5I17B

Crystal structure of human germline antibody ighv1-69/igkv3-20
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
216
Chain Sequence
b'EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 216
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B01
1UWXK 3LS5L 3VG0L 3EYOB 2AEQL 3SDCC 3EZ8A 1D7FA 3TVMA 4AG4H 4NSKB 4ZMAT 1KEGH 2EKJA 1HHKB 4X98B 4LPCA 4U7SA 1QSEE 3BGMA 1QSFD 5EU5B 3WBDA 3KPSB 1ZA3B 2IFFL 2OTUA 4OLWH 4PJAA 1KJMA 3BSZL 4AM0A 1JNJA 1ZWIB 2FJGA 3MPCA 4IEFB 4YIQA 3R06B 4HWBL 3F7VA 4NZTH 4MJ6B 2E27H 4LFHG 1JZ2A 2J1KA 3VFWB 2F15A 4OAWA 4JEGB 4MD5A 1BFOB 2ITCA 4PGDB 5BQ7B 1EV2E 4H25B 4L4TD 3ULVH 4Y5VA 1YQVH 4CBPA 1WAAA 2W0FB 3EOBB 4G8IA 1CVSC 1AQKL 5C1MB 4KK8C 3T65B 3T4AA 5I19H 2HFEA 4PUBL 2O61B 2ARJB 4QRPB 1QPPA 1X4ZA 1OVZA 1UT9A 2IGFH 2HT3C 1A4KB 1CGSH 1CU4H 2ZG1A 4M7ZB 3GKZA 2X70A 1AKJD 4J12A 1J7VR 4ZD3L 1MCOL 2DQTH 1Z9LA 3VXRB 5JR1L 2APXA 2JJTA 1I7TB 4UT7L 5DQJB 4ZOEA 3O4LD 2Z8RA 2FJHA 4GG8A 4Y88A 3IFOB 2ZOLB 3VDBA 4YHKH 1NLDL 4JFXB 3T3ME 4M6MH 3DIFA 5T5FL 1MFAH 4KTEH 3LH2L 2GHWB 1NCWH 3P73B 1KPVA 4JFHD 1RAMA 3EOTL 5A40E 2DQIH 3FFDA 3S4SG 3SE4A 1C5DB 1E4KA 1SBSH 4LARH 3GHEL 5DZLA 1T7XA 5TFSH 1D3CA 1M7IB 1U6AL 4PBVC 4J4PD 2W9LA 4H0GA 4FMKA 4U6TA 3T1FA 3GBNH 4EDWL 3D0VB 4NCC2 43CAA 4AT6B 3GO1H 1ZV5A 5I2IB 3U2SA 1BJ1H 1H5BC 4Y2DC 5BRZD 5K9OA 4KVCL 3L5IA 5DFWH 4WHYG 3QHZL 5F9WC 4JQVC 4NRZA 4XPFL 5FHBL 2A77L 5K9JL 3H9SE 3FQTB 1EEZB 4ODHL 1NEZB 2RCSH 3ALXA 3OXRA 4D3CL 1IM9A 1OSPL 4NPYA 1HYRC 1QBAA 4M61B 3T0EE 3GMLB 4WI5A 4MD4A 3QDJB 2I9LA 5I1HL 3BOVA 4RFOH 3TT1L 1TENA 4KMTH 4HIXL 5CD5D 4KAQH 4P4RA 3JTTA 3GSNL 4M1CC 4LPXA 1LP9E 4FFZH 5CBAA 1Z5LA 4RGNE 3GJFA 4R4BA 1NGYA 1F45A 1CFVL 5TDPA 5F7EH 3TNNB 5J3HC 2IH1A 5EO1B 1ZLWK 5DJ2A 4ZXBB 5IB4B 2JB5L 4O51A 3VXUA 1NGWA 1MCJA 5KAQG 4YHPB 4GW5B 4S1RH 2Y23A 5DXWA 3ZDXF 5T1LD 2CDGB 1WT5C 1AR2A 4HC1A 1J1OL 4HCRH 5IVNA 3MJ6A 1JHKH 5F7LB 3QIBA 4BM7A 1NJ9B 1YC8A 1JWSB 5EU7C 3BO8B 2X4PB 5JA9A 3BUYB 2Q86B 5HPOA 1Z9SA 1AGCB 1A1NB 2IANE 3RWEA 5DVKA 2ZUYA 5LGKA 5BV7H 4PRDB 4L5FH 3NPZB 2FL5B 5ELIA 2YPLA 4OD3L 3UTSA 2P42B 4PPTA 4PTUB 4MSWB 1CT8B 2ZSWB 4N9OB 3QNZB 2HFGL 2MOVA 4HMCA 3W82A 2CR3A 4EI5A 2EDQA 4WO4B 1BQUA 4MAYB 5E4IA 4JO4L 4QRTB 5E08H 2Q8AH 4KI5C 4V1DD 2AK1L 2BERA 1ZLVK 4Q6IA 2BSTB 2PW2B 3RX7A 5D9SB 4LIQH 3CCHB 3FN0L 1YA5A 1H8NA 4LLYB 2FJFB 4FP8L 3O6FB 3T0XA 3D39E 3VGGA 1FGNL 2GUOB 4PP2B 2E7HA 5IT2L 2XRAH 3DVFA 1FZMB 5C09D 5JXAH 2ENYA 4XP4L 2IWGA 2LAGB 5FOJA 2EE6A 2BHUA 5SWSA 4NM4L 5GRJL 2XACC 3DX9A 4HK0B 1XIWD 1FNEB 1ULVA 1OLZA 3WXWH 4A2MA 1VCAA 1ZTXL 1MCFA 2VSCA 4JHWL 4CDHA 4Z7WB 2CKBL 4U1LB 1YY8A 1T7YA 2PXYA 5GPRA 1U8OA 2ORBL 1SEQL 1I9RL 3OR7A 5HHVL 4PV8A 1OAQL 4U3XA 2VQ1A 4XTRC 4BSWB 4IRSB 1C12B 4MB3A 1HYSD 5D70L 1TMCB 4U6VL 1DE4A 3HRZB 1IGFL 4CNIB 1U8PA 4FQ2H 1SJHB 5I15L 1Z9MA 1IZKA 5KOMC 4JRYA 3PWPD 5AG8A 1VEMA 2H9GA 3HI5L 4HS6B 3IFPB 4NRXB 2W60B 2OYPA 5GS1B 1P1ZB 4X6BB 4TN9A 1B0WA 5EBLB 4ZUVB 3WDHA 4UUJA 4Z95L 4U1SB 4ZFZA 2NY4D 1MLBA 5KN5A 2CD0A 3GZKA 4MQXD 3OKEB 2VDOL 4M7KL 2DBLL 1G7HB 3IFNL 3ZE0F 2O26U 5C0AD 1D5XA 4JZNB 4D9LL 2AJ3B 4WUUD 3JTSA 1F11A 4CADA 1NCUA 4GBXD 4UU9A 1T1WB 43C9A 2MPAL 1SJEA 3FB8B 3VXNA 3MRIB 5DHXB 3SDXE 4X6CF 2A9NL 5JA8B 3D0LB 2BNQA 4P59L 3C9NB 4OQTH 5GRWA 5D1QB 3L3GB 2Y6SD 1IAOB 3VFOA 1YMME 1JTPA 1LDPH 1NMAL 4Z78A 3TCLA 5J6HB 1ZHLB 1SYSA 1AIFA 3G6DL 3K80A 5DJAB 1NAKL 1LK3H 3KYKH 1X5HA 1HH6A 4GUPB 1OTTC 12E8L 2QHLA 1A3RH 5IF0A 1YEHL 1H3PL 3LQZB 4YR6A 2R8SL 3D18A 3LN4A 1XGPB 2RB8A 2E8YA 4PRPE 4X8XA 2E6PA 4R7NA 5GIRA 1DEDA 4PGEB 1A1MA 4RA3A 3VJ6B 2H32H 4OZFA 4G9FD 4AIXA 2V2TA 4IIQC 1QRKA 3WHXB 3ARSA 3CVIL 4YHZH 1F00I 4LNVA 3MRJB 3TBVB 1UZ6E 2C9AA 2CIIB 5FYKD 2D9CA 3FO2A 3HZMB 4C57C 4ZAKD 2BVYA 3O11A 4D9RE 2BC4B 4OCYH 3QCUL 2GQHA 4Z7OE 5D1ZB 4TNVK 3H8NA 3BEWB 5IHLB 1XIWC 4JZOB 1GCFA 2DQDL 3O3BB 3BDYH 5GS3A 4H8WL 2SEBA 3P2TA 4X80H 4X7TA 1DDHA 1MI5A 3GI9L 3SY0B 1A21A 3H7LA 4ZUSA 4PJXB 5A16B 3STZA 4NT6A 2AJZA 3L7EB 3TO4C 1BLNA 3CLEL 1EJOL 2Q87A 5JUEH 1VDGA 4XPTH 3T0AA 3KR3H 1D9KB 1ZSDA 3QEQD 2A2QT 3NPSB 3IT8D 5BZWA 2FX8L 4K9EL 2R2BB 1FFRA 3CX5K 1GGTA 4LLAA 4XMKH 2XQBH 2M2DA 1KB5H 4ZDHB 3X11B 3U4BH 4JRWA 5FUZH 3VXMA 5HXMA 4U1MB 3TH4T 3WMSA 2JIXA 3CK0H 5CEXB 4MD0B 3VH8B 1U93A 1LDSA 2JCCA 1U8JB 3QFJE 3QXTA 1NGXA 5JIIA 4F7EB 3GMMB 3IRPX 2UYLB 4WVRA 4I3RL 4JN2A 4I0PB 1NC2B 2QL1A 4PJ5D 2OL3B 3ARFD 4GBXC 2P8LB 4UDUA 5ESVB 2A9MH 2VR5A 4DUXA 5HHNB 5IFHL 3IJHB 4HZLA 2EIZB 4Y5YB 1CL7L 2VJXA 4TOYH 5CCKH 2GT9A 4ZOBA 3DMMC 1S9VB 4DAGL 1HDMA 5C0BA 2Y6SC 1LD9B 4OV6F 1JN6B 4DQOH 5C0CE 4RIRB 4OCMC 5EB9A 1YECH 3J8F7 2QSCH 5A2LH 1INDL 1YNTA 5DQDH 1R0AL 3MUGB 5D96C 4CVWA 3Q3GA 2HKFH 2VUOA 4Z7NE 2YBRB 4QOKB 5D93B 2BXYA 5F96L 5T1DH 4UQ2B 1Q94B 3AREB 1UWGH 2UZXB 1AXSB 3S37L 4LSRL 1E4WH 3D6GA 5GJTL 2IPUK 2QBWA 4NJAH 5IIEB 4H0HB 1G9EA 5HHPB 5FA3A 5B38B 1A9BA 1YN7A 3OHXA 4ONOA 3RTQB 5IK3A 3RNQB 2COQA 3AXLB 4AEHL 3B8YA 3DV4B 4UAOC 1GC1H 5E8NA 2X05A 3LMJL 2OJEB 4ZAKC 4IOIB 4NNXA 1BGXL 4FQXA 5H2BA 1KCKA 1B0GA 4KHTL 3MRBB 4LKXB 5BVJA 4OLYH 