5I17B

Crystal structure of human germline antibody ighv1-69/igkv3-20
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
216
Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
total genus 39
structure length 216
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B01
3SDDD 4UDUA 3ALXA 4P5KA 3MBEB 1RZ7L 2GJJA 4XRCA 3VXSB 2WP3T 1QZ1A 2JCCB 2P46B 1DE4A 4NPYB 2Y6SD 5CGYD 3QAZB 4LLWA 3MA7A 5B8CB 4R7DA 1OLZA 1P4IH 2UZXB 2IALB 5KSAB 5GRVK 5I75B 5ISZA 1ZE3C 1AR1C 3OR7B 4AEHH 1U3ZA 1QLRA 5IB2B 2HJLB 5KSUA 2IQAA 1UM6L 3T0EA 1NC2B 1DQQB 1G7IB 2H6PB 3OAUH 2ICEB 4WW2B 3ULVH 4ODXB 2DLIA 2EYRB 3MREA 4JB9H 4W70A 3SO3C 1A9BB 1IFHL 3C8KA 3GI8L 3V6BR 2FGWH 5DD6A 1KTRL 5LGHL 5BXFB 1HILA 4UDTB 2OK0L 5A16A 3M45A 1K5NB 4OF7A 4NKDB 2NY1B 5DHXB 4ONHB 1X5FA 3P30H 4XPBH 2PYEB 3RWFA 3LDBB 3CZFA 1MREL 1VDGA 1VGKA 1DBKL 3CVHB 4LAJH 5FB8A 1A4KA 1JP5A 5DR5L 1QO3A 3MUZ1 1P5VA 3LKNB 3VGAB 1HHIB 1EAPA 2RIKA 1T66C 1YEJL 2FX7H 4ZFOB 4P5TA 3VXRA 4XBGB 2R0KH 4GMTH 3QNYA 3WJJC 1FO0H 4Y19D 2G2RA 2D4DA 3OKMA 2D7QA 1IGML 4LVNC 3WKNA 1DQJA 2AXGB 2Z8SA 3GSUA 2GUOA 1IC5L 5CEZE 2W91A 5HYFA 1UXSA 3H0TA 3A67L 3SJVE 5LKNA 5GS1B 5FGSA 4ZUTB 3B8YA 1BD2A 3VFSA 4PREA 1MFCL 4PGCA 3TFKD 1MCCA 2OJZH 4I18B 1QRNA 1UJTA 4HMDA 4Y8DC 2IAMD 1I1FA 3R1GL 3VGAC 1FV1B 4HF5L 3IU3B 3TNNB 3NZ8B 1SBSH 4IJ3B 1JWMA 4P3CL 3T0DA 4XTRD 3FT4B 1D5MA 1JL8A 3OKEA 4JFDE 1HILB 3B9KD 2E3VA 5F7DA 5EU4B 4GBXA 1WZ1L 1KBGH 1D9KB 1P7HL 3N1FC 5I1JH 2WBKA 4HH9A 1IAOB 1EO8H 4JGMA 4LSPL 3EDKA 4JJ5A 3OF6D 4EOWH 1OAKH 4XPGL 1J8HE 4I3SL 3FRUB 1FORH 1A22B 2B1AH 5D72L 2WUBH 4OUUB 2D31B 2UVFA 4NP4H 5T3ZH 1IQDB 1FNEA 4J7RA 3HMWL 1KELL 3O2DA 4P5KB 3TBVA 4L29A 1VB9A 3REVB 3VXSA 3QZWG 3RDTD 3RL2A 2ITDB 1FYTA 3THMH 4Z7VF 3H7BA 2JK5B 4AH2B 1KCSH 4K9EC 5LWYH 3VD4A 3HE7B 1RZJH 5DO2D 4WJ5A 4OLWL 1SM3L 2FL5B 2VXTH 15C8H 1NAMH 4QY8B 1F4WH 4ALAL 2APWA 1C5DB 5DXWA 4ORGB 4JR9L 4ZD3L 3RGVC 3WYRA 3CK0H 2R1WB 4YUEH 3U6RB 4ELKA 1EEZA 2GJ6D 3TA3C 4Z77A 4P2CG 1HEZB 1GCFA 4IDLA 1AO7D 3W0WA 3ZYZA 3RBSA 2J4WL 2FCBA 4ZOBA 5AYQA 3GRWL 3OMZA 1EGJH 3I9GL 4JJ5B 3DXAD 4MA1B 3KPMB 5IESH 3EBAA 1KN2L 2YRZA 1Q0XL 1A5FL 1BZ9B 2FATL 3RWDA 1I8MB 1SVCP 3CLFH 1KIQA 4HFUH 3LVEA 3IDNA 1I8LC 4PJGB 4P5MB 1MCEA 5FYJH 4NNPL 5GGTA 3P2TA 3QEUA 4OZIE 4FQXD 1EO5A 1EX0A 5FYLE 2ICWJ 1E27A 3FHQA 1A0QL 2BSRA 4FQQB 3E8UH 3OAZH 2NY7H 1F02I 12E8H 4Y4KB 3QIWC 3NACH 4ETQA 2J8OA 3GEWB 2BDNL 2EH8L 2XQBL 1WFUA 4JANB 3U9UA 2V7NA 1JZ7A 3KLHD 4AENB 5IQ9B 2PYFA 5E1AB 1KTDA 4AQOA 3G6JB 3UBXG 2VDMH 2ZJSH 2Z92A 1DR9A 4JZJC 1AGDA 1PKQB 3LQZA 5TDOB 3DX9A 4YHKH 1SJEB 3WHE0 4IIQA 3ZE2F 3UYRL 3PABB 1FAIH 1KIPB 5EZOL 1JYWA 4G7VL 2HT4C 3RDTB 2XWTA 1I7TB 3IDYC 3RWFB 2YD7A 3UTTE 3UBXA 2UZIL 4GRMA 4U0QB 5EBLA 1H3VA 1Q9KA 4GS7C 2XZCL 2P5WD 3QIBC 4F57L 2ED7A 1KTLA 1Z5LB 1FZMA 2FB4L 1UWGL 4KK5D 3KAAA 1U2HA 5C09E 1ZLSL 1X5AA 2H2SD 4JM2F 4P23A 4Z7UF 2B8OT 5C6TL 3QCVH 2XZCH 1KCLA 3P9MA 4BA8A 5IMMB 1MSPA 2LABA 5EIIA 3HG1B 1AKJB 5H35A 1MFNA 5EPMB 4HUUA 3ZSSA 4XPFL 1S7TA 4KTEL 43CAA 3ARYA 4XCCH 5EZOH 2DIBA 5A2FA 3LMJL 4ODWB 3TA3D 3QXDB 4GXVH 4QRRD 1DP0A 3E2HC 1PG7W 4YX2L 2R4SL 3OKLA 4JJHA 4Z7NF 4IOIA 1M7IA 3DYOA 5C2BH 3U0TA 3H42H 4MNQD 2QQLL 3VI4F 4JPWH 3QXWA 5ID1A 1HHJA 1H3PH 4L9LB 1OSPH 2FYYA 3LHPL 4KH2A 3RVUC 1WAAF 5E7BA 4YDJA 2IBGA 4HJJL 3B6SB 4G6FB 3RZCB 1BJ1J 1SQ2N 3ZKXC 4POZC 2P45B 4OUOA 4MLIA 3TO4C 3RX7A 4ZPVB 2AJYH 2F5AL 4HKBB 1PEZA 4BH7A 4LCYA 5CKGA 4M7ZB 3MOBL 1YQVH 4LDOB 5DUPL 3ULVD 1R3JA 3W0WB 