0RB 5EU6B 2EXTA 4ZRGA 5GRWA 5FCUH 1OK0A 2XA8L 4ZUTA 4NNXB 4ZMNA 3OAUH 4JZNB 2A6KB 3P3UA 5GGQH 4OV5B 2A2QT 3FO0H 4LKCA 2F58L 2WANA 2XA3A 4M5YL 1S7UB 1VAHA 4MVBC 4PRBA 4RMUA 5C0GA 3HZMA 4XPHL 1FL6A 2AJSL 4GRLA 2D9CA 5DJYB 3FQWB 3UYPA 2DQ6A 1WGOA 3EHBC 4UQ9A 5LDUA 1Q72H 4J2QA 4PEEA 4XCFH 1N2RB 2ICWA 3GMRA 4AG4L 2OXGA 3HW7A 2WVVB 2IH8A 3DETC 1QEWA 4ES8A 2WAHA 2GTZB 3W56A 4JGNA 1BPVA 4UTBH 4MAYA 1JD7A 1GGBH 2C4XA 2DH3A 5FOJA 5SWZE 4B97A 3T6QC 2XVGA 4AI7A 2EKJA 2WBJB 3N43F 1N64H 3EGXB 3DVNA 4U7MA 4XN7A 5JW3L 3V6ZA 4OJCA 3QZWA 5FB8B 1VGEL 3UEZA 4D8PB 4YDJA 4JFPA 3IJSA 4UQBA 4J12A 4EZJA 5JPMB 5AB0A 1IKOP 1QFPA 4IS6A 4E9VA 4JFEB 2FIKB 4RISL 1F6LL 3V9CA 3SHSA 4I18B 2N0KA 3WAKA 2YEZB 2FJHB 3QUZD 3AXLA 3KPPA 1BJMA 4YSEA 3HHMA 3BEWA 3HZVA 3AC0A 2JJSA 2DIEA 1W72A 1WWWX 2KMWA 1JWSA 2KZKA 2VXSL 2V5MA 3FH5A 2NQ3A 3LSOA 3OJVC 3P73A 4JFXA 3V52L 1EHXA 1WUZA 2YRBA 2ICES 1M3JA 3MV8E 3PPEA 4H20H 4LLYB 5B39B 5J0BA 2HWZL 2CM6A 4FNPA 4FNUA 5EC2B 3CFJA 3NABH 1LDPL 4CN1A 1QAWA 4GKNB 4NUPA 3W39B 2WLIB 3LQAC 1AIFB 1IGIL 2VABB 2JK5B 2R0KL 5BZDA 1VFBB 4LSUL 4XN5A 1EAQA 4MGXA 1BECA 5FOBB 1G7QB 3BP5A 1CL7H 2P8MA 4G72B 4AM0A 2GIYA 3INUH 2AQSA 5MP6H 2ENJA 1C16B 4FZ8H 4XBPA 1VFUA 4QOKD 4EIBA 4R4FH 4PG9A 3NFPB 3O8XB 3M6DA 1E5UI 4M6MH 1QHOA 3CH1A 3KDMB 3LQZB 1A6UH 2YARA 4DN3H 2P8PB 1J1PL 3DJRA 3LYRA 4JO2H 1Q0XH 4OFVA 2OMUB 1KXHA 1NCAH 4IGBC 4Q4IA 1N5AA 2IV9A 5F8QC 3C60A 3N91A 4GMSL 3B9KD 5C0AD 3VDBA 2CRMA 2I85A 2WJ5A 3HR5B 4GSQA 4JFHD 1NOLA 3LKQB 4XP9L 1X9QA 2IH9A 4JQVC 3WJJC 4P46C 1BFVL 4I9WE 3VH8A 3X1FA 3VXRA 2Z34A 3T04D 5F7DB 3VTMA 2ARJQ 2OMYB 1CGSL 4M4RB 4PVMA 5LCVL 1KTJA 1J0JA 3F7VB 1VA9A 4WI0B 1CR9L 2X41A 4C83A 3D0VA 4AMXA 4PREB 4JREC 5C97A 2Q6WA 3SDXF 4CJ1A 3MXVL 2GUOB 1KYUA 3MYJB 4I0KA