4FABL 5I1AB 3I02A 4OCNC 1IM3B 4IRJA 1U8HA 4GW1B 4OZHA 5H8DA 3PL6C 3UC0L 1W72B 4OGAD 4UT6H 2VL5B 3O3DB 2QHRL 1QEWB 2V7HA 5EO9B 3MXVH 4AIOA 5HYSB 4YDJA 1WICA 4FFWD 3BWAB 5DRZB 5HDQH 4D9QE 1CLOH 4OGXL 1EVUA 1CZ8H 5SX5K 1JHTB 2VXVH 3NIFE 2X4RA 4OIBA 1LE9B 4TNWF 1AH1A 4UV7H 3OAZK 4XB8A 5DUPH 4LHUB 5IFAL 4HD9A 4G43A 3MLVL 3GSOB 3NA9H 3VGDA 1W0YT 4G8FA 5E1HB 3HC0B 1FH5H 1HQRA 2BZDA 5I1KL 2VNCA 1YUHB 1DR9A 2JB6A 3GJFH 2A6JA 2XXCB 3NGBC 4JO3H 6CGTA 5HHMD 3QXAA 1FNGB 1UGNA 2YUWA 4MNQE 3WIFA 3F7PC 1J1XL 1M6OA 1AGFA 2YRZA 1EFXD 2OQJB 2CK0L 3WFCL 4TSBH 1OQOA 1FN4A 4NBYB 1CDGA 3BIKA 1KC5H 1LEIB 4Z0BH 4RISL 3FFCE 4G6KH 1EO5A 3P9LB 1J10A 3ARFC 3MFFB 5EBMB 5IJVB 4MDIB 1T03H 4HC1H 1SYVB 3U7WL 4R96A 1YN6B 2AABH 3QO1A 3MRDB 2XTJD 3ARBB 2EYRA 4PRNB 2R23B 4JR9H 2MNUA 5FYJL 3IDXH 5C9JB 2YMXL 1T2XA 1JPGB 1HCFX 5C7XH 3MV01 4R6UA 5D7JA 1S9YB 1U58A 5T3XL 1JZ5A 2EYTB 1XFPA 5EOTA 3SDAB 3HCVA 2AQ2A 2XWJB 4RAVA 2J8UA 1G9NC 4K3JL 5BZDB 5KS9E 5DZOA 1R3HA 4JJHA 3EDKA 1SM3H 2MJWA 3GMRB 4X8JA 1MCHA 4XWGH 2VC2L 1B0RB 4PYHA 1IGYA 1FFQA 1E4XI 4Y1AE 1AQDA 4FTVE 2P7TA 1J12A 3OB8A 4HXBH 4PJ9B 1KPRA 5GRVL 4HFUL 1EEUA 6FABL 2W0KA 1Z6JT 3T04D 1RZKL 4NJ9H 2DLFL 5DD5H 3QIBD 4R3SB 3MOBH 4LQFL 1UFUA 1TTUA 4Q2ZB 2NX5A 4NUJA 5IKCA 3GMQA 1HSAB 3UTQB 3TN0A 4PJHB 4UQ3A 1F3JA 5DMYA 3MO1A 4WEMB 1CK0H 3RUGE 4OGAC 3HE6A 5I8KL 4J8RB 4HV8B 5KG9B 3ZZ1A 3I2CL 3FB6B 4OCSH 3SDDD 3B9KA 2QQLL 3HKFA 4FFWC 2O5XH 5F88A 4R0LB 4MWFB 2VXUL 4OV5B 1P7KA 4UOW1 3WIIL 2Z93A 5E5MB 2F19H 4NO3B 4BZ1L 3RL2A 2AXHA 2AJXH 2VN7A 3BT2H 1MWAL 4BH7B 1FZJA 4ZUTB 3MLUH 3BP7B 3KDMB 4YBHA 1XH3B 1WT5A 3DGGB 3O2VL 3BN9D 3DX6A 3ARTA 3LEYL 4JPIB 1M05A 1PKQA 3VXSB 4M93B 3TA3D 5D2LE 4JFOB 3P30H 4J3OC 3G5XB 1CBVH 1QHPA 5IB5B 3N9GL 1TETL 4GXVH 2KH2B 1KCRH 2R1XB 4ALAL 1CDHA 4XC1L 4P5MA 1M71B 2NY6D 1RVFL 3OXSA 1PAMA 3QG6A 4X5XB 2VDLL 4W4NA 5CJXC 3V6OC 1MQKL 3LEVL 1KNOB 3EYFA 3AS0A 1SEBA 4LSTL 2CO7B 2D9QB 5J4MA 1FYTD 2R0WL 5LBSH 2WM0A 3OJDB 4XNXH 5TF0A 1FJ1B 3WE6A 5TPWL 4K55A 3IGAA 2XN9A 3T0ED 4HF5L 4PJAF 1YJDC 1DBAH 2VWEC 2FYYB 3SE9H 3TWCH 3CH1B 3BYTA 4LVOB 4C54A 3MR9A 1F4AA 5HYSG 4L1DA 2A6KA 1H3WM 3OKYA 3EW3B 1TJHL 3V79C 2N7AA 1K4DB 1RZJC 4ONFH 1A7NL 4NWUL 2ZUTA 3O2DL 1BFVL 2XT1B 5DJCB 5FXCH 2P24B 5CZVL 4GKOA 2DTMH 4F7TA 2P5WB 3RDTB 2VH5H 4OZFH 5EUOB 2VLJA 3VWJA 4S1QL 4QYOA 4Z0XA 4DGVH 4JG0H 1BECA 2RIKA 1JPTL 4FQQA 2P43B 2ARJQ 3HMXA 5EC1B 5DWUL 3ARGB 5EU6A 4NYLA 2N4IA 2BNQD 3EHBD 4WEBL 2ZP0T 3CVHA 1X5XA 5CSGA 4E0RA 4OI9A 3O6FC 3P0VL 4HJGA 4NO2B 2IAND 1A7PH 4KC3B 4LAQH 4XXDA 5TQ2H 4M6NH 4N8VA 2X1PA 3SDDC 2DQUH 3C87A 3UZEA 4YE4H 4GG6F 1B90A 4PJGA 3FQWA 2P5EB 3QNYB 5E6IB 3ZDYF 5IBUB 5ICYB 2X1OA 3S35H 5KVDH 1QRNA 3PQYB 3GUTB 3PHOA 1RK0B 1UH2A 3CFEA 2Z35B 5LGJB 2VZ3A 1E6OH 2DMKA 3BN9C 3ZKMD 5FKPA 3HMWH 4PJ8B 1KCVL 3FT4B 3TA3C 3MYJB 2EDHA 4LVHC 4AL8H 2XA8H 4KK5C 3HTLX 1FLRH 3FRUA 3TT3H 1J0KA 4JFEE 4L8BA 4O4YL 1I9JH 1BQHB 4KRPC 4H0IA 1YEFH 1T22A 3HRPA 4K71C 3QWOB 4NHCH 5FA4A 4Y4HD 2NY6C 3WN5A 5AWNL 1QLFB 2NZ9D 2I60L 5HJ3B 1TJGL 5L0QB 15C8H 3JWDL 4QHNA 2X44D 3HB3D 4JFPA 3PDOA 3S5LA 4XCEA 1B2WL 1FO0A 2CLRB 2UWEB 3GM8A 4HMDA 4OFYA 2GW5A 5IB3B 4LSPH 2VIRB 5IVXB 1PG7L 4MHHG 1U8NB 4DTGH 3T0EC 1DEEB 3E8UL 2VDPL 1DQDH 1M4KA 5FECA 3EFDL 4P9ML 2XA3A 2C1OB 5B4MC 2FH8A 4CMHC 3SKNA 2E7LC 4X7CC 3U0TB 1IT9H 3OZ9H 2NCMA 4RX4A 3VXMD 3NABL 1QNZH 3P9MB 5ESAA 2JIXD 3C2AH 2NY2D 4PB0H 5D1QC 4EIGB 3OJVC 4RGNC 4G7YL 4TULL 1F3DH 1PX3A 2R2HB 2VKWA 1CGYA 3M8OL 2VERN 1Z9OA 3B9AA 3C8HA 4JY5H 4ORGA 1NL0L 4KJWD 2BHYA 4JKMA 4Q6YA 5MI0B 5GGUA 4LEXL 3DUHA 3ULUE 2AQ1A 1NCBH 2AVGA 4HS8H 2DB8A 3OAYH 3I6KB 2CGRL 4M43L 3DURB 3HAEG 1DANU 1IC5H 1WCQA 4WW2B 3ILPB 3I3EA 1AGEB 5DQ9A 3WEXB 5ACZB 4GRLC 5HGDA 4RWYH 3EHBC 4ZTPL 3ZDZE 4K2UH 5C0BD 3BD4A 5I6XB 1J8HA 4RMUA 1R5IB 1NGPL 5IMMA 1XR8A 1DFBL 3L3IA 4L8DB 1FVDA 1CFNB 3O3UN 1YMMD 5JO5B 3X3GH 4WI8A 5D5ME 3V4VH 4NN5B 4OCRL 3L7FA 1OTUD 1JYWA 4YFEA 1JHLL 3ECBA 5DDHB 1HILA 3HFMH 1NFDB 4ODVH 5EFIA 3RHWF 2XIDA 4M1DH 5TGBA 3O45B 3SCMB 5ILTL 2LVEA 4MCZB 5DMKB 5F93C 3ZKMC 3S4SA 5I71B 1DQQA 4R7DA 1MRFL 1D9KC 2QQNL 2C7UA 4G42B 5EDXA 3AROA 4YQXH 4OJFL 5IBTH 4RMWA 4OTXL 3AUVA 3T2NH 2B0SH 3N50A 5DRWB 1L7TH 3ARUA 2NY7L 4D9RD 4WV1A 4YC2C 1EZVY 1KLFA 1CD9B 4J6RL 5GQBA 3OKKB 1SMAA 1O0VA 2QR0A 3EJJX 3REWA 4JFDB 2NZ9C 3MBED 3ARYA 3QJHA 3PGCB 3HB3C 1Z3GL 1R3KB 3CIQA 1FC1A 2Y7QB 3EYUL 2P8PA 1YY9D 5GJSH 2ADFL 3C60A 4JM4H 3QDMA 4KFZC 3W0WE 1YEEL 3U9UA 4MJIA 2BY0A 3EOAB 4JY4B 2X10A 5HI3D 4V2CB 1ITBB 1NAML 4HKJA 3OSKA 3UTZA 4UTAL 3GHBL 3TJEH 3MRLA 3KPRB 3E6HA 4LSQH 2AEPH 2NY2C 5IBUG 1A6TB 2O5YL 2B2XL 4JZJA 1OCWL 2IBZX 4ZYKB 1I1CA 3FO1B 3ALPA 1J5OH 1GIGH 3PL6A 4KJWC 3BZEA 3NCJH 3VFVB 1FPTH 3EO9H 1P7QD 3MNVA 1CE1H 2FHBA 2ICWJ 3LQMA 5GXBB 2NLJA 4P9HH 2AJSL 3TBTA 3G08B 2ZUXA 2ZCHH 3BAEH 3H3PL 2YD9A 1UQSA 3TFKD 1IC4L 3KPLB 1L9NA 2EDDA 4DFIA 1I8MA 3D3VE 5I1CH 2MCG1 5JLZA 2W65A 5B8CB 4F57H 1INEL 1VENA 2HT4D 4JB9L 4LHQB 2C5DC 3GNMH 1EJ6A 5F89B 3IDYC 4NQCE 3T08A 3MV8A 5ISZA 3H42L 5D7JD 1H3GA 2Y1VA 3EYVB 1AGBA 5MEOA 4Z7UA 