3D9AH 1KG0A 3PWPA 5C0BA 5FM5O 3TVMC 1IEBB 1NC4A 4J23A 1WLHA 3ARQA 4IJ3C 2W0LA 2Z8VC 5I1CL 2LAAA 5AUMA 5FKAA 4QRSA 1QOKA 3MOQA 3ISWA 4MAYA 2Y06L 1P4LB 1KB5H 2EE2A 3BISA 5F6IB 1KT2A 1A7PH 2BVQA 5HVHB 2OZ4H 3C9NB 1TJHH 2DQDL 2UWEF 3PQYE 3OAZK 4E0RB 5DUBA 4X6BB 4IHOB 4JPWL 3HI6L 5GISH 1A7RL 3QDJD 3FT3B 1GOHA 3HUJB 2P4AB 1WITA 2DTMH 4XAWL 3ZMRA 4KRPC 4Y5YC 1RAMA 3DBXB 2D0HA 3VFOB 1TPXB 1YEDA 1WZMA 1D7FA 4PJHE 3LEXB 2EDYA 3VFGH 5A40E 1AKJD 4JQVC 1AQDA 5D1QA 3JXAA 5MEQA 2DQUL 1W0YT 1MCKA 5DJ6A 1RJYB 3PABA 2G5BB 5D1ZC 2CIKB 1NPUA 3C2SA 3WFBL 5C92A 5FDWA 3OXSB 3EO9H 2CIIA 3UTZB 3VFWB 3EFFA 2HG5A 3ARFB 3BAEH 5C0NC 5EU6A 3X13A 3TO4B 4JZNA 4Y5VA 4HPYH 4Y5XA 5FYKD 2W07A 3FOLB 1EO8L 4LSPH 2NW3B 3FKUS 1MEXH 1PW3A 4X80L 1AGBA 1HZHH 1DLHA 5E9DA 4XPHH 4U1LB 4HS6A 4KJWC 3N06B 4EIZC 5HTSA 1HWGB 4PJXF 4OFYA 2NY5C 3ZTNH 3CPLB 4WVRA 3C5ZA 4U1GC 3SDCA 5DS8A 1E4KC 4JFPB 4U1SB 1MCRA 1X3DA 3LEXA 3GMPB 4HZLB 3V5HB 1MI5E 4ZMAT 4LCWB 1A02N 3MV11 5IGXH 3VGFA 4OZIA 3MA9H 1ZWIB 3MRKA 3T77B 4LRIA 3SBWC 3BFOA 5AAWA 5BV7L 4WU7A 1S7VA 2BVEA 2N7BA 5FDYA 5GRUL 3BPOC 2ZCHL 2X70B 3ZDXF 1C08A 1CFVL 2MHAA 4JFDD 2FIKA 4LU5H 1BJMA 4RMQA 5I17B 3VWKB 2FJFB 1F45A 4NC1C 4JM4L 4NBZB 5E1HB 4BH7B 4ZO8A 3U4BL 2FHCA 1UH3A 4MX7B 5CBAB 1KEGH 1F8TH 1GIGL 1HINH 1HHHA 2Q3AA 2BZDA 3MXVL 2NY0C 5JW3L 2GIYA 1MCBA 3C6SB 2K1MA 2EDTA 3WFZA 4QRTB 3LRSA 1S9VA 4O02L 3IF1A 5MEOB 3O4OC 4PJAB 3RVXD 1WTGT 1NC2A 3MRLA 1MVUA 4I13B 4Y5VB 2DLEA 4NWTH 1T7VA 2J2ZA 4OFDA 1FBIH 5D7LB 1T3FA 3UTTA 5JQHC 5CWSB 3JTTB 3FONA 3OGCB 3V7MA 4JG1H 4YUEL 3GMNB 3KDMA 4PRPA 5J12B 4BUHA 1IFHH 3GSNH 5IR1A 1UWEH 3IJSA 1G7HB 2OSLA 4RA3A 5F3HB 1XGRA 1QUNA 3BOVA 3G04A 3LD8C 4PRHE 5F3BB 5BMFH 3VI3F 4NC1E 5T1LB 3MLVH 2EH7H 2H9GA 4WEMB 2JELH 1YEDB 5E99L 4KTEH 3O4OB 4RAHA 3T08A 4I0PA 1S7SA 1RZ8B 4LHUA 3VFVA 5DEGA 3RNKA 4JKLA 4O2FB 1OP3H 1TNMA 5HD8C 5CEYB 3G6AA 2G5RA 1BQHG 5BJTA 1MHEB 4PFEA 4K3DL 1UWGH 4PGCB 3RVXC 2QQNH 4RBPK 4R3SA 3TBSA 5I2IB 3AREC 1WZ1H 3N9GH 5JW4M 1L0XA 1EH9A 3VD9A 4RWHA 3DHJA 1OB1A 1F3RB 3F7RA 1G9ML 2WQ8A 4DK3A 1Q72L 4HGMA 1FSKC 1AXSB 3SGEH 5AEAA 3SOBH 4PV8A 4AM0B 4QOKD 1W72L 1BOGB 3TNMA 4NZRL 3R1GH 1NEUA 4IRZH 1N0LA 5D1XB 2GYSA 3ORJA 3MZTA 3HE7A 3PWPE 5D1ZB 2XN9D 2RFXA 4QF1B 3LQZB 4GO6B 4JG0L 2ZJSL 3GHEH 4EXKA 3QHZH 3T0WA 3WFCL 2X7LA 1SHMA 5TJWK 1I1AD 2KKQA 4DN4L 3KPPB 5I1HH 4PUBH 3QT2A 2DQFA 2I9LA 4HIIB 5B38A 1ND0A 4R4FL 5E03A 4AH2A 3K0WA 5JUEH 3PQYA 4DCQA 1KJMA 3HI6H 2NY0D 2Y9RT 1FG2A 5D2NE 1A3RL 3GSWA 5I74B 4OKVA 4FP8L 4JFOA 1MCSA 4GLRI 1EFXB 3GZKA 4NNXA 1U8KB 1QHOA 1JK8A 1K3ZA 3BUYB 4NRYA 1OARL 4YDKL 1U8JB 1UA6L 3BI9X 3G5YB 2UYLA 3BESR 3FOMA 5DSCB 3FN3A 5JW4N 4JFXB 4NQDB 4XB8A 4XXCA 3SPVB 5FYLH 5DD3L 2DBJA 4NJAH 1P7KA 1PG7X 5C0FB 5E95B 4MJ5A 2DQJL 3LB6C 2A38A 4MJIA 2H32B 4R4FH 1ZGLP 1HWHB 1IEAA 4UDTA 4Y1AE 3L5XH 4I8DA 4JDVA 1BAFH 5I1HL 3SKOB 4D9LL 2AAVA 2X41A 5E5RB 3ARVA 4JFEE 1D5ZA 1X7QB 4UT9H 3RAJL 1P53A 2XTJE 4KU1A 5DC9B 3MLUL 3BE1L 4XCEB 2GQHA 5EORH 4HWBA 3QEGH 2GHWB 2VQUA 5DJAB 4DJMA 4JKWA 1BBDL 2HFEB 5I19H 1ITCA 5TF1L 1S7SB 3L9RA 2DM3A 3GKWL 2HLAB 5H37G 5F6IC 4PJ9D 1G7MB 4ZNEE 2YS4A 4PJ9A 5DZLA 1N3NB 1XIWB 2HP4A 1FVCA 3ESVF 4WO4D 1DE4B 2M26A 3K8KA 2D7PA 2AQ1A 4PJAA 4Y4HD 1SYVB 4XZUB 4XC3H 3CNKA 1OOAA 3QXUA 3U0PB 1WJ3A 2FB4H 1DVFA 5K9JH 1U8MB 4AT6B 2IPTH 1XGYL 4DW2H 1QSEE 1G7JB 3MV9A 1WBZA 5C07D 1KTKE 5BVPH 2NZ9D 1JWMB 4X0KA 1WZKA 2R29L 4J6RL 1MJUL 3ARWA 3GRWA 2OBGA 2RQ8A 2Q8AL 2YK1H 1RJZA 2CKBH 4MD0A 5C0CB 4U1MB 2H9GB 1NCAH 4KTDH 3PWLB 3PDGA 1MAKA 1VERA 1DDHB 5ESQB 3C8HA 4TNVF 3WN5B 4TQEH 2EEAA 4Y89A 1F58H 4OLYL 3KXFD 3CFKB 1EMTL 1CFSB 2CLVB 4ONGH 4OTXL 1JWUB 4UZGA 1QRND 4OM0L 4KK5C 1PSKL 3LKNA 1HCFX 4RFNB 4NQTA 3SE9H 1A0QH 5DQJA 1E4XL 4LPCA 3S5LA 4K55A 4X6DF 2NYYD 1KEML 4X8JB 3RFZC 3CFJB 4I1NB 4H1LA 2ZCKL 4ZODA 3STZA 3DMMC 1NBQA 4KHXL 4Q9RL 1S3KL 4AY0A 1WV7T 2H6PA 5CSZA 5IKCA 1QBML 1YMMB 4DWHA 2DYPB 3U36B 5EOCJ 2XN9A 1HXYA 1J05B 4FQIH 3NIGF 3MBEC 2PR4L 1T04B 3G5YA 5MI0C 5SV3A 2O5XL 4DEPB 2IADA 3FJTA 2G9HA 2XPGA 4Z78A 1IAKA 5T3XE 4XBPA 2CXGA 2IG2H 3T2NH 3OXRA 3QIWB 2DOCA 1T03L 4PLJC 1QP1A 1OAYH 3QEQB 5ANME 3TZVA 3MCLH 5INDA 4KPHH 3C08H 4NO0D 3EO1B 1H8NA 1P2CA 1RZJC 3SE3A 2VABB 4JRXD 5IK3B 5J57B 3T65B 1FFPA 1TZGH 5DS8B 1KT2B 5MENB 3PL6D 3GSOB 3T0ED 1H0DA 4BFIB 4WO4A 1ZAGA 3BZFB 1MRCH 2VAAB 2XWBB 4JZJB 5E70A 5EBGA 4P46C 1DFBH 1LD9B 2AEIT 2A6IB 3P73A 4H1LB 5D7KE 3PF2A 2V9TA 3MBED 1S7XB 2A6KB 4Q7DA 1YUHB 5TPWL 1JF1A 5I8OL 1X5IA 1XF1A 4CL7A 3RL1B 4ZXBD 2HKHH 3VFGL 3NH7H 2DLFL 4OI9A 5KBNC 4UV4L 4HWZB 5CD5C 3UTSE 2A73B 2Q87A 5KJRH 2ZUQB 2HT4D 3FQXA 3CSYB 4L8CA 3FRPG 2WBWB 3NMEA 4OGZA 4JHWL 4PJIB 4PD4J 3K4ZA 5ICXB 1NC2D 4LSVL 2E27H 4NQDD 1WCBA 3H6JA 2PXYC 3EOYG 1Q0YH 3QXAB 2JF1A 4MJIE 5DRWA 3WNLA 4PR5B 3GBMH 3O6KH 1AD9A 4BZ1H 5IB3B 5CMAB 1AY1L 3EOTH 3FMGH 5IR1B 1F2QA 5A2KH 1AJ7H 4LSSH 1IC4H 1FZOB 1EUUA 3UJJH 5HHOA 1NANH 1NEZG 4P46A 4NQSA 3V6FA 1FVEA 4GG6F 4HEME 5E8PA 3OX8A 5D7JA 5J6HB 1MH5B 5K9QI 3FZUC 4WEUD 1XGQB 3E1F1 3LIZH 3RJDA 3GMOB 3EAKA 4OLUH 4CVZB 4PLKC 3RPKA 3NABL 3O41A 1JHTA 5D7LA 1EEZB 3TVMB 3QO1B 3IAPA 1GYAA 2MWCA 3SDCD 4ZFZA 2HFFA 2BC4A 3MRCA 1QRKA 3V7AG 2VZTA 4R97B 2P44B 1CD1A 1KNOB 1OGTA 1Q38A 2AXFB 3A6CL 2FBOJ 3QQNA 3JV0A 5I15L 5TDOA 4OI8A 2Y23A 4FQPA 4PG9A 1GGBH 2AEPL 2ICWB 2ITCB 3BRFA 2FLRT 5DJCA 3FQWB 3NCBB 4P49A 3ROOB 1NGQL 3TVMD 5CMAA 5L2KA 4YBLB 1S5IL 1YNTB 3I50L 2X40A 4CVXA 2EXYC 1ZA3A 4OI7A 5K93A 3PGFH 5EDXA 5J89A 2BOCB 3CSPA 4Y4KA 5E8PB 5TF1H 3CX5K 5JDJA 4XNZC 1QFUH 4CDHA 3UAJC 3NFSH 5TE4H 3EO1A 5C09D 1CGUA 3GGWB 4AENA 3DECA 4PB9L 1HYSC 3RUGE 1AKJA 1MVFA 4OCRL 3BE1H 1A47A 4GAFB 4JRXB 2IWGA 3ZT6A 3AU1B 4YHNB 1NFDB 5F93C 1A7NH 1YEIL 3C60D 4NRZA 5DHVH 4D9LH 3VXUD 1PLGH 5HGGS 1QR1B 3VU2A 4N90D 2HVKA 3QDJA 3ZT5A 1F6FB 1OCWH 1MIEH 2H3NB 4EKXA 4L9LA 4WGWB 5I18L 2A6IA 1U8QB 3ARUA 1FO0A 4MNHB 2GSIA 3MMEA 1QA9B 4L3ED 4L8CB 4HEPG 1U3YA 3E2HB 1FNGB 3FQNB 2ADJB 2A9NH 1C16B 2XZAH 3D3VA 4X4ZA 5FF6A 1OTTD 4OV6F 3WV0A 5DHYA 1QACA 3REWB 5IWLA 4ZXBB 3E6FA 4WW1A 5IV2A 1II4E 5GGRY 1JNHA 1H15A 5ADPH 1JPTH 2ARJQ 3QWOA 4K2UH 1YYLH 4KKBC 1QPXA 3CFDB 3PWPD 5E8DL 4OCWH 1MELA 4LPXA 4MJ4A 4MQSB 1CGVA 4XVJL 2JK5A 4L4VE 1UJ3A 2YUZA 1AJ7L 4LSSL 3MRQB 2DQEL 3DMMA 1B4RA 1WCBB 3HI1B 2R69H 3HTLX 4WFFD 1R3IH 4FOMA 5D6DC 3WD5H 4PB0L 5J13B 1MJ7L 4TSCH 1T1YA 2X4TA 4YK4C 1BREA 2APVA 1QLFA 1N6UA 4PJGE 1MUJA 3HE6D 4DUXA 3KPNB 3J7HA 3OKLB 3NH7L 1F4YL 4JG0H 4MNQA 4WENB 2XNAA 1NGPH 5HGBB 1J7VR 5I9QC 3ARGD 2QHRL 1MCNA 3PHSA 5TQ0H 4QRRA 1B88A 3FFDB 4KK9D 4AEFA 4Y4KD 2LU7A 4IMLA 3SHSA 2W9LA 5C0GA 3NZ8A 3T3PE 1VFMA 1ACYH 3LQAC 5C0RH 1YY8A 1HNFA 3TVMA 4MXWL 1RIVH 3BEWB 2C4FT 1G1CA 2NLJB 4P23D 3QO0B 4B41A 2EYTA 5HY9A 3B9KC 5GGQL 1MCPL 3RY6A 3Q6GH 3A6BL 1KCRH 5E9DD 3BQUD 3O6FB 3FL7A 4JFZL 1I1FB 4K3EH 3R06A 1DVFC 1IM3B 2Q76B 5EU6D 3UTTB 1KIUA 4OGXL 3RL2B 4JDZA 2GTWB 1KYOJ 4NZJA 2OJEB 3GIZL 5T5FH 1XF2A 1R3LA 4HT1L 1INQA 3UTPE 4GKSB 1NLDH 1VENA 3GMRA 2MKLC 5FYKL 5HYSB 