1AP2A 4PJDB 5CINH 5D1XA 3RPKA 1V3MA 1NH6A 3ROLB 1OTUC 4WFHE 1CFTA 5E00A 5DHVB 1JYXA 4PJBB 4WWKB 1RUPH 2G5RA 2IH3B 3ESVF 3EYOA 3T09A 2WWMD 1T80A 5F1IB 1NFIB 5GGTL 1HHKA 2OJZH 25C8L 1H8SA 1DVFD 1ACYL 3OKMB 2FRGP 3MOAL 1OQXA 4Z6AT 5I74C 4JCMA 5EU5A 1WIOA 3KPSA 4HWZA 1ZA3A 5E95B 3V6ZB 4JCLA 3IKCB 4LCIH 1HCVA 1ZWIA 3RWJB 4PJEE 1RZ7H 4OSUH 1Q72H 3R06A 3CD4A 4JM2D 4K3DH 1GGBH 3PHSA 5IFJA 4MJ6A 2R56H 4DEPB 1T3FB 5DT1H 3MC0A 3FN3A 5AG9A 3IXAB 2FB4L 4QCIB 4ZS7H 3VFWA 4LSUH 1B4JL 1BFOA 3MBEC 4PGDA 5BQ7A 2BSED 3V52L 4H25A 4Z18A 1KELL 3HC4L 1OT1A 5I8CB 3EOBA 2W0FA 3A6OA 1UACL 4LLWB 3TIDB 3PIQB 1CXKA 5SWZB 5E8OB 4FN0A 1NCNA 4HH8A 2O61A 2ARJA 1X3DA 4PJIF 4QRPA 3DXAA 1IAMA 4RFNB 4O2EB 3CXDL 4D9QD 1A4KA 5HI3C 3RA7L 5JHLH 1AO7E 4G6JL 3MLRL 4IHOB 3L95B 4L9LC 3LKNB 3VXRA 1I7TA 5DQJA 2W91A 1AFVH 1VGEL 5C2BL 4JGUA 1MJJB 3IFOA 2ZOLA 1JPFB 5C0ND 3V4PH 5F7FA 3DO3A 2V5RA 3QB7C 1DQLL 4JFXA 2Y72A 4R4ND 1MIMH 4ZNEA 1FVCB 4JY6B 3K3QA 1MCQA 3P73A 3HUJF 4KTDH 4MNQD 4HUKB 3SDAC 4HK3J 3PP4H 5D7IF 2ZPKH 1C5DA 1QLRB 2WSKA 3N1PC 4NN6B 4U6HB 1M7IA 1BQSA 4FHBD 2KQNA 1GOGA 4KKAC 1WVZA 3FFCD 3D0VA 2AV7B 1U3HD 4AT6A 4DGIL 1NKRA 3TFKC 5I2IA 4FOMA 1EERB 1IEBB 4HPYH 4XPBH 1F97A 2VISA 4PJ9C 1D5BB 3JV0A 2XN9D 2HT4C 3FQTA 1EEZA 2EC9T 1NEZA 5E2VH 3SEPA 1HOCB 5KW9L 4ZTOL 1RY7B 4M61A 1IC7H 5D2NB 5DMIH 3GMLA 5IQ9B 2FGZA 3MROA 3QDJA 4CVXB 1KYOK 1OD9A 4I3SL 2XI9A 5IB2B 1BHGA 4UIKL 2RHEA 4OF6A 3FKUS 1UADC 5CZKA 1U2CA 1JGEB 3PUCA 5J9PB 1HKLH 1T2JA 1EO8L 3CFJB 1AC6A 2IQ9H 4Y1AD 3TNNA 4BFIB 4FTVD 2C3VB 5FDWB 1DVFC 4H26A 3V6OA 5EO1A 4ZXBA 5IB4A 2PETA 3ZTJH 3SGKC 4YHPA 4GW5A 4JANA 2EZ0D 2CDGA 3CFCL 2EO9A 4LKCB 1BZ7B 1XR9A 2R0KL 3SN6N 3ZYZA 5CIPB 4LSVH 3AB0B 3V2AR 1C8PA 1NJ9A 1JWSA 1TNNA 3BO8A 2VLKE 2X4PA 4M1GL 3BUYA 3ZE1F 2Q86A 1AGCA 1A1NA 4NM8L 2CRZA 4L8SB 4PRDA 3BESR 2FL5A 1FO0H 3T0WA 5IG7A 3BMWA 3T0DA 4PTUA 1I9IH 2OK0H 4MSWA 2C4XA 1YQ2A 3QUZD 1CT8A 2ZSWA 1QOKA 3DHJA 4GAGL 4X0KB 3STLB 2EDKA 2W59A 3GSUA 4E9LA 3O8XD 1AE6H 3VDCA 1CLZH 4WO4A 3ET9F 3PHQB 4MAYA 4QRTA 1SY6L 4U1GC 2YWZA 2OBGA 4YDVB 5BOPA 1DL7L 3UAJD 5C0NC 1ZT4B 3BKJL 2BSTA 2PW2A 4PRIE 5D9SA 3KLSA 5I9QB 5KSAD 4XVUD 2ADIA 4LLYA 1VFAB 5JW4M 1IGJB 2FJFA 3O6FA 3OKNB 3S7GA 1OD7A 4WI2A 1A6VL 2GUOA 4PP2A 1QBLH 1C7SA 1IGCH 3QIUB 3C8DA 3QI9D 4P2OC 4X83A 5FYJE 2HVKB 1RULH 2J8UF 3CFDB 4HK0A 1U3HC 4E41E 1TLKA 1FNEA 1BD2E 2CJUL 1XGTB 5CP3A 3VFGH 3QPXL 1WFNA 5T3XE 3S9DB 4Z7WA 4P2YA 5CGTA 3QQ4A 1LO5B 4U1LA 4D8PB 5I0ZA 4GW4B 1BVKB 3FT3B 5DR5H 1S9WB 4X4ME 5I8OL 4X9HA 4JFFD 2E7BA 3ARZA 3DHMA 5D7LE 1OAYH 3IDIB 2ERJB 5C6TL 2EYSB 4BSWA 4IRSA 4YO0B 3WD5H 1C12A 4OLVL 1HWGB 2KDGA 3IRZA 3RP1A 3HRZA 4CNIA 4LCCB 1IKFL 3VA6A 3MV9E 1BFSA 1J0IA 4N5EC 4HS6A 4NRXA 3WXVL 2W60A 4ERSH 1P1ZA 3HE7D 4X6BA 4LFHD 5BMFH 3ALWA 4HBCL 5HVFB 1J0ZA 4S0SD 1JWUB 2UY7A 5EBLA 4ZUVA 5F71A 4WTZG 3MOQA 3D48R 4GOSA 4LVNC 2FLRT 2VXQL 3OKEA 2EZ0C 5E9DD 4L9DA 4UIMB 1G7HA 2EDJA 4JZNA 2AJ3A 3BE1H 4ZFGL 5J89A 5J11C 5K9QG 1T1WA 3CGTA 1VFOA 3Q2CA 3FB8A 1NLBH 3O41B 3F65A 3MRIA 4NCDA 3WL9B 1WWCA 3RJDA 1CR9H 3D0LA 3C9NA 5DYOB 1ZLSH 5D1QA 3L3GA 5HHOE 1S7RB 3AMLA 1IAOA 4K8RL 2DLEA 4FXGB 3TYFB 4MNHB 1AR1C 3WFDH 5J6HA 1ZHLA 4GRWH 2AJUH 3QUZC 1X5IA 5JW3L 1PY4A 5DJAA 1ZOXA 3JSSA 4GUPA 5C8JB 1MHEB 3LQZA 3NVQA 4K23H 5B39B 3KWWA 3S6CA 2OTWB 4HUUB 4Y4FB 2V2WB 5ETUB 1XGPA 3RWHB 1ADQA 5FGSA 4PGEA 1BZ9A 2VITB 4OB5H 1N7ML 4CU8A 3VJ6A 4Q9QL 4HIIB 3O4OB 3GRWA 3HNTL 1T04B 5GHWL 4KI5F 3MRRB 3UZVB 3WHXA 1KLUB 4XVUC 5E1AB 3RZCB 4DKEH 4JPWH 5ITBL 3QYCA 4MQSB 3JWNC 4UT9H 4JFED 1IAII 1FNFA 1NC4D 3TBVA 2CIIA 4HWNA 3HZMA 3DOSA 3HG1B 2BC4A 3QI9C 4LRNL 4XHJC 5D1ZA 1R24B 5HY9A 3BEWA 3QJFA 3H3BC 4PJ7F 4HZAA 4JZOA 4EI6B 3E0GA 1JGUH 4P23C 1MRCL 3O3BA 3OAUH 1G9MC 3C60D 2VSDA 4HKBB 1V3KA 4LPVA 3THMH 5T33L 4KJPD 1MFBH 5F9AC 4MJID 3SY0A 5IW1B 1JI2A 3TBWB 4PJXA 2IBBA 5A16A 3BW9B 3L7EA 4XI5C 4F80A 4Y19E 1UWEH 3I9GL 4G5ZL 1ZANL 1D9KA 1JF5A 4K7PH 3B5HA 2R2BA 2CMRH 3HNSH 1KACB 1F8TH 4FQLH 1KBGL 4OLZH 3FCTA 3WO4C 4MXWH 4PBWD 2BVUA 4ZDHA 4NO5B 3X11A 5GRVK 3PWLB 3CZFB 2HLAB 1A14H 3LPGA 4KQ4L 1GAFL 5CJ8A 3HE7C 5CEXA 4FA8A 3QUXD 3VH8A 2BNRE 1U8JA 2VDRH 4F7EA 3GMMA 1AC0A 2UYLA 3MLYL 1GOFA 4GFTB 4NOFA 3ULUD 4J1UA 3P0YL 3MLWL 1RI8A 4HUNB 4QXTB 3QQ3B 3D2UA 1X4YA 2AJVL 4I0PA 2ZCLL 1BJ8A 2DKUA 1NC2A 4RGMB 2OL3A 1UH3A 3F7QA 2P8LA 1D5IL 1I7RB 3NCYP 2GSIB 5C6WH 5DD0H 5HHNA 1XGUB 3IJHA 4W6WB 5BS0E 2EIZA 5CKGA 3P4MB 4RGOH 1DLFL 2MTPA 4G8GB 1S9VA 5EIQA 3RNKB 1LD9A 3GIVB 4J3VA 1JNNL 1JN6A 4RIRA 3HN3A 4Y0GA 2R2EB 1XGQB 2FO4B 3LSOB 1FV1B 3BD3A 1L6XA 3K4DA 1ROWA 2JELH 1JFQH 1I3GH 3MUGA 1XAUA 4KHXL 1XEDA 2NY3B 4ELME 5E5UB 5A2IH 2YBRA 2CKNA 4QOKA 5MEPB 5GRYA 1QBML 2BRRH 2AV1B 2YZ8A 3Q48A 1Q94A 1K2DB 3AREA 2XZCL 5FOBB 1AXSA 2WWKT 4AG4L 4EVNB 4XX1G 5IIEA 5HHPA 1KEGL 5B38A 3BKYH 1CLYH 5C0EB 3RTQA 4OBRA 3RNQA 2XKUA 3AXLA 3DV4A 1K8DB 4XWOD 3TZVD 4UILL 4YXLH 4PGJA 5FCUH 3LDBC 4OLWL 4O5LH 2OJEA 4IOIA 4LKXA 3MRBA 1UA6L 1T2QH 4LVEA 4NZTL 1IM3A 2E27L 3MUJA 1IVLA 4GW1A 4D2NA 3IJYB 5DUBB 5CS7A 4XMLH 4LLVB 3JVGA 1W72A 2VL5A 