1QG3A 4MXWH 4ZQKA 3KYAA 3LSOA 2QADC 4ELME 4N1HB 1WIOA 1QSZA 5D2LE 5F97E 4U1KB 4BFEA 2W9EH 4HUXB 3G5XA 2EKJA 3MR9A 3OJMB 4L8SB 4M5ZL 2FZ3B 2H1PH 3HPJA 5HHOE 4XNZB 1WFTA 1LGVA 4L3CA 5EZIH 4O58L 3UBXB 4LARL 4R0LA 1ERNA 3LS5H 1QLEL 5C6PB 2KUTA 1T4KB 2IJ0C 5I1GL 4E41B 2D03H 4RGMB 1N3NA 1XIWA 3WXVH 4OF5A 4I18C 1UKSA 1H3TA 3ARED 3LN5A 4QRUA 3QFJD 1ZT1B 1CICC 4IMKC 4X4XB 3PNWB 1NGZA 4TSBL 1WF5A 1CIUA 1I9JL 3LN4A 4XPAH 1TVBA 3IFLL 5ACLA 6FABL 3IVKB 3WNKA 3MFGB 1NCAL 5EN2A 4U3HA 1MCQA 3MBEA 3PHQB 4KK9C 5HHXH 1GAFL 3U30C 4D0BA 3BXNA 4H5SB 1AI1H 2YC1A 4FFWD 1UB5A 1F58L 4PRDB 4OD3L 4QXGL 4TUOA 1H3UA 4P5MA 3PL6A 3QEHB 4CW1A 1RZIB 5I8EA 4MA3A 1UZ8B 4O5LH 3BIAX 4X5XB 3TIEA 3IKKA 3B2UC 4DVRL 1MEXL 4UMGA 1U3HC 3HPJB 1HI6B 1JGVL 1BQHB 2GITB 1Z5LA 4CMMA 4F7PB 3VXTB 3KNBB 1QD0A 4PJ9C 3O2VL 1OM3H 1DLFH 1A3LH 3CVIL 1K9TA 4NBYB 4YXHH 5SWZD 3BAEL 3MYZA 1KYOK 5HGDA 3FB8B 3QDJE 1DQTA 3KVQA 4YWGL 4P4KA 3HI1A 4HHAB 5HHVL 3GM8A 1UYWH 2Y1VA 5DF0A 1S9YA 1BBDH 5F7HA 4BQ6A 1ETZB 4LSQH 4UQ2B 2V5TA 2YRPA 3QEGL 3I50H 2QADD 1NGZB 3CVHA 1NKRA 4DN3H 3ROLA 4PRDA 2NY1C 2NCMA 1MFDL 4ISVA 4JE4B 3V0AC 5D96C 1UEYA 4I48A 5I15H 3VWJB 4RNRB 5DWUH 3ES6A 4GBXC 3UPAA 5IVXA 5HPMA 1DUYB 5FKPA 4X6CE 1KC5H 4D8PB 3P40A 1Q9LB 5C0FA 1KJ2A 1A6UH 1IMHC 3IDXH 1JHLL 4H0GA 4MJIB 4QHLA 2P48B 1T1WA 3KXFA 2F5BH 1CCZA 4LIQL 4N68A 5I9QB 3NFNA 3GBNH 4JO1H 3WHE1 3AM8C 2I26N 4CN4A 4BK4A 4L3CB 5GJTH 4EVNB 2F5BL 4OZHA 4P2QB 4XP6L 3DXAB 1QBAA 3KPSA 1C8PA 2H26B 2IEPA 1A1MB 4G43B 3DV6A 4X6DB 1HCVA 4HBQA 4ENED 3X12B 5BXFA 1EAJA 1I7UA 3S8WA 3O6KL 4QHUA 3HCVA 3TO2B 2YBRA 3MV9D 4P4RB 1T1XB 2A1WL 4U6VL 3B9KB 3WFDH 5DJXA 4ZQKB 3H9SB 2FECL 3HUJF 3OTTA 5KG9B 2AEWA 1DSFL 4NSKA 1X4ZA 4TPRH 1I8KA 2E27L 4YIQA 4OZIB 4MSWB 1E28B 1UB5B 4ZXBC 2E7LA 3SDXF 1XGTA 4NZRH 4Y4HA 5DJZB 5TDPA 1FCCA 4P59L 4Y16A 2BK8A 3TWCH 2HFFB 4N0RA 3AFLA 2EIEA 3GSRB 1G9MH 1I7RA 5ISZD 3DOSA 1U8PB 3WEXB 1DEEB 2F74B 1UENA 3GB7A 1XH3B 2R0ZL 1A6AB 1HDMB 1OSZA 4PBVC 4OV5B 4XAKD 3DYMA 1BJ8A 2W0PA 3QO1A 1P84J 1AXIB 1CD9B 1UXWB 4ODXA 4RX4D 1MRCL 1QTYT 4M8QB 1U58A 3IFNH 3N9GL 4BZ2L 4QHUB 4IMKA 2NY1D 3QDGE 1MHHB 2GAZB 3NCMA 1T1YB 2OX5A 2X4TB 4EBQH 4JPIA 1G9EA 4HS8L 5F7LB 2VC2H 4L4TB 3K2UL 4MJID 5GSRB 3SKNA 4GRLD 1KENH 4GW4B 4MAUH 2P8PA 4NQED 5E6YA 4GBXD 1J10A 3MPCA 5DEGB 4DKFH 1LO5A 4MA1C 4WTXA 2R4RL 2FEEI 5INCB 3UPRB 1EJOL 4HUWA 1X9QA 5H37H 4F7CB 5JHDB 4PJEB 4N8CL 2DS4A 2CR3A 4QGTA 3QP3A 4HJ0C 5IMOA 4WI6A 2LE9A 4GLRH 2ED8A 5J6GB 2CUMA 3T1FB 2CK2A 1ZWIA 5HHQA 1WWCA 4F7EB 1OAXL 1T22B 4PJIF 3VXNB 1U8QA 4TULH 1WWAX 4ZUUA 1U93A 3KYKH 4UUJB 2MPAL 5D1ZD 3RRQA 3RWEB 3VFNA 3V4VL 1N4XL 43C9B 3CLFL 1B4JH 3U2SA 1MFAL 3TN0C 2FSEB 3VXRD 1ZHNA 4HGWB 3ZHDA 1N6QH 2D03L 2Q86A 2PW2A 4MAYC 2J88H 2Y72A 3QUYA 2X70A 3QPQC 4OCMC 3IFOB 2Q6WA 5ENWB 1D6VH 3FO1A 1MHCA 4OCXL 2ATPA 3CDFA 3TP4A 2QSTA 3ET9F 2MQ0A 2V5MA 1H8SA 4WRLA 3RX8A 4M3JA 3GNMH 4F7TB 4PD4K 1I8KB 3QDMD 3PIQB 1CBVL 4WHTA 1VHPA 4LSRL 3ZTNL 1DL7H 3IETA 3FFCA 4X99B 1R5WA 1RZJL 3HN3A 2ZG3A 4Z78B 3BW9A 5BQ7B 2CXKA 3MQIA 1M4KA 4QTHA 2XXMB 2BCKA 3C5SA 3IDUA 4S1QH 3X11A 3QWOB 1S9XB 3O8XD 3SCMA 2P5ED 1M05A 2J5LC 1N6VA 1CF8L 5B21A 5IW6B 1UB6A 3DVFA 3RL1A 1QEWA 2VH5H 4I0PD 1QR4A 2QSQA 1T0NB 3R8QA 1U8HB 2VMFA 5GSVA 3WIFB 3CVHH 1QKZL 4PG2C 3PXJA 3TZVC 3U36A 4L9LC 3UTPD 1GZPB 3CFEA 4X6CA 4GRLC 3B9AA 5E4EC 2AABL 2N4IA 1Z9LA 2ZSWB 1T0PB 1B0RA 2XWBA 4PRPD 4XMLH 3QHFH 3TWCL 4HC1A 1UQSB 3BHBA 3SDDA 1A14H 2YD1A 2YPLE 5L9DL 3AM8A 4NIKB 4KRLB 5I19L 4G9DB 2L7UA 3P4OB 4G8GB 4YC2B 4UV7L 2AJZB 1DANT 1ADQA 4OLXH 1CDHA 5DJDB 3EJJX 3NBNA 3DUSA 1JGUH 3DVIA 1IGJB 4MS8D 1BM3L 4YPGB 35C8L 4MD4B 3UPCA 3ELAT 5DUBB 3OSKA 1O5DT 5C86A 4E9LA 1FFRA 3KYOA 2FBJH 3CD4A 4YR6B 1FPTL 3OWEA 4NO5B 4PJ8A 5C0CE 3SGJC 3UJIL 2KH2B 5KOVC 1I1CA 4OQ1A 3HPLB 3EYFA 1MHHA 1D6EB 4RDQF 1LD9A 2OYPA 5F88B 2VDNH 4WFFE 3ARTA 4KVCH 2PW2B 4JO4H 2K9UA 4I3RL 5GGVL 1BX2B 2D4FA 5I30H 3LKSB 4M6MH 3BPCA 4U1NB 9CGTA 2AJYL 2F5AH 1JHKH 3BD5A 2X4RB 3QA3B 4URTB 3TBYA 2YD9A 4ELMB 2J8HA 4YDVA 2W0FB 3QSKB 4NZUH 1K2DA 5D2LB 1L9NA 1A21A 1I1AC 1JPFA 3TBTB 2WMPA 4Z7VE 4Z7QE 4MA7L 4OF3A 3QXAA 1ETZA 4HLZG 5HHOB 5EPMA 4ZS7L 4KKBD 1HXMA 3KPRD 5DJCB 2V9QA 4RFOL 4NN6C 2VNCA 1FZKB 1ZLSH 4XXDA 3SJVB 2RGSA 5FHBL 2DD8H 2V5YA 1RULL 5IQ9A 2DICA 2ZSVB 4DGVH 3HZYA 5J0BA 1YMMA 2Y5TA 4N9OB 2NPLX 1BIIB 3DETC 4RAUA 4PJCA 3QEQE 4XNXL 4G43A 3QIUD 2XZZA 2NTSP 2EEDA 4M02A 1RULH 5FGRA 1YEKL 4JFHD 1CDBA 3BP4A 4NO0B 3QUXA 3BXNB 3TIEB 4EEEA 5EOTB 2R1XA 3SJVD 3BPOB 5JPMB 3QCUH 1BF8A 2OCFD 3SDDB 5FOBA 1A7QH 4RAVA 3IDJB 5HPOA 3BMVA 2QJDA 4P0DA 1UM5H 1C12A 1RUPH 4QRPD 3O3AB 4PJFA 3MLVL 4XNMA 3ARSA 3STLA 5HDBE 2BOBA 2X9XA 2R0WL 5EU5B 1LNUB 5F89B 4HKXA 2AK1H 4APQA 1N5YL 2I9TB 2ICWI 1XT5A 4RNRA 4M5YH 3O9WD 6FABH 4MNHA 3O3DA 3QNZB 3VFUB 3SE3C 1P2CB 2UY6A 4M7KH 1TZIB 5F9DC 3BT2H 4LLDB 3VWJC 4G9FB 4Q2ZA 3VH8B 2VISB 5D7LE 1RU9L 2DQIH 5ACZA 2YRLA 4K3GA 5CD3B 1RHFA 2BNQB 4YC2C 2UY7A 1H8OA 1XZ0A 4LKXB 3W39A 5IJKA 4YJZL 2VLKA 4UQ2A 2YD3A 5A16B 4HK0A 4GKZB 2CK0L 4HQQL 1W8OA 4ONFH 3VG0H 2J8UB 5IW1A 3L3DB 2EICA 4PRHB 2QBWA 1T2JA 3QQ9D 4GG6B 3O2DH 3MNWA 1NAKL 3KLAA 3GIVB 3VGEA 2H26A 1QQDA 4WWKA 1G9MC 5L2KE 4KXZH 3HPLA 1Z0NA 4NGHL 3ZZ1A 2IADB 4RMSA 4PGEB 4WDIB 1EEQA 4JQXA 2VZ1A 5HGBA 4NKMB 1KC5L 2JIXA 1KIPA 1FZJB 2WV3A 3BKYH 3O9WC 2CRMA 4NWUL 4DQOH 3O3DB 2AI0H 4DAGL 2MFNA 3SEPA 4NQDE 4OT1H 3PV6A 2UV3A 3DI3B 1MWAL 4H0HB 3HZVA 4PTTA 4U1NA 4KAQL 1BLNB 3KDMB 4L8DB 3G9AB 3LN5B 4QRUB 4G8FA 5HI3D 2B2XL 5JDSA 1SMAA 4GAJL 4YEFA 1T3FB 5F3HA 4LLWB 4XPHL 1CLZL 4JPKL 1ZT4B 1JTPA 4OZFG 4L8BA 1TVBB 4XRCB 3FQUA 4DKEH 5DD0L 5HHMD 3ZL4L 3CVHL 1PKQE 1HK6A 2LFGA 4XMPL 4PJEA 5F7DB 2CRYA 2W9DL 1FL6A 3P0YL 4HFWB 1JRHH 1JV5A 3B3IA 2DJUA 2I07A 5IHUH 3SBWA 3TT3H 3QUMB 1FORL 5GRXG 3C6LB 2AJSH 1JCKA 1BVKB 5ALCL 4LBEB 3QI9A 4EDWH 3GIVA 4NN6B 4L4TA 2DIJA 5DMJB 4WI8A 5KVDH 3HNTL 2WINA 3IJHA 5EBMA 1F4YH 3BEVB 3QAZC 3X14B 1TTUA 1CBVH 4ZS6C 4FRWA 3T3MF 4LGSB 1DBJH 1NBVL 4U1JA 2NY5H 4M4RA 1S9XA 2ATKA 3RWCB 5DYOB 5JDSB 3WD5L 3I2CH 4TUJB 4GSDH 4O2EA 5MHSD 4WCYL 1XF3A 3FO2A 4OKVB 3D85B 1F5WA 3AROA 4O9HH 1F6AB 4J3VA 4YGVB 4LIQE 1CI5A 4XPAL 4BSVB 1IGMH 4F15B 4R0LC 4LCUB 4L3EB 4FFYH 5IJVA 1HN1A 1LO0L 2FJHB 3O0RL 1R0AH 2P7TB 3I2CL 2HVKB 3RQ3A 5AZ2H 2X7LB 4P9HH 4P48A 3QFDB 1EVTC 4G6ML 3TBWB 3LN4B 2Q86B 5E56A 1AH1A 1AQKL 5D6CA 4ZPTB 4ZTPH 5JOEA 4R0LB 3MRCB 4FA8A 1IM9D 1FNSH 1D9KA 4XPTL 4L4VB 4QHMB 3VRJA 2VERN 3DTXA 3P30L 4XPBL 1U8JA 1NUGA 3U7AA 2AJUL 4OF0A 1UB6B 3PUCA 3U9PH 3HZKB 1MJJA 4WV1C 3GHBL 4UU9A 3NCYS 1JYVA 5GZND 3UROR 1K8DA 3HMXL 5JHDE 4DKFL 4KKLC 2OMNA 2APXA 1UJ3B 4P46B 1TZIA 4Y5VC 4I18A 5D4QA 3TN0A 5BOZG 3BW9B 2BSSB 5ACMA 5FYLD 2Q6WB 3C09C 5JR1H 1LE5B 3F7PC 5DHVA 1W0WA 5GHWL 2EO9A 4ZFGH 5F1IB 1GSMA 3SDCB 3QDGD 4AEHL 5D2NC 4YNYB 4JFEA 4KY1H 2NNAA 1IQWH 5AD0B 1FYHB 1FJ1A 3EIFA 4KJYA 1ZGLA 4JKPH 5FGCE 3QULB 1KACB 4K7PL 2AK4D 2CH8A 5GGQH 4F57H 5E2WH 2A6JA 3RZWA 4G9FD 4OQTH 3E6HB 5ID0B 3ULSA 1JNJA 1M6OA 3Q1SL 