3ULVL 5GRUH 5LG1A 2LABA 1YQVL 3O3DA 1KTKE 1QEWA 5EO9A 4PRPA 1MHPL 3W0WD 4BQ8A 5HYSA 1PZUB 5I19L 3BWAA 5DRZA 4FQIH 2IGFL 1GPOL 1JHTA 4X9IA 2N7BA 4DVRH 5ENWB 3L9RB 2YUVA 3NIGE 4XBEL 4IRZH 3X13B 3B5TA 4LHUA 1MRDL 2IF7A 5TQ0H 1CICC 3I3BA 3GSOA 1RUMH 2VAAB 4OQ1A 3HC0A 3KXFB 5B39G 4M03A 3WV0A 2X09A 4NUGL 4YHKL 3QUXC 1YUHA 4KUZH 4ZUUB 4M6ML 1FNGA 1F4XL 1MFAL 1WFOA 2J6EL 2FGWH 1NCWL 1ORQB 2GY7B 3CDCA 2LVCA 2OQJA 3AMKA 1SBSL 4LARL 5TFSL 1LEIA 2YR3A 4OF5A 1NCCH 5HYIA 3FRPG 3P9LA 5KJRH 1RD6A 5HYQB 2FIRT 3MFFA 5EBMA 5IJVA 4MDIA 1HEZB 5FDYA 3D3VD 1SYVA 2KBGA 4DW2H 1YN6A 2AXFB 3SJVB 3DX7B 3QZWB 3MRDA 3ARBA 4PRNA 3ZT5A 2R23A 4ZSOE 3PP3K 1F5WA 2DDQH 5C9JA 4NQCD 2RCSL 1M7DB 2DF3A 1JPGA 5LVEA 1S9YA 5DTFB 5I1IH 2IQAB 4WFHD 1ZT7B 2EYTA 2V17H 4UDTB 35C8L 5E8PB 4RFOL 3SDAA 4KMTL 3PXJA 4KAQL 2XWJA 4KROB 5I17B 2A1WH 5BZDA 3N85H 4Z7VB 2WBJD 1F3RB 5F7YC 4YXKH 4HJJL 3GMRA 3CMOL 1EGJA 3G6JF 4FFZL 4RFNC 3L5WB 2BJMH 4LRIC 4OZGE 5F7EL 2FIKB 4PJ9A 4KMLB 4R97B 3QFDB 4XWOC 3TZVC 1LEGB 3D85D 2F53E 4S1RL 4R3SA 2VZSA 2X9XA 4ZFFB 1N8ZB 4Q2ZA 1TPXB 4HCRL 1HSAA 1JHKL 3UTQA 3HZYB 2YA0A 4PJHA 4TSCH 1UM4H 3T0BA 2JJUA 3M1BB 3UYPA 3G5YA 5TE7H 3CFIC 3FOMB 4HV8A 4J8RA 5IW3A 3E2HC 5KG9A 3V0WH 2BRQA 2E6JA 4QXUH 1UJ3C 3MGTB 5FUOH 3FB6A 1XF1A 5BV7L 2YD5A 3TBSA 4L4VB 4L5FL 3RKPA 4F9PC 3ARDB 1S9KC 4R0LA 4GLRH 4MWFA 5BXFB 4HKXB 1AO7D 3C8KB 4PYGA 4GMTH 5E5MA 3B2VL 3SGKA 4BH7A 3VXQB 3BP7A 2V2XB 2PYEE 3KDMA 3DGGA 3BDXA 3QIWC 1T0NB 4X6DB 5E08L 2Q8AL 4JPIA 3VXSA 1KXVC 1G0YR 4X5WB 1IKNC 4JFOA 1FZOB 3G5XA 1N0XH 5IB5A 4Z7UF 4PJAB 4AM0B 3CSPA 1IGMH 3TNMB 2R1XA 4JO2H 2XRAL 4RDQG 1NSNL 2PNDA 2DWEB 2Y36H 4LHJB 3Q5YA 1M71A 4DGYH 2H1PL 4Z7QF 3U0PB 4EN3B 4BFGA 2NZIA 3MJ9L 4WTWA 3EAKA 4OAWB 2BNUB 1KNOA 2A38A 5DD1H 2VLRE 2QJDA 2WWKO 5FEBA 3WXWL 2LTQC 3CMGA 1X5ZA 2EDRA 3OJDA 1AJ7L 3SE3C 1QKZH 1FJ1A 3R1GH 5HDBF 4DKFL 3T4AB 3DGCR 2MWCA 2HFEB 1MAJA 5F9JB 2VUYA 4PLJD 2R2CA 5KTEH 1DBMH 5T1KB 3CH1A 1KF9B 3MGOB 4MVBD 1MCLA 3QHTC 1A6WH 3R8QA 1V05A 2H6PB 4HIJB 3QG7H 1NGQH 2WBJC 1K4DA 1TTFA 4MGXA 4P2OA 3BEVB 4FQ2L 5E56A 2FJHB 2VZUA 1JYVA 5DJCA 1ADQH 1X7QB 4HWUA 3SO3B 5GGRA 2P24A 5BCAA 1F4WH 1KJ3H 4XHQA 4YUEH 1A7QL 3RDTA 4KDTA 3H9HB 3GRWH 5EUOA 5I1EH 4GG6B 4H8WC 5FGBA 1PVHA 3IU4H 5GGQH 4IJ3B 2WK2A 1YNLL 3SKJH 4LPTA 4FFVD 5I18H 1W8OA 2OM5A 1MEXL 4O9HH 5EC1A 3ARGA 4JLRB 5AZEH 1S7XB 3H0TB 4OFVA 5DJ8B 2VLKD 4QTIH 3NCMA 4NO2A 2G9HB 4K9EC 3U30C 2MKLC 3LRGA 3MCLH 1A0QH 3OXRB 3MMEB 5CGYC 1FAKT 4OQTL 4RBPH 5E6ZA 3QZWG 3VMNA 3BGFB 5C08E 5L2KE 4NKOB 4LK4A 2IAMD 2P5EA 4KV5F 3BP4B 3QNYA 5E6IA 3FMGL 4XVSH 5ICYA 3PQYA 5DJ0B 5KVGH 4DK6A 1RK0A 3KYKL 1LK3L 1I1AB 2DQHH 3GDBA 4JDTL 5KSBE 1N4XH 2Z35A 2VXSH 1A3RL 3OKDB 1HIMH 1YYMH 5LGJA 3RWCB 1GYAA 3UYOD 4LCWB 3VMPA 4PJ8A 2XG4A 1XF3B 1MFCH 3FT4A 5T5NF 4KZDH 3MYJA 1WZ1H 1NAMB 4AEEA 2V7NA 4OI8A 4I2XE 3S37X 2CDEB 3SGEH 2VQUA 2MQCA 1NGWB 5ACMA 3OGOE 4F15B 1BQHA 5JMOC 2NQCA 5FYJD 3QWOA 2APFA 2VAJA 5DO2D 1JNLH 1I8LA 4JREB 1QLFA 4E41D 5ADOH 2K7QA 1BD2D 5IHBA 2HLFC 2OL3H 2Z31C 5T3XD 1BQLH 2CLRA 2UWEA 5IB3A 3QPQD 2VIRA 3RX5A 4X80L 5IVXA 4QT5B 4YZFF 1U8NA 4YWGH 4HUWB 5D7LD 1DEEA 5IHUH 2YPLB 3C5ZB 5F70A 3VWKB 3UTSB 5JQ6H 1VERA 2HAZA 4N0CD 1P53A 5JUEL 2H8PB 1DSFH 2C1OA 1T6VN 4OCXH 3KR3L 3U0TA 5L8KB 4MVBC 4I0KA 3U48A 4G3YH 4EI5B 3P9MA 4OZIE 1EHLH 2J3SA 1Q8MA 4XMKL 3VCLB 5HYJE 1RUAL 1ETZB 2X1WL 1KB5L 1F4HA 3BZDA 3QCVH 3U4BL 2R2HA 1X5LA 5CJOH 3GBMH 2FEDC 4B41A 5CJQH 1P5UA 3BHBB 1BJ1J 5E2JA 4XPHH 3I6KA 1QSZA 4QRQB 3DURA 3VA2C 4WW2A 2YZ1A 3MRCB 4FFVC 3G6AB 3ILPA 1AGEA 3WEXA 2OXGA 1XGRB 4P49A 5ACZA 1YMHB 3O4OC 4Y8DC 2WBKA 4DKAA 4NO0D 1EUUA 4JRXE 3B9DA 1R5IA 2OI9B 5CCKL 4L8DA 3MLSL 4TOYL 5HHOD 5TE6H 1CFNA 5JO5A 2F58H 2GJ6B 4DQOL 3VGAB 1CXFA 1JNHB 1YECL 2IAMC 2QSCL 2A6IB 4QOKD 4JKPH 3QUYD 2VQ1B 4POZD 3WJLC 1P6AB 5DDHA 1NFDA 2HKFL 4JKKA 1L6ZA 3QEHB 1C5BH 3O45A 4NZUL 3SCMA 2F54E 4MCZA 4XMPH 5DMKA 5T1DL 2DIBA 2E9BA 1UWGL 4F37F 1E4WL 4P5TB 3DV6B 4NJAL 4G42A 3LD8B 3V8CA 3RIAK 5DRWA 4YFDB 1U8LB 1FDLH 3QBTB 2OSLB 1GC1L 1I8IB 3S8WA 4FQCH 3OKKA 2PUQT 4JFDA 2ESVB 4OLYL 3DBXB 3PGCA 1MFDH 5FO9B 3F6IA 2Y7QA 1Y6KR 3UDWC 3QPQC 4UT6L 1XF5B 1F90H 1U8MA 3FN9A 4UB0H 4Y19D 3UO1H 5D8JH 4JY4A 3EOAA 3MXVL 4N0CC 3SOBH 1IL1B 5HDQL 4L1HA 1CZ8L 5ALCH 3KPRA 1TCMA 2VXVL 4MJ2A 4R2GD 1JRHH 4UV7L 1A6TA 4AY0A 5DUPL 3KHOA 1P84J 1RZKC 2HKHH 5IESH 5IJKC 5D72H 1CD1B 2VL4A 1RHFA 2AKRB 2NR6D 4N0YH 1LP9F 2V9QA 3NA9L 3BRGC 3FO1A 1EGJH 2BNRD 1FH5L 4DOHB 5AZ2H 1MFEH 3NH7H 4WUKL 3T4YA 3VFVA 1OF2B 1HWHB 2AK4B 2BSRB 1RUQH 4EOWH 2EIEA 1C1EH 2PO6B 4GS7C 5IMLB 1INQB 4IS6B 3QDAA 3V5HB 4TSBL 3G08A 2EDBA 1KC5L 3MQIA 4Z0BL 3KPLA 4UV4H 4L3EB 4OF8A 3DX8B 3D1MC 4G6KL 4NKQB 3E3QE 5F7WC 4MXQD 5B8CA 5HYFA 3VGBA 4HC1L 4JQXC 3P3YA 3VW3H 2J88H 4XPAH 1EEQA 4JKWA 5F89A 1CICA 3ZDXE 3EO0B 4FQ1H 4JR9L 3CU1A 1KCSL 1N0LA 3EYVA 3FONB 2HP4A 1AHWB 4PJDA 5GGVY 3ROLA 1C7TA 3MA9H 5C7XL 3N06B 2GITB 3QUYC 4POZC 2ZJSH 3UJTH 1PEWA 2GIYA 5DHVA 2VLLB 4PJBA 4OF3A 4WWKA 3GMPB 1XZ0B 1Y0LB 2AGJH 4OLXH 1J9CT 3U7YH 2ICEB 2YKLH 5F1IA 1G7MA 1SM3L 1NFIA 