1AHWB 2NY6D 4HIHB 4LNVA 4JEGB 4KKAD 3NAAL 3GMQA 4QXUL 2RCSL 2BNQD 4UQ3A 2VDLH 1LVEA 5C0EB 4JN1L 1ZLUK 3GSNB 3NIFE 5KANG 1U8PA 1CE1L 4G6AC 3WN5A 3C6SA 2EDDA 2FIRT 4DKDC 2WP3O 3I3EA 5CZVL 2F53B 2D0FA 5IVZB 4ODHL 1MFEH 2AJ3A 5E6IC 2WWMD 4HS3B 3STBA 1HHHB 1NUFA 2WUCH 5CIPH 2VN4A 3MV9E 2E7MA 3EOTL 1FHGA 3AU1A 3INUH 4YBHA 1VSCA 4JVWA 3O3UN 4QCIB 1AO7B 3FB5A 4ZTOH 1CQKA 2YOCA 3P0VL 4FP8H 4Y4FA 3WXWH 4G80A 1MI5B 4M7KL 3AY4C 5EWIH 3QA3A 3VGGA 5JOPD 1QLFB 3QCTL 3VXOA 2C7UB 2XTJC 2NXYB 3GMLA 3ARBA 5DFVC 4OM1L 3VRLF 4IRSC 3LV3B 3LH2H 5D8JH 3NPSC 3CH8A 1PZUB 1X4YA 3AS2A 5GRJH 2HN7A 3X3FH 2NXZD 4TVPD 3CFDA 4OZFA 5D7SH 5A43C 4CN1A 5CEZL 1OCWL 1FZMB 3L3OA 5L0QC 4POZD 1MNUH 5JMRA 1DBAH 1PKQA 2G60L 1NEZA 3CK0L 1YEHL 3RVVD 2CJUH 2W65A 2VL5B 1ZHKB 4CU7A 5KVMC 4JRYD 3OZ9L 4LLQB 4KK8C 1U91A 2XN9E 5DMIL 2GKIA 5JLZA 3V0WH 3QXDA 3UC0L 4X4ME 4KRMB 5HHVH 1BWMA 4U6XB 5B39B 4AEIH 3SDAD 3F6IA 1OAUH 2M1KA 4L5FH 5TDNA 3SO5A 3NCJL 4IIQC 3UTSB 4OD2B 4XNYL 1OM3L 3CSBA 3WLWD 1FL3B 2DIAA 2DN7A 3QRGH 1QSED 1IGIL 2I5YL 1QNZH 3TJHD 2XWJB 1R3LB 3QQ4A 3VD5A 4WFHE 1N0XL 2A6JB 1KGCE 4ZUWB 3VFTA 4P9ML 2X42A 3IAGC 4PJCF 1MJJB 3A6CH 3T04D 4Y5XB 2C26A 1AIFA 3QULA 3EYOB 4JG1L 4JN2B 1CDJA 1MJ8H 5GGVH 3VCLA 3WNNA 1LO4H 4OD3H 3L1OL 3I6LD 3F7VB 5C0AA 2B0SH 3EDJA 1UEMA 3IRPX 1E6JH 1HSBA 5IUSA 3LIZL 4PJDB 4UIKL 1T21A 3VA2C 3WIHL 1W0WB 1G7LA 5C0ND 4M9OA 5GS0L 5ID1B 2JIXD 5J56B 2R2EB 2FGZA 4TSBH 3V0VB 3LRGA 3ILQC 1S7WA 1YDPB 4LVEA 4X99A 2GSGB 1CLYL 4NJ9L 4OTXH 4HSQA 4XWGH 3TGXA 3RZCA 3U4BH 1KEGL 4JAMA 3ZE1E 3EO0B 5CAYB 4PJHA 3O2WL 3V5KA 4KGJA 5C2UB 3WO3B 5JHDA 2QHLA 1TZHA 3BGFB 1E4WH 4QYOB 3MZGB 4HMEA 4PJBA 5AYUH 1WC7B 3UYPA 2O93L 3PDOA 5T1MB 3ROOA 5L2KB 5FGCB 5F7YC 4RISL 4R4BA 4KTDL 1YZZA 5A2LH 1M7DB 3FB5B 3PG2A 4FTVD 4LSVH 1MJUH 1XF4A 5EFIB 5ETUA 4P2QE 2DI9A 5MERA 2HKFH 4EDWL 3BEVA 1UZ8A 4UOJA 4MD4A 3EYVB 1IQDA 4PR5A 4NFCA 2HVJB 3L3JA 3SDXB 4J3OC 2FGWL 1XGYH 1PD6A 2B4CL 1ORSA 1AGFA 2W9DH 4EI6B 3H9SE 5L6YH 1W0VB 4O51B 3ECBB 4PJ7A 5L88H 1ZEAH 5EH1A 3FTGA 3ZL4H 3UTOA 2I5YH 2F53E 4HZAA 3I3DA 8FABA 1N64L 5CEZD 1VPOH 3MGTB 4F33A 4GH7B 3I6LE 2OZ4A 3GMMA 5GGSB 1IAIH 5D1QB 1SJVA 2PO6D 2JJTC 2ZUVA 1FO0B 2P7TA 2C1OB 2ZUUA 1S9WB 2BP3A 1HHJB 1TCRA 5E5MB 5F7FA 3CMOH 3TT1L 5EC1B 2JLLA 2KZ1B 3V95A 3A6BH 2V7HA 1CD8A 3NCEB 2R0LH 1EA9C 2Z0BA 1YPZE 3IXAA 4NSKB 2X4OA 4C59B 3QIUA 3MLUH 4PTTB 3ARFD 3GSXA 2JIXB 4RMWA 3TZVB 4L8DA 2NY4C 5HYIA 2R56L 2R2HB 2P8MB 5SX5H 4JHAL 4PTUB 4OT1L 3RGVD 5ESQA 7FABL 3EJYC 4MB4A 1MRDH 3W11C 3KPRA 3GKZA 3EDFA 1X5ZA 2VLRE 1SY6H 4C4KT 2R1YA 3Q6FB 1RZGA 4JQIH 3MLTA 1CGYA 1YMHA 1LDPH 3NFNB 1Q9WA 3BIKA 4HQQH 5JQ6H 1LDSA 3BO8A 1BJ1H 3MUHL 4FTVB 5I6XC 4LCWA 5I1DA 4R2GB 3QUMA 4OV5A 3FN0L 3U30B 4OM1H 1E6OL 3C8KB 3V4VH 1GZQA 2VXQL 3SQOH 4IBLT 5I8KL 2XN9B 3BZ4A 2QL1A 2IAMB 4MGXA 4E42A 4GW5A 3HAEG 3U1SL 5JUEL 3RWGB 5C9KA 2G75B 3ARFC 2YEZB 5DVLA 4PYHA 3RTQA 3P11H 5BO1L 4ODUB 4AK1A 1MLBB 3F6LA 2GSGA 4ZO7A 3DROB 3MJ6A 2GY5A 1RIUH 2P5EE 4OZIF 1EFQA 2MCPH 4R7DB 3MNVB 1XCQB 4IS6A 2Z93B 1AC6A 3HZMA 4HXAH 4HCRL 3QIWA 3RY6C 3LDBC 4FQQA 3NIDF 4IMLB 4MCZB 3G6JA 1T2XA 1N2RA 5DK0B 4KQ4L 4NO2B 4OGAD 2PETA 3N1MC 2RCSH 4QT5A 5KSAD 1PLGL 4U1HB 5LGJA 1A1MA 4X6DA 2V2TB 5EOTA 2W60A 1RZKH 4NCC1 3SDAA 4MQ7A 3MV7A 5CILH 4BM7A 3C5JB 2IBBA 4UNUA 3RNKB 1U8OA 4DFHA 2UUDK 2A0LD 4QRRB 4ZAKA 4HGKC 4MXQC 4Z9KB 2MQ3A 1IZKA 5ECJE 3UMTA 3RKDC 4QLRA 3BDBA 3LN9A 3QQ9C 4JDZB 4UTBH 4D9RD 1RZKL 1S9WA 4U7SA 1FRGH 2F58H 4Q0XH 1C08B 2DD8L 4UIMB 5IFAH 1JZ2A 5HYSA 5IB1B 4XHJC 3EJYD 1BPVA 3BGAA 4LASH 4DCQB 1R3JB 1IT9L 2R2HA 1UCBL 3VI3E 1Q94B 4GXUN 1SJHB 2WLYA 4LVNB 1ORSB 1ZANH 3IXAB 2AJUH 4Y19B 3O8XA 1FDLL 5J1SC 1BIIA 2JB6A 4XI5D 1BBJB 4LDLB 3VDCA 1MVUB 5FUCE 3MV9B 4XGZA 3HFMH 4QNPE 3QZWB 4Y4FD 5ESAB 4LLAA 2OR9L 2FWOB 2KQNA 4WTZA 2VDNL 1UA6H 2VR5A 3BKML 2NYYC 1JHTB 5JHDD 1FPTH 4HFUL 2BNUB 5GQBA 3O0RH 4PJ5A 3HAEB 5K33A 4M7ZC 2VQ1B 4R96A 1ZXQA 3ARBC 4UILL 1LO2L 1ZA6B 1KPUB 1TQCB 1N8ZB 3SKMB 5KN5A 4KROB 4OLXL 4EN3A 1MOEA 1AXTL 3MA9L 7FABH 1EFXD 4TUKH 1P6FA 2GJ6E 2PF6A 1AFVH 1Q1JH 3FO9B 1G6VK 2Q7YB 3O11A 1SMOA 3M1BB 1IGFH 3MOAH 1LNUA 5DZNA 4G9FA 3PWJB 4XCEA 5JW4Q 3EDDA 3KYMA 2YD2A 1JGUL 4ODUA 1FYTE 1IVLA 5IVZA 2NX5D 5GS0D 3DV4B 4J1UA 3DVNA 3C9NA 3HNTH 3U83A 1HQRB 2AK4A 2OXHA 2ZUTA 3CIQA 4WU5B 5I8OH 3BIKB 1AGBB 4X4XA 1MWAA 1UH2A 2BSTA 3D18B 5F72S 3QUZA 4Z76B 5D5ME 2OR8A 4PRNA 4KROC 3ZTJH 4KDWA 3ZDYE 3TA3B 3P0YH 1YJDL 4K94C 2IPUG 5KVGH 2HG5B 5IEKB 1CR9H 5A1AA 4LMQE 2QQNL 3O4LA 4QHKI 4MMZC 4QTIH 1H5BC 3ME0A 3D0LA 4NNYA 1R5VB 3IT8D 3BP7A 2J3SA 4WUUA 3V8OA 2NW2A 5CZKA 3ZT7A 4OLVL 3PWVB 3QPQD 1DEDA 4XCNB 4HUVA 1IGCL 3MCLL 5EFIA 4Z8FL 4ZNEA 2OS7A 1BQHA 2GITA 1FGVH 1FFPB 1ED3A 1GH7A 3JTSB 1DN0A 3PGDA 1GC1H 5KSBA 4BZYA 1HH9B 4NO2A 4OCXH 3LKQA 1T5WA 4PBWD 3ZKND 4P99A 2J88L 1I1YB 3IFLH 3LOWA 2E7HA 4D0CA 1UADC 1YUHA 4NGHH 4Y16D 4P9HC 4MCYA 3CUPA 4JFPA 4U1SA 1Z9MA 1B4JL 4NRXA 1JI2A 4MQXD 3EFDL 1D6VL 2YKLH 3CFBA 2FD6H 3VG9B 3ARBD 3P9LA 2VO5A 3S37X 4AYFA 3BJLA 3UTQB 4GW1B 2B1HL 3NTCH 2IH1A 5CHNB 2CK0H 5ILTH 1T7WA 1RJYA 3O9WB 4H26B 3BRGC 4V2CB 3BH8B 4Z7UA 1GGUA 5EZIL 5T1DH 1N4XH 5HHNB 2W9EL 2MPAH 3MV7E 4EUPH 4PRIE 1D9KC 2I27N 4FQJH 4O2FA 5I8CA 1ZVSA 2NY6C 3IS1X 1J87A 4WUUD 5F1IA 1U3HB 4GKNA 1KLUA 4N0UB 2X89D 2OL3H 2Z92B 4IOFC 3SDXE 2F54A 1MCIA 3QI9D 1L7IH 1JPST 1J1XL 4HT1H 1IGIH 4K3JL 4X83A 5E24E 3RVWD 2BNQA 2V5RA 2VDOL 4ODSL 5SX5K 4KROD 1A6VH 4RZCA 3B9EA 4D9QE 2IH3A 4LCIL 1ZTXL 2CKNA 4G3YL 1FSKB 1R6VA 3E6HA 3QUZD 1INQB 2IFGA 1IM9B 4L4TE 4NQVB 4NQCE 1IGTA 4OD1H 4NUGH 4JREB 4A2LA 4Q6YA 2B20A 1YEKH 1AE6H 3N1GC 5F1KC 2VKXA 1OGAD 5ALBL 5GRWA 4C56A 4YHZL 1R24A 2BHZA 4X98A 5CILL 4JFED 2ADFH 4MA8L 2NNAB 5E6IB 1K3IA 4XNUH 4Y16B 2OM5A 4MX7A 2FX8H 4M61A 4LGPB 1AD0A 3WUWA 5DEZA 1S78D 1Z3GL 4FFVC 3VFRB 1GGIL 2DQUH 1NL0L 4HLZH 3KYMB 1CZ8L 5ID0A 3EYQC 3JZ7A 5IMOB 5TH2A 4TOYL 2Y5TB 5JO5A 4LPUA 1NLBH 1MAML 1FIGL 5I1EH 2Z4QB 1IBGH 5CKAA 1MHPL 5FK9A 4YQXL 1IM9A 3C5ZB 4FTVE 3VD3A 5ITBH 5AD0A 5DRWB 4G8GD 1PX3A 5C71A 1I7UB 4XVJH 1NSNL 2CSPA 4G8GE 2XFXB 4I77L 4JO4L 3DBXA 3QDME 1CDUA 5TE6H 2GI7A 1UZ6E 5FYJL 2OTPA 1T7YA 4LRNL 4HKJB 3HB3D 4UINL 5LG1A 4RMVA 2FSEA 2DI7A 2J6EA 2A77H 4GG6A 2G9HB 2XPGB 5HBBA 2I07B 2A9NL 3LD8B 3CLEH 2NX5B 5F96L 5IHZA 4RRPG 4H26A 3O9WA 3MRHB 5EBWA 2AKRB 1JZ6A 3GRWH 3O3EB 1A7OL 1T1ZB 2VDKL 4AG4L 3B5HA 1MH5A 2HFEA 4F7EA 4HKBA 2D3VA 3QFJA 4KI5D 4JHAH 1D5BA 4OAWA 3HNSH 1FZOA 1NLBL 3S5LG 4XP4L 1I9RH 1OL0A 1QFPA 5FO9A 5MEOA 3DARA 3QHZL 3X3GH 4QWWD 1BFOB 2QQLH 1MQ8A 2YSSA 1BBJA 4E42B 4DK6A 1W2KT 1B2WL 3OJ2C 4L4TD 3D85A 1Y6NR 5IROC 4FQ1L 2WANA 4NDMA 3NFPB 3SOBL 4NFBA 4CJ1A 3HZVB 3BKCL 1CIDA 1FC1A 1Q72H 4RGNC 1YMMD 1IAMA 1X44A 2YPVH 4ZFGL 5ESVA 1A4KB 1Y6KR 1WFOA 5JR1L 2ZUWA 3OKOA 1INDH 3MTRA 4NQEE 2EIDA 2IFFH 1NDGB 4M1CD 4EUPB 4Z7VB 4P4KC 4KZEL 1NJ9B 2O61A 5E2UL 4WI5A 5DJYB 4FZEL 5H2BA 5L8JB 4BJLA 4CMMB 3VWKD 4Z7WB 4N0FA 4XCFH 1KIQB 3JWNC 1SBSL 5HI4C 5GRYA 2W65B 2XXCB 2HKFL 2NY0B 2C3XA 