5JW4N 1YEGH 2VXTH 1EVTC 3OKMA 4PJXF 5ACLA 1G0XA 3B3IB 3V6ZA 1QYGH 3U36B 3IKCA 3MLTB 1XF4B 4HXBL 4PJIB 1O7SA 3RWJA 3TC9A 5T3ZH 4Y4KB 3RGHA 3KJ4B 2HG5B 4NQEE 3V5KA 5C07E 4NJ9L 5JDSB 3WIHL 1T3FA 1SVCP 5DD5L 4PRHE 3MOBL 3IXAA 4YFLI 4QCIA 3QDGE 5IOPA 1Q9WB 3D5OF 3ILQD 5KVFH 4TYUA 4MS8D 5I8CA 7FABH 4UNTA 3TIDA 3PIQA 4K7PY 4WI9A 4XP5L 1CK0L 5SWZA 3DVIA 4WY7H 5E8OA 5J12B 1HDMB 3E6FB 2KQMA 4YXHH 1VEOA 4NHUB 1KCUH 3HUJB 1ZGLM 4XNZC 4O2EA 5D7IB 4OCSL 4NC0B 4OM0L 3WNPA 3NA4A 1CL7I 1MIEH 4IHOA 3L95A 3OTTA 5SWQB 1G7QB 3LKNA 5IP4A 2B1HH 3BT2L 3CFKB 1JTTA 1MCWW 1NANH 1MJJA 3MLUL 3RGVB 1EBPA 4TTGA 3PABA 2NR6C 3N1GC 1FVCA 4JY6A 1QSFE 1WEJH 5GS0H 3P30L 2FECL 1QLRA 1R5VB 1CBVL 4U6HA 4GXVL 3H2WA 1KCRL 1A3LL 2EECA 2AV7A 1N6VA 2OLDA 2UZIH 5ESQB 1IEBA 3OB0H 1OAZH 1E27B 3K46A 1D5BA 2F8OA 2Q20A 4RAUB 5D71H 4QRRB 4PR5B 3QHFH 3SDCB 5LBSL 1HOCA 1OAKH 4LSDA 2W9EH 5K9KB 1P7HL 5DEZA 4KGJA 4XNXL 3SDXF 5D2NA 2Z4QB 5EOQH 4YDJB 2GCYA 1JZ7A 4CVXA 3DSNA 4XX1E 1I3RB 1DBAL 1PG7X 5JIHA 3PWJB 3TWCL 5IB2A 3NCFB 1EAPB 4ODSH 4X6CE 2B4CL 5ICZB 1ZLUK 5JHDB 1JGEA 3RAJH 5J9PA 2D7OA 1XCTA 2DJ4A 4J7RA 4G43B 1JCKA 4QRUB 4W68A 2P1YA 5JW4Q 3B83A 3CFJA 4ONFL 2P5WD 5FDWA 5MENE 2FWOA 2WMPA 4P2QB 1RSFA 3U82B 3JWDC 2FCBA 4JFHE 1BIHA 1P69B 4NBXB 1M6OB 1J11A 3ULVE 4OZFG 2YD8A 4S1DC 1FBIH 4XCCL 3X3FH 4ETQB 1FP5A 4LKCA 4MAUL 3PWNB 4DGVL 1BZ7A 5CIPA 2X4OB 3EDFA 1X4XA 2D7TH 3MRNB 4QY8B 4Z7OF 2VR9A 1OP3K 5FB8B 1I1FB 4L8SA 3IDJB 4LAQL 4PGBB 5E6ID 3WUWB 1A22B 5TQ2L 2YRPA 4M6NL 1A64A 4LASH 5IWLC 1UENA 4YE4L 2XY1A 4X0KA 3STLA 2BFVH 9CGTA 3N1MC 3K8LA 3S35L 3PHQA 5FV2A 3P4LA 4PJ8D 3P0GB 3EIFA 2PYED 3MFGB 1NBVH 1G0DA 4YDVA 5JIKA 1GH7A 3QRFM 1S5IH 1ZT4A 1E6OL 4UTBH 1H5BB 4Y2DB 3MJ7B 2CXGA 5F9WB 1IGJA 8FABB 3OKNA 4M62H 4AL8L 4HUXB 4IBLT 1AXTH 5CGMA 2X6MA 2BP3A 5CHNB 1KCLA 1VADA 1JPSH 4P99A 1I9JL 2ZUSA 3N1FC 4HH9B 2ZUVA 2HVKA 3Q6FB 4NZRH 1ZVSB 1YEFL 3CFDA 4NHCL 1XGTA 3LIZL 1A5FH 15C8L 2VLRD 4YPJA 4APQD 3SGEI 1LO5A 4M7LH 4D8PA 1BVKA 1MAMH 2XQYG 3TEUA 3FT3A 1S9WA 1GVIA 2A73B 2IFFH 4LSPL 3IDIA 4ODTL 4P2RB 4DTGL 4N8CH 4MCYB 3OJMB 1PDKA 2XV6B 5GZNC 2YEZA 5DC4B 1DQDL 1T1YB 4YO0A 5TF1H 4HS3B 4LCCA 3OZ9L 4AMKH 2OX5A 4NKDB 1QNZL 2PR4H 3U83A 5DJ6B 2CK2A 4PB0L 1WSST 2CLZB 4NGHH 4WFGE 1X5AA 5C70A 3REVB 1JWUA 4F3FB 1ND0B 4L4TB 3H7BB 4JY5L 3EYSH 1ZVYA 1CFQB 1ZHBB 1I4FB 2R9HD 5C09E 4UIMA 1T6WA 2V5YA 2J4WL 1NUGA 4HS8L 3P40A 1IC5L 3OXSB 3QG6B 1J1PH 5JXEA 5ANMB 4ZFOB 3O41A 1OGAE 1SEBB 3MJGX 3WL9A 3MLXH 4A6YB 1AKJB 1JJUA 1WWBX 3MNWB 4K2UL 1KIRB 5DYOA 4DK3A 1S7RA 4HPOH 3UPRB 2EDWA 3O4LB 2IPKB 1GL4B 3MV7E 4FXGA 3TYFA 4RNRB 4MNHA 5EIIB 1VGKB 5DGQA 3X3GL 2F5AL 4KJQD 3W9DB 2AJYL 1R3JB 3V4VL 1U6AH 3NMEA 1QTYT 2HJLB 2EDTA 2DLIA 5C8JA 2ICWI 2FX9L 3SCMD 4LIQE 4EDWH 2NY5H 2YPVH 4NQDE 5B39A 4P46C 2OTWA 4HUUA 4Y4FA 3S36H 4ODVL 2V2WA 3F58H 3RWHA 1VPOH 4PJ7B 4M1DL 3FHAA 3PWPE 1OARH 32C2B 1NEUA 2A77H 2VITA 3BP5B 5IB1B 5K9JH 3CLFH 4HIIA 3U9PH 1T04A 3MSPA 1MCSA 1OSPH 3MRRA 5BRZB 3KNBB 1KLUA 2GK0B 3ZSTA 3RZCA 1MCCA 4CVUA 2DYPD 3ELAT 2G2RB 3FRPA 4YQXL 5IBTL 3EDJA 3T2NL 4CRPA 2B0SL 2YPKB 3HG1A 4JFDD 1L7TL 4X7DC 3BX7C 2VE6B 4MNGB 1R24A 2H2SD 2X1XR 3GMOB 3P4OB 4EI6A 1MF2H 1A02N 4JGJA 4E0RB 1U8KB 4HKBA 2EXYC 4I18C 1CFVH 5DLMH 4APQC 5IW1A 3TBWA 4U4BA 4UBDC 3BW9A 1JF1B 3W5MA 1DQMH 4R8WH 1S78D 4JM4L 1OLLA 5D7KE 3FQWB 4G80A 4O02H 4FG6C 4OF7A 4E5XB 1LO4L 4WJ5B 4TRPL 4JE4B 4OM1L 5DF0A 3TJEL 5CFHA 4D0DB 1SBBA 1KUMA 3ZYOA 3VRLE 4L3AA 4MLIA 3HR5B 4LSQL 4NO5A 5T1LB 5DHVH 5HYJD 3PWLA 4TVPH 3CZFA 2HLAA 4MZ2A 1U92B 3U46B 5KS9F 4GAFB 1N5YH 1T20B 4G9FE 1J5OL 1GIGL 3FRUB 4R90H 2NW3B 1HN1A 3NCJL 2Q7NA 1FPTL 3EO9L 4QXTA 4BUHA 3QQ3A 3X14B 4KK6D 2R9HC 2VDMH 1CE1L 4MDJB 1T22B 3DUUB 3ZKSD 4QXGH 3MV11 4P9HL 5TDNB 3VI4E 4ONHB 5HHXH 1I7RA 2ZCHL 3BAEL 2GSIA 4LP4A 4S2SB 4OD2B 1XGUA 2WLZA 5I1CL 3P4MA 4EXPX 4JRXD 1FO0B 4G8GA 4F57L 3TCXA 3QAZC 2V5SA 1FL5B 3RNKA 2Q76B 2R1YA 3LZFL 5KBNC 3GIVA 1WBXB 2QSQA 4F33B 3GNML 2ENSA 4V1DB 1UCBH 4TVSa 1BOGB 2R2EA 1XGQA 2FO4A 5INCB 3LSOA 1FV1A 4C56E 5IT2H 3ZHDA 4M6AA 1VA9A 3DPBA 3IDMA 2ZSVA 4IIQB 5CINL 1T66D 1S9XB 4XP4H 2A0LC 1KPUB 3VXPA 5CP7B 3C6SB 5MEPA 3LKOB 4MHHI 2APBA 2AV1A 1K2DA 4JHWH 5FOBA 4CGTA 4X4XB 4EVNA 2YXFA 1P84K 1XIWB 3UTTE 1K6QH 5C0EA 4ORGB 4FZEH 1SEQH 4ZNCD 4JQXA 5IM7B 1K8DA 5DA4A 3SQOH 4LCIL 3TO4B 3R0MA 4OSUL 1HHIB 2QSTA 3NZ8B 2Q6WB 1Q72L 2D3VA 4U6VH 4K3DL 1GGBL 5DSCB 2H2SC 4DVBB 3IJYA 5DUBA 3VGFA 4ZS7L 1JTOA 4LLVA 4LSUL 4GAJH 1MCIA 4ZOCA 5A3ID 4N0UE 1FVDB 3MUZ1 3ZTNH 4FQPA 3IDGB 1ZK9A 4GSDL 1S78C 4H20H 5F8QC 5HVGB 4M7KH 1XGYH 2B8OT 3I84A 3CX5J 2ZUUA 4M8VA 5ENWA 5JHLL 3L9RA 2Y07H 3GK8L 3BI9X 5IHZB 5EFIB 3X13A 3DUSB 2MPAH 5EU3B 4I3GA 1BMGA 5DD3L 3LCYA 1CG9B 1AFVL 5C0AB 2A9NH 2LAAA 4YJZL 2VAAA 4WUUB 3KXFA 1AHWC 4GBXB 1FVEB 1DQQB 1ZLUH 3V4PL 5HYEA 2IBZY 2NXYD 4PB9H 4Q7DA 4ZUUA 3CAFA 1NMAH 1SJVA 5ECJE 2LQRA 1ORQA 3OF6D 4KTDL 3PP4L 2IEPA 2ZPKL 3DMMB 4KKCD 2EE9A 4KK6C 1CD8A 1CE6B 3CH8A 3SGJC 5K59E 2C4FU 2VZTA 1YEHH 4NP4H 5HYQA 5DMJB 2QR0B 2X40A 2R8SH 4PLKC 1WAAE 1F13A 3D87B 5D96B 2P48B 3UTPD 2AXFA 5EZOL 3SJVA 1N3NB 2GI7A 3DX7A 3G6JB 3QZWA 1P9MC 4HPYL 4XPBL 3NCYS 5CWSB 3HMXL 2P8PB 3O0RL 3G5VB 1I1RA 5SX4I 1EO7A 3CVHL 5E2VL 1M7DA 1OW0C 3V95A 4O2CB 1IC7L 3RY6A 5IBLD 1PW3A 1NMBH 3MZGB 4HT1H 2IQAA 5DTFA 5F7DB 4PJFB 4UDTA 1TQCC 5C86A 1EXUB 5I17A 4UAOB 2F8XC 5TDOB 4Z7VA 4OBSA 3DWTA 4ZAKB 4Y16D 1X6NA 3L5WA 4P3CL 1FNSL 2IQ9L 2FIKA 3CLEH 1TZGL 5BS0A 5HHME 5LXGH 3LKRB 3QFDA 1T89A 4Z76B 4KZEH 1Q0XH 3ZTJG 1LEGA 4NQED 5E99H 2FX8H 1RJLB 4K9EH 5C07D 4ZFFA 1N8ZA 4ZPVA 3FQRB 2PW1B 3LEXB 3QDGD 1IFHH 3HZYA 4NC2B 2EDEA 4P3WA 3M1BA 5E7FA 4LSVL 1YPZB 2DQJH 1J86A 2XTJE 3FOMA 5A3IC 4FS0A 1CLCA 3MGTA 5F9OH 5HSFA 5ISZB 4L4VA 3S5LG 4RRPA 3ARDA 5EORL 1RU9L 1I9IL 5BXFA 4HKXA 3C8KA 2OK0L 1CFTB 5CILH 3D25A 2XKNB 3BPCB 4ZUWB 3B6SB 1AE6L 3VXQA 3KLAB 1FNLA 2V2XA 1CLZL 1CGVA 3L6FB 4PV9B 2H45A 3FHQA 5HDLA 1H8OA 1T0NA 4WNQB 4X6DA 3SGDI 4JPKH 5I1GH 4PJ5B 3ARFB 5KAQF 4X5WA 3VXUE 4DAGH 1FZOA 2NXYC 3QIUD 1FFPB 1JMXA 4HWZB 1I3UA 4PJDF 1D6EB 1UVQB 4BZYA 1INDH 4FFYH 1R0AH 3TNMA 3OKLB 4KKCC 1QBLL 1IGCL 4QGTA 4F7MB 4K8RC 2DWEA 3VXTB 5IFJB 2CLVB 4PJBF 3RVXC 4HW6A 4EN3A 3U0PA 1QR4A 1CFSA 2HYMA 1D6VL 1RULL 5FUCE 2BNUA 3BDBA 1REIA 3E3QC 4W6XB 3AM8C 4GXUN 4PP1C 4JO1L 1OAUH 3VFGL 5GJTH 2ADJB 3FJTA 3O3EB 4JG1H 2EICA 3WJJC 5DR5L 5F9JA 2GSGB 4AEHH 3DXAB 5DK2B 1H3VA 3G5ZB 1OAYL 2DD8L 5T1KA 3MGOA 3I50H 3LMJH 5FHAH 1H0DB 1YNKH 3LKPB 4U0RC 2H6PA 4HIJA 1KXQE 3J7HA 3BEVA 1I85A 5DA0B 4BQBA 5MEND 3K8KA 1X7QA 4ERSL 2QHRH 2BY3A 5BMFL 1A6UH 1MY7A 4CW1B 1DZBA 3H9HA 4GG6A 3ULVD 3CSGA 4XNUL 2EEDA 5SWSE 5JTWA 4EUPB 3EJZD 1N64L 3UROR 2ZUWA 1BBJB 1LNUB 1EX0A 4MA8H 1TZIB 4U7MA 1RHHB 4JLRA 4PY8I 1S7XA 3H0TA 2DQEH 5FV1L 1QFHA 5DJ8A 2VISB 1NLBL 1FYTE 1UXWB 3H9YA 2G9HA 4U3HA 5TJWK 1JUFB 1CR9L 2IMNA 3MMEA 3RVTD 4J3TA 1ZLSL 4YBQD 1RZIB 4P4KD 4KGLA 1ITCA 4NKOA 3W5NA 3MROB 3BP4A 4R9HA 3P4NB 1IMHC 5DJ0A 1GOHA 4JRYE 1I1AA 5HPMB 1J87A 3AS1A 3OKDA 1EFXB 3O9WD 5GGRY 3RWCA 3GJFK 3UZQA 4LCWA 1K5NB 1RUKL 1XF3A 2HN7B 2R69H 5DUMH 3BZ4B 4H26B 3UX9B 4Y5XC 1NAMA 5DJZB 3RU8H 2IC2A 3HG1D 2CDEA 3O81A 4DKEL 4JPWL 5BW7A 1URLA 4UT9L 4JANB 4YHIB 1FORL 5JOPE 2PN5A 1YEIL 3C6LD 4WTXA 1XR9B 5CJ5A 2G60H 2OR9H 3TJHD 2BNQE 1X9QA 2FH6A 4HIEB 2O5ZH 2ZZUT 3ULUL 5GSRB 1S7WB 1MCWM 3THML 1MFBL 4QT5A 4HUWA 4HFUH 3L5XH 6FABH 3C5ZA 5IG7B 3VWKA 8CGTA 1VSCA 4M8QB 1MOEA 4LQ1A 3JWOH 1UWEL 2H8PA 3RL1B 1QSEB 2WUBH 3L3HB 4XAWH 1MVUB 5IROA 5BJTA 3C08H 1FRGH 4I77H 4LQFH 3GSUB 3LHPH 1MHHB 1QD0A 2CDFB 2UZYB 1DLHA 4X5LA 3HNSL 1F8TL 4FQLL 3VCLA 4MXWL 4QHKI 3SHSA 1IEAB 1ETZA 4WFGD 5DRNB 1KN2L 5I8KH 1A14L 1L0YA 1CXLA 2ADIB 3MBXH 2VDRL 3BHBA 3NFPB 5AUMA 1PGRB 2VXUH 3WLWD 3ZT6A 3ULVC 3WIIH 4QRQA 3BQUD 1NBZA 3AY4A 4J4PC 3UPAA 1FSKC 3EJZC 1LO3H 3MRCA 4TUOB 4WHDA 3SDDB 3G6AA 1XGRA 2Q7YB 1YMHA 4PJEF 1CTOA 1MI5E 3FTGB 1I7ZB 4IOFD 3ARVA 3LKQB 1OGAD 3MYZA 4WI6A 3RPIB 1LE5B 2OXHA 4YHLH 3LEYH 4KVNH 5DD0L 3QQ4B 3ARWA 4RGOL 5M94B 2BVPB 3RVTC 4O58H 3U0WH 3NCCB 4YBQC 3MV7D 4P4KC 1K9TA 1NGZB 2GJ6A 4U33A 1JNHA 2A6IA 3TA3B 3K81A 1QHOA 3EYQD 4LVHB 5CD5C 2GFBB 1I3GL 4XC1H 2K9UA 1RVFH 3VXME 4EQ3A 4NQDD 3O3AB 1U9KA 3QRGH 3QEHA 4KRPB 1MQKH 1TJIL 3O9WC 1H3TA 2JCCE 4K71B 3BMVA 2NY6B 4M00A 5DS8B 4P5TA 3DV6A 2YC1B 1IAIM 3BKYL 3PDDA 1CLYL 2FZ3B 4K3HA 1U8LA 3H9SB 2HTLD 1T83A 2OSLA 4U31A 5IEKB 2ATPB 1I8IA 5FCUL 3T0EB 4O5LL 5E2UH 3MRHB 1KEMH 3C6LC 1A6PA 2X89D 5L2KA 4DUWA 2H41A 3VG9C 2ESVA 3DBXA 1UEMA 1T2QL 3G9VA 3BKCH 3TPUB 3TJHC 4CMHB 5FO9A 1V7NH 3GSXB 1A7NH 1RQ5A 5C0BE 3UMTA 3KVQA 4XMLL 4YPGB 3QNXA 1V7MH 1R3IH 1CWVA 4XPGL 1LP9B 1XF5A 2Q3AA 2YD7A 4RGNB 1AY1H 4QHUB 5K9QI 5D7KD 1X5YA 5I8EB 3KYMB 1NEZG 1IL1A 5T5NG 3QP3A 1HHJB 5DURD 1JL8A 4DVRL 5KSVB 3KWWB 2Y06H 1G7JB 2XWBB 3KXFD 3VGEA 1DBBH 4BQ6A 4URTB 3IB4A 1CD1A 5TQ0L 1BZ9B 2AKRA 3V6BR 1RUML 4GRLB 1KN4H 2BY2A 2YA1A 1Q9KA 3GMNB 3Q6GH 1HXMB 1NFKA 4KUZL 1OF2A 4YDIH 1G7PB 3GKWH 4EDXB 2AK4A 2BSRA 2IANB 2FGWL 3WLWC 2PO6A 3BPLC 3AC0A 5IMLA 3BQUC 4I4WB 4UMGA 2VDKH 4YBLC 1INQA 4IS6A 3V5HA 1DUYB 4OZHE 4LU5H 1WF5A 5BV7C 1NCCL 3TO2B 4L3EA 5HY9B 3DX8A 1IBGH 3QJFB 4XP6H 1U91B 3AS2A 5KJRL 1KTLA 3U4EB 1PY9A 4IOFC 3FO9B 2RFXB 4DW2L 2EDNA 3A67H 4LCYB 3MRPB 2IADB 4MA3B 3EO0A 1R5WA 2DDQL 3N0PB 3FONA 1AHWA 2B1AH 4C56D 1KJ2L 4KROD 1P4BH 4GMSH 2GITA 3EYQC 4XCFH 1HYSC 5I1IL 2VLLA 2V17L 1PQZA 3D39B 2IJ0C 3GMPA 1XZ0A 1Y0LA 3ZE1E 5I75C 4CN1A 3FCTB 4XP9H 4X99B 3JWDH 1QFWI 1E0OB 3N85L 4XC3H 2AW2A 2ICEA 4LF3B 4YC2B 3T77B 4YXKL 1MJUH 4C55A 5FO8B 4Y4HB 1LO0H 2RQ8A 3DECA 3UTTD 3B3IA 2BJML 2Z8VC 3EO1B 1T5XB 3C2SA 3U36A 3FQUB 3MLTA 1F2XK 1DQJB 1XF4A 1UH4A 4PJIA 2NY4C 4HJ0D 5F21B 3EFDH 4Y4KA 4I9WE 4J1UB 2HTLC 4MQXC 2HG5A 4LGRB 3D2UB 4JHAH 2ZOKB 1PSKL 2F5BH 4XAKD 5JDSA 3K1KC 3VFMB 4QXWA 2DQCH 2XQYK 1FHGA 3TLRA 1Q9WA 2DLGA 2Q8BL 5EC2B 1RURL 2XWTA 1VKXB 4TSCL 1UM4L 3MCKB 4FQJL 4PG2C 1GJIA 3ARDD 2NY2B 1JVKA 3E6FA 1NL0H 3V0WL 2VMFA 4NHUA 1G6VK 1Q0YH 3HUJA 4LEXH 3K4AA 5FUOL 5D7IA 3WKNA 4IOSD 5LQBH 4N90E 3OBAA 2J8UE 2E7CA 4M43H 1FGVH 4OT1L 1B6DA 1QFOA 4NKIH 4Y89A 5KANG 5F1OB 4Q0XH 5SWQA 1G7QA 4MB5A 3TVMD 2FD6H 3CFKA 5J7CC 3WS6C 1MPAH 1PZ5B 3RGVA 3NACH 2CR6A 1GGCL 4U1IA 3WHE1 3GSVB 4IMKC 4S11A 4U05A 4IDJH 3W81A 3OAYK 2BCKB 3SDXB 3EKCA 5F3HB 4XXCC 1QLEH 1R5VA 2NX5E 1N0XL 1I1YB 3IDYB 3QR2A 1IGML 3RVVD 1YMMB 2R29H 3QULA 3ZL4L 4JO2L 3IDNB 4BQ9A 2P49B 3DROA 2FEEL 3QQ9D 1P4LB 4DGYL 4U6XB 5ESQA 2DAVA 1E27A 5ILTH 4RAUA 5DD1L 1MLCB 4QRRA 4PR5A 3SDCA 2M1KA 3C5JB 5K9KA 2X7LB 1QKZL 4PRPB 1PJ9A 3R1GL 2Z4QA 5F6IC 4NQTA 5KTEL 4WDIB 1I3RA 3LQAH 2EO1A 4LMQI 1DBML 5I74B 1QQDB 3PWJA 1FZKA 3WDIA 2YD3A 2D7PA 1A6ZB 1BAFH 4KUCD 1EAPA 1A6WL 2E5EA 4U6YB 1PKQE 5EN2B 5ICZA 3IAQA 5JHDA 3DARA 1UM6H 3QG7L 1NGQL 4QRUA 2QQKH 3NTCL 2P4AB 4P2QA 5GZOD 3MBEB 1KOAA 3AM8A 2MSPA 1ADQL 1F4WL 1KJ3L 4ODUB 4YUEL 5IR1B 1NAMH 2DMCA 3GRWL 1UJTA 3WJJA 4Z5RB 1GGIH 1I8KB 4ETQA 4K94L 1Y6MR 3IU4L 2DMBA 3PWNA 5GGQL 4FQHB 3WSQH 1FIGH 2KUTA 4DN3H 2X4OA 5I18L 3SBWC 4KPHH 1IJ9A 4O9HL 4MA1C 3MRNA 1OCWH 3ES6A 1IM9D 4QY8A 5AZEL 4L9LB 2XN9E 5FB8A 1I1FA 1WISA 4QTIL 3IDJA 2HVJA 1XCQB 4PGBA 1NDMB 3MCLL 3WUWA 1CXHA 1TZHB 5MHSD 1UB5B 2JJSC 4UNUA 3OV6A 1L9MA 4KY1H 3QFJB 4BSJA 2AJSH 1Y18B 4EIZC 3WNKA 5IGXL 4XVSL 5FYLH 3TVMC 3H3PH 1P7QB 3P11H 3T3PE 5KVGL 4PJCE 4NWTH 2DQHL 2K7PA 1N4XL 1RJZB 1IGTB 3JXAA 2VXSL 5H35B 1INEH 1HIML 3IU3B 2F74B 5DD6B 3VXUD 1H5BA 4Y2DA 2VLJE 3MJ7A 1MFCL 1IAKB 4JQVA 4KZDL 8FABA 1WZ1L 4Z9KB 1NDGB 4HUXA 5ALBH 3KS0J 1K3ZA 3VH8G 2X4UB 5CHNA 4HH9A 5B3JE 5EU6E 4YNYB 5C0CB 3Q6FA 1E6JH 1ZVSA 2ICES 1G7LA 2AXGB 5HBBA 4Y5VC 4Z7VF 3QQ9C 3A6CH 2ARWA 2YK1H 3SKOB 3HLAB 5ADOL 5J57B 5GGTH 4FMFA 3G5YB 1OWRM 3B8SA 2OL3L 2YPLD 3C5ZD 3UTSD 4PJGE 5F6HI 2A73A 4RA0C 5C0DB 1JZ6A 3TBSB 1KYOJ 4P2RA 3RWIB 1QRNE 4YWGL 3UYRH 2ITDB 4MCYA 4EI5D 5IHUL 1DVFB 1MSPA 5JQ6L 3V7AG 1T1YA 1WK0A 1DSFL 2JJTC 2X4SB 4OCXL 2VLMD 4HS3A 1BBDH 4G3YL 1B4JH 2GTWB 4NKDA 2CIKB 3V52H 5DJ6A 2QADD 3NCBB 4JM2B 1R3LB 2CLZA 1EHLL 2Q3ZA 4YGVB 1GC1C 3WS3B 3L5HA 4FXLA 3QCVL 3REVA 3WYRA 1QFUH 4OGYH 4F3FA 1E4KC 5GZOC 4E42B 5DJXB 1ND0A 4L4TA 3H7BA 2NXZD 1X5FA 3U7AA 1CFQA 1PG7W 4EZMA 1ZHBA 5CJQL 1I4FA 5SWSD 5B38G 1JZ4A 4XPHL 3CJJA 2R4SH 2E3VA 4AYFA 4HUMB 1OP5H 4HBQA 2YD2A 5ANMA 4ZFOA 5D6DC 4H1LH 2PXYD 4X6DF 2CUHA 4DZ8B 5DZNA 4A6YA 1AKJA 3MNWA 1DQLH 3U6RB 1KIRA 2XTJC 3UPRA 4U1GB 4MJ5B 3O4LA 2IPKA 1IRAY 4M7JH 4JFFE 4RNRA 5TE6L 5EIIA 1G6RB 1VGKA 1KG0B 1W72L 3DRQA 4OUUB 3W9DA 1YEJL 1R3JA 2HJLA 4HUVB 5B22A 4OIIH 4MNQB 5FGCE 4JKPL 4JRYD 1FE8L 1NCAH 1K85A 2GJZB 4PJ7A 3O6KH 4P2OB 4P5TD 1U95B 32C2A 3BP5A 4GQ9H 5IB1A 3NIGF 3FFCB 1IILE 3F5WB 4XMPL 1U3HB 4YHMH 4LHUG 5IQ7H 5BRZA 2D7NA 3KNBA 2GK0A 5GGRB 1QA9B 4RMRA 2PYFB 3K74B 2G2RA 4HGWB 3W11D 4EKXA 2YPKA 4M02A 1HHGB 5E9DE 2ESVD 1X44A 1KTRL 5MEQB 5JOPD 1QR1B 3QIBC 4UIKH 2VE6A 3BWUC 4MNGA 1IC1A 3UBXB 2DL2A 1J8HE 4FQCL 3GMOA 3P4OA 4UI2A 2N1KA 5GRXG 1U8KA 2MQ0A 2HH0L 1MFDL 2X4NB 2J6EA 1PD6A 1WWWX 5KS9B 4YHNA 1JF1A 4PD4J 2C1PB 2HTKD 2WINB 1F90L 3HPJB 4UB0L 3QCTL 4Y1AB 5D8JL 2FDBP 5D4QA 5KZCD 4L8CB 1BREA 4E5XA 4WJ5A 3NCEB 3SOBL 2NY0D 2DQFB 1N59B 2MHAB 3DVGA 1Q38A 4D0DA 4LVNB 1A6AB 4Q6IC 2A83B 3HR5A 5T1LA 4N68A 1JRHL 2GEEA 2CPCA 5IESL 2HKHL 1U92A 3MUHL 4NM8H 5DEGB 1CQYA 1T21B 3U46A 4G6MH 5D72L 5J11B 4NQVB 1T20A 3OL2A 2AK4D 5FO7B 1EGJL 1BP3B 2V7NB 4NQSB 2NXZC 3RUGB 4XP1L 4F58H 4UOW0 5AZ2L 1HSBB 2NW3A 3NH7L 5CEZH 4OZGF 3X14A 5FK9B 4L3ED 3T1WA 1RUQL 4EOWL 4MDJA 2EKSB 3DUUA 1B88A 2I26N 3VFNB 1TFHA 5TDNA 4ONHA 3ME0A 3QUZB 1MI5D 4OCLC 4S2SA 1ZMYA 4GRWE 4OD2A 4UV4L 2PXYC 1DL7H 3BIAX 3O8XB 4PG9A 2E7MA 3QDME 1T1ZB 4MJIE 2EDOA 1VESA 1FL5A 2Q76A 4XRCB 1WBXA 3VW3L 2J88L 4F33A 2E8ZA 4V1DA 2BOCB 1BOGA 4ELKB 5INCA 4FQ1L 4XCNB 1KJVB 1ZEAL 5D2LB 4IIQA 4BSVB 5KSAB 2X5PA 3WFEH 1S9XA 2AQ3A 1KPUA 1DTUA 2NY1D 3VDAA 4XBGB 3C6SA 5CP7A 5AD0B 2ZJSL 3UJTL 1DANT 5E8DH 3LKOA 4N5UA 3HR6A 3QI9B 3QPXH 4OLXL 4X4XA 5I0DA 3U7YL 4D0BB 1WIPA 5FYKU 4BK5A 1ED3B 2YKLL 4CMMA 4ZO8A 4Q9RH 2W9DH 3MODH 1XIWA 2HJFB 4P23B 4Y4KD 3GI8H 1XF2B 2EDLA 4BFEA 1FG9C 3QUMB 3TESA 2VDNH 5IM7A 1SHMA 1LGVA 1J0YA 4X7SH 3W11C 4K3GA 3VI3F 1GGYA 1WLHA 3TO4A 5T3ZL 4KQ3H 4OLVH 3CXHJ 1BWWA 1HHIA 3NZ8A 4ZO7A 2Q6WA 5DSCA 3DSFH 5AYUH 5DEFA 3V4UL 4DVBA 1ACZA 5E4EC 5KVFL 3C09C 4QEGA 3MV8E 5HDOA 3IFLH 3WO4B 1GHFH 1S7UB 4UZGA 4Z7UE 3TYGH 2B4CC 1L4IA 2QEJA 3IDGA 3RIFF 2X9YA 5JDJA 4WY7L 1RJCA 4YXHL 3HE7B 1KCUL 4MA7H 4J3SA 5E2WH 4Z7QE 3MJ9A 3KPNB 2PTVA 4ZFGH 5IHZA 1MIEL 2DBJA 3DUSA 1DN0A 3DLQR 4X9FA 5EU3A 2B1HL 1ZA6B 1CG9A 5C0AA 3KPSE 3S35X 4WUUA 3PV6B 4GBXA 1FVEA 3PGDA 4TTDD 5C0IB 1NMCC 5BO1H 1C16B 5I1JH 1BEYL 1I3VA 1WEJL 5GS0L 4MLSA 1BIIB 4FQXD 1JF6A 4U2ZA 3DMMA 4TUJB 4IRJD 1CE6A 1IQWH 3VXOB 4Q9CA 3V0AC 4Y4HC 4GKZA 2GAZB 2UZIL 1N3NA 3G6JA 2YUXA 1OAZL 1MAKA 5ERWB 3UBXG 3WNOA 5CWSA 4U1JB 4QRPE 5D71L 5GHWH 3DI2B 3G5VA 3FOLB 3PG2A 2I5YH 3QHFL 1U8MB 5ITBH 4KRNA 1JBJA 1AGDB 4O2CA 4IMKA 4O2FB 1KIPA 1J05B 4PREB 5EOQL 3B4NA 4IMLB 3LS4L 5F7DA 4PJFA 3VXRE 4NC1E 4LRNH 1EXUA 2NY1C 4YEEA 4JFEB 1NC4B 5CSZB 5TDOA 4A2LA 3LDBB 3SDYL 3NFSL 1CDJA 4ZAKA 4ZNEE 1G7IB 2OZ4A 3RAJL 5KSBF 1OM3H 4PLNC 4BZ2H 4DJMA 1OL0A 3LKRA 1MREH 3I9GH 3T4YB 4G5ZH 4Z76A 3RIAF 1C5CH 3GSNB 3STBA 4I9WD 4EQ2A 4LSSH 2C26A 3P9WB 1U3ZA 2OCFD 1RJLA 3VMOA 3X3FL 3IXTB 3FQRA 4ODWB 3RI5K 5FFLA 2PW1A 3LEXA 5E6YA 4LEOB 2AEIT 1BQHG 2HFFB 3QEQA 1YPZA 2ZKHH 5I1DB 3DNKA 2Z9TA 3H3KA 3QDJE 1BPVA 1CICB 2V9RA 5GSVB 3NIDE 3LPWA 2IPTH 4D94A 5AAWA 3MLWH 1WBZB 4KRLB 4N90D 5CD3B 3QUXB 5LGHH 4NZJA 4LASL 5CJBA 5J1SC 4M48L 2XKNA 3BPCA 4ZUWA 3B6SA 4IM8A 3V6FB 1UC6A 3KLAA 3TV3H 3HS0B 3L6FA 4PV9A 4Y2DD 3V6OE 4WNQA 1WZLA 1M7XA 1G7MB 4NQUA 4PJ5A 1NBVL 3L5JA 3ARFA 4OZIF 1S5IL 4TTDC 1FFPA 4RMTA 3QA3B 3O6MH 2ADGB 1D6EA 1UVQA 2VKXA 4FQXC 4M62L 1DBJH 2FX7L 2NX5D 3OKLA 4KHXH 1CGWA 3V5KB 1AXTL 4F7MA 3VXTA 1ZKAA 2CLVA 3H9ZA 4TPRL 3TN0D 1JPSL 5D5MB 4CJ0A 3C5SB 4NZRL 4M1CD 1TVDA 5IOPB 2IMMA 3HE6D 2XZCH 3HC3H 1S7QB 1JGVH 2MCPH 1A5FL 4LGSB 1NCDH 2ADJA 3OMZA 1WFUA 3QXDB 4P2RD 3B9KD 3O3EA 4M7LL 1YY9C 1MAML 5J3HD 4A6YH 4P48A 4QTHB 3ZE2E 3LRHA 4GKNB 3ZKXC 2GSGA 2G5BB 4NOBA 5DK2A 3G5ZA 4UILH 3ZHKA 5DK3A 3CPLB 4N8CL 1NCTA 1H0DA 3AVEA 4OZ4B 2OR7A 3JUZA 3LKPA 1UA6H 5TF1L 5BOZG 3CC5B 3PWUB 1JYNA 2CKBB 3TZVB 4NKMB 4AMKL 1X5KA 2PR4L 1C08B 3PABB 4NGHL 3WLBB 2BK8A 3RWDB 1MHPH 5HTSA 4ZQKB 4POYA 1RIUL 1J88A 4CW1A 4Z77B 4GO6B 4XVTH 1GGUA 3E2HB 3EYSL 4FZ8H 1T5WA 3GSWA 1UJ3B 1GPOH 4EUPA 2VO5A 3QUKB 3SKMB 4YX2H 3W0WB 1D5MB 3KYOB 1BBJA 4XBEH 1LNUA 2CUIA 1TZIA 4Z7WE 1OB1B 3ORJA 1RHHA 3FB7B 1MRDH 5L7XH 1IZJA 1P5VA 2FECI 5F3BB 4KI5D 1J1PL 1UXWA 5I30H 1PYWB 4P3DB 3MLXL 1RIVH 4NUGH 4F8TA 5LWYH 1JUFA 4PLOB 4U49A 1RZIA 3HZKA 1F4XH 3INUH 3QIWB 4HPOL 2D4FA 2J6EH 5D7JC 2X4TB 2GCYB 3I85A 2ZNXA 5ID1B 5EOCH 4L29B 1TQBB 1UM5H 3P4NA 5EBGA 5IMKB 5ADPH 3HI6H 2W07A 5HPMA 1I75A 1EFXA 2NY5L 5L88H 2YPVL 4NFCA 2WWMC 3RY4A 3S36L 3GGWA 5EU4B 3F58L 1XCTB 3FB5B 1VPOL 1K5NA 5EBWB 1OARL 2HN7A 1A7OH 2R0ZH 3OKOB 2YD6A 3BZ4A 4P9HC 2FWOB 5CJXA 2VLJD 3CLFL 1MCPH 3S98A 5D6DA 3D3VB 2JE8A 5DJZA 5TE4L 3U9PL 3VWJD 2R1WB 3L3DB 3S88L 2OTPA 5DJDB 1G84A 3ZKND 1A9EB 2LTQB 1E4XH 1UEYA 4MMXC 4LCUB 1DUZB 4YHIA 3QISA 35C8H 4NQCB 4JM2C 4XTRD 5EU6D 3TN0C 1WITA 1QSVA 2Q1EA 1EUTA 1AI1L 2XKSA 3HE6C 4HJJH 3UP1A 3CMOH 3K8MA 4HIEA 2D0GA 4YDKH 3JUYA 1MF2L 5GSRA 5EIVA 1S7WA 4HIHB 3B9KC 5DLML 2WBJB 3IETB 4DCQA 4M8QA 1QRND 1DQML 4R8WL 1GZQB 3O2WH 3RL1A 1QSEA 5C9KA 3L3HA 1MVUA 4AENA 4B5EA 4KMQA 3GSRB 4O02L 1KTDA 5M7QA 1MHHA 2QSVA 2CDFA 3EJYD 5L9DH 2Z8WC 4PJEB 4JFYB 3D85B 3WFHB 1IEAA 3QO0B 5DRNA 3GJEB 3BH9B 5ID0B 1K8IB 4TVPL 1VEPA 4HLZH 4R4NC 1KJ2B 1N5YL 2AI0H 5EZIL 4LPYA 1MH5B 2X42A 5CMAB 3NFPA 4QO1A 3U30B 3RY5A 4R90L 1HH9B 1VADB 4G8EB 1I7UB 3SDDA 4TUOA 3B2VH 2VDML 2Q7YA 1OTTD 4QF1B 3U1SH 4QXGL 3ULSB 3FTGA 2DLHA 1I7ZA 1IGIH 1AO7B 3LKQA 4OFYD 5HHXL 4PJXE 1PLGL 3RPIA 1LE5A 2WUCH 5JPMB 2LV4A 5HGGS 4F37K 4YDLC 3OR6B 1PFCA 1N2RA 2BVPA 4GH7B 4AJ0A 4DN4L 4QHLB 1NGZA 1QACA 3WIHA 4PD4K 1UCBL 4RX4D 3TA3A 2YEZB 1MVFA 3PF2A 2GFBA 1NSNH 2H1PH 2VTFA 5I16B 5HGBB 2PKDA 3Q5OA 3MJ9H 3O3AA 2PCPB 4K3EH 3VFRB 4CJ1A 5CEYB 4HMEA 1AJ7H 5DS8A 1XMWA 2OS7A 3VWJC 4DKFH 3KPMB 2YC1A 2Z31B 3TO4D 1K6QL 2FZ3A 1FYTA 3ZKNC 5IVZB 1KFAH 3LKSB 3CX2A 4FZEL 4C83B 4HWEH 3H9SA 3SQOL 5IEKA 2ATPA 1KXTB 2WAHA 4S1SL 5FKAA 2UUDK 4QWWD 5HI4D 3T0EA 1F2QA 1QBBA 3MRHA 4JPVL 5C0FB 1J8HD 2Z91B 3MLZH 3TPUA 2E7LA 3GSXA 3V7AE 4HQQH 4YPGA 4HAGA 4OCWH 1CIUA 4GAJL 1X5GA 2AEWA 1LP9A 1M1SA 5D6CB 1BFTA 1A7QH 4QHUA 2DKMA 5MERB 1E28B 3ZTNL 2EIDA 2J5LC 1II4E 5I8EA 3KYMA 3RFZC 3F12B 4QOKE 4H20L 1YNLH 4OLUH 1HHJA 4L3CB 1FG2B 1XGYL 3O8XC 3CDGB 1MEXH 4LLMA 5KSVA 2Y07L 1G7JA 2XWBA 3EJYC 2DWDB 3L3OB 4JHBA 1U42A 3BXNB 3KPTA 2X2YA 5GGVH 3UAJC 5FYKH 3MTRA 4H5SB 3WCYA 4GRLA 3OWEA 1HI6B 1VFUA 3DMMD 3GMNA 1HXMA 2OZ4H 5KSAC 2F9BT 4PB9L 2VLKB 1G7PA 5E8EB 5EH1A 4EDXA 2IANA 4N1CA 3FMGH 4I4WA 3WN5C 3I6LD 5C6PB 1DUYA 5H37G 1HE7A 4JDTH 3AU1B 1MCNA 3TO2A 3CXHK 3ULVF 3M17A 2IAMB 1NBYB 1U91A 4NP4L 3U4EA 3W39A 3FO9A 2RFXA 4RBPK 3QDMD 3OGCB 4LCYA 3MRPA 3W2DH 2IADA 4MA3A 4YHYC 2YUZA 4WGWB 1QFWL 3DI3B 5HVHC 5F7NC 4NNPL 4HAFA 3S34H 4PRIB 4G80B 5KVEL 4G6FD 1NMBL 3LRSB 4HT1L 1O5DT 1T1XB 1S5HA 3D39A 1F6LL 4PY8J 5J13B 4X99A 4OIAA 4LF3A 3T77A 1FL3B 3PL6D 4ZG1A 5FO8A 4Y4HA 3CUPA 4E41B 4WHCA 1BD2B 3EO1A 1T5XA 4FXKB 3FQUA 1DQJA 4XNYH 5LXGL 5INDB 4KZEL 3DYOA 1Q0XL 2B5IC 3MXWH 2ZOKA 1HINH 3QT2A 2NYYD 4QWWC 5HI4C 3VFMA 5D7LB 5E99L 3BPNC 3BYYA 1CDCA 3NAAH 4YK4C 5EC2A 1RUAH 1IFHL 1VKXA 1RMFL 3MCKA 3MV8D 4FNLL 3PNWB 4K07A 5ISZD 3CFBB 1T0MA 2DQJL 3MV9B 1UWXH 1F58H 3BPOC 5D1XD 2R1YB 1OAXH 4ONGH 4PS4L 1G9NH 3D9AH 5F9OL 2BDNH 4PRBB 3VD4A 3O6LL 4CKVX 2DL9A 1GXEA 3IDMB 2ZSVB 4H88H 2UV3A 4Q58C 4XB7A 4JHZA 3VXPB 5CILL 1OSZB 2H26B 4GS7B 1RFDH 1EFQA 3MRKB 1V3JA 1PZ5A 2W0LA 3KPSD 4QRSB 3GSVA 1ZHKB 2GYSA 4JPKL 5IV2B 5I1GL 3MLSH 2NW2B 4EBQH 2BCKA 3SDXA 4NO0B 5F3HA 3TGXA 4WV1C 2AAVA 2CH8A 1ERNA 1MWAB 5HHOB 1I1YA 4FFYL 1JWMB 4N1HB 1YMMA 4PJHE 3IDNA 1QFPA 1YDPB 2PF6A 4NN7C 4QHKJ 1P4LA 4U6XA 4EUPH 1RIHH 4NZUH 3EDEA 3QUYB 1WC7B 3C60C 1UZ8B 2DM4A 1MLCA 3UJJH 5E7BA 1UG9A 1VACB 2ZCKH 4RQQB 2ED8A 4KJPC 1OAUL 4QRPD 3DXAD 3VRIB 3C5JA 4PGZA 2X7LA 2D03H 1YEDB 5E2TH 4JG1L 4OLEA 2WLYA 5GGSY 4W4OC 1S8DB 3DYMA 4WDIA 3VXRD 1QQDA 1CGSL 1UCTA 1A6ZA