4QWWC 4NT6B 1DQLL 4RA0C 1EJ6A 2G2RB 5KTEL 3KJ6H 3W11D 5HHXL 3MLXH 1MFCH 5JW5A 2HT3C 1B0WA 2AP2A 4LSTH 2IANE 3JWDC 1WEJL 1I8IB 4PGDB 4I0CC 1HEZA 2ESVD 4J12A 3QUML 5BZWA 1SJHA 3EHBD 5B3JF 2XKNB 4XP1H 2QSCH 2VJXA 2ZKHL 32C2B 1MRFL 3KPOB 4K3HA 1FNAA 2WW8A 1AY1H 4HKZB 2BDNH 2EH8H 2XQBH 3OJVC 4TUJA 1VA9A 3RUGB 2OSLB 5CJOH 4M7LH 5SWQB 1ZT7A 3ARGA 1TENA 3GMNA 1CT8A 4QHNA 3K7UA 4QRRE 1DBKH 5EU4A 1RHHB 4WHTB 5KW9L 5I8KH 1E6JL 3ZDZE 3BP5A 3PWJA 4RIRB 2YKLL 5DVMA 5JOFB 3F7QA 3FN0H 2YMXH 3DO7B 1CL7H 5A2JH 4D9RE 2C1PA 2AW2A 2BVUA 2D31A 4FNLH 2X44D 3PWUB 2N7AA 1IAIM 3DTXB 4OZGA 4CGTA 3GI8H 5AAMA 4JQIL 3KPRB 4OJFL 3KLSA 1CFNA 3QZWA 1GOGA 4HWBL 2VDPH 3F58L 5CINH 3QJHB 4OLEA 4ELMF 2P5WE 4BSVA 1QNZL 5DURD 3DX8A 5FYKE 4C56E 2DL9A 4PP2A 2NXYD 1Z6JT 4I5BA 3WS3A 4F3FB 2BNUA 1MF2L 1RUML 1Y18B 3JV4A 2HJKA 4Z7QF 1B0GA 3EO0A 3CUPB 1JFQL 1WSST 1ZSDB 1NMAH 4E5XA 3L3GA 4DKEL 4NPYA 4M1GL 3D39A 4ELMA 5FM4A 1BOGA 1OY3B 1YA5A 4X9BA 3WNMA 2R23B 2W0KA 4HPYL 1TVHA 4LP5A 1BVLB 2NY6B 1HSAB 3Q2CA 2X4RA 3MLYL 3QEUB 1GPOL 1IL1A 1B3JA 3PL6C 2CDEA 4NP4L 5T3ZL 5DJ0A 4ODBD 5IVOA 5C0AE 4AIZB 5GGSY 4NCC2 2X6MA 3FB7A 2G60H 2R1XB 4FTVA 1CFNB 5HDQH 5GGTL 5H2BB 2AQ2A 3TN0B 5CINL 4R4ND 4Z6AT 1KBGL 5GGRA 3QNXB 2P24A 2QV2A 5DK3A 4CDGC 3IDMA 2KPNA 4RGNE 4Y8AA 5LCVH 5CEYA 2HVJA 5BW7C 4NQXA 2YN5A 5IW6A 3VG9C 1INEL 1U36A 5KSAC 4TNVK 4IOSD 4PJCE 2V2TA 4HF5H 3UTSD 1MY7A 5HI3C 1DVFB 3QJHA 4KKAC 1NFIB 3BZEA 1JZ4A 3WO4B 2QHRH 4PRNB 2YXMA 2CMRH 5DRZB 4N0YH 3NFPA 1D5MB 3ALPA 1KEMH 2QADB 4LLDA 4S1DC 2VIRB 2YA2A 3IU3A 3TNNA 3WFHA 3B4NA 2PW1A 1LP9B 1GXEA 5C0AD 3FT2A 2AEQH 4XBEH 1C7TA 2Z35B 2A83B 4HKXB 4GT7A 1RU9H 1Q9OA 4HK3J 2AJZA 4ENEC 4JDVB 4QHNB 3V6ZA 2AXJA 5D7JD 2XRAH 2VDRH 1KLGB 4P46D 4GQ9L 3O6FC 4DVBA 3UTZA 1DBML 2XTJD 3KJ6L 4HV8B 3MODH 4OLZH 4N9GB 4MNGE 1FDLH 2EC8A 1RUPL 1J1OL 3N0PB 1RJLB 4YR6A 1AIFB 3QYCA 1JTTA 5BVPL 2VLKE 4XCFL 3T2PA 1IGTB 4NNXB 3CSGA 4YHMH 3K1KC 1M05B 1JI1A 3WE6A 5D7JB 5DD5L 4HJGB 1VACA 1KB5A 3HE6B 4K7PH 4OIIL 1DANU 1JGEB 2LQRA 4HWUA 3ULVL 1G6RB 2E6JA 3VW3H 3U0WH 1AQDB 3P4NA 2JB5L 2XZQL 2R56H 3VI4E 2OR7A 5BW7A 4YHPA 2PXYD 5ITFB 1CDIA 5ADOH 4HKJA 4HUNB 4HDIA 2BVOA 3D69B 5DJ8B 5DRNA 3ZKMC 3FFCB 4QRPB 5FHBH 3R4DA 2ERJB 2FDBP 1T5XB 4JFYB 2R39A 1S7VB 1B0RB 3N1QC 1KCVH 2HAZA 4FQ1H 1A9EB 1FP5A 4QYOA 4CVXB 1P84K 3BN9C 3VW3L 2VLRA 5T5NF 5TQ2L 1ZKAA 3R0NA 4J3SA 2BNRB 3L3GB 4GAGH 3S6CA 1FAKT 4ISVB 5ADOL 4WWID 1NGQH 3JVGA 4P2OB 2QLVB 5CIPA 5F70A 1A6TA 4PLKD 1KIRA 4JRXA 2ESVE 5MP6H 2CLRA 3C60C 4JY6B 4IDJH 1UT9A 1W8NA 1ZS8A 3RWHA 3TJHC 1BFOA 4OCLC 5CEZH 3BPLB 3F7VA 4PJ7B 4N0UE 5CP3H 2XG4A 3AXLB 4HXAL 2XRAL 3EJZD 4L9DA 5F96H 2OL3A 1JPGA 3RIFK 3W9EB 5C7XL 4S10A 5D70L 1J5OH 4PJBF 3VXMB 4RQQB 3GSVA 5DMGD 3S88H 1QSFB 1PG7H 1B9ZA 3KLAB 4YFLI 2CIKA 4PJHF 1LEGB 1S8DB 4GBXB 3AAZB 2GT9B 4DKAA 5DI8A 5EC2A 4K7FA 2GEEA 3P0VH 3KS0H 4Y88A 2VXQH 2O5YL 2BJML 5TFSL 4YDVB 5J4MA 1CL7I 1T0MA 1GGCH 3NZHH 4HIEB 4KMTL 3CJJA 4DFIA 5C0AB 4KRPD 1NDMA 1WEJH 5KANI 1I85C 4K23L 4YDLC 2EECA 3DSFH 1I3GL 4QHMA 1CZ8H 3VFUA 5BV7B 5CZVH 5T1MA 4LOUC 3LS5L 1FNFA 2VWEC 2YA1A 1Z3GH 1B6DA 1DTUA 4HC1H 3EYQD 5C0IA 5I71B 5IF0A 4CNIB 4NQSB 3V6FB 3KPSE 4FFZL 5FYJD 2RHEA 4U0RC 3QDGA 3M8OH 5FYKU 1NFDA 4FZEH 3KPTA 2VAAA 4YE4H 2I24N 4S1RL 4WU5A 1S5HB 5JNYA 4JANA 3U9UB 2DL2A 2R8SH 1R3HA 3VRIA 3QDJB 4XWOD 3TN0D 3P73B 3L3KB 3GMQB 3LS4H 3MRGB 3NPSB 4ODTH 5BV7C 5C8JA 4YNYA 3K74B 5HDLA 3NCYP 2PTUA 3D69A 4L5FL 5HYJB 1K5NA 2VOTA 1KJ2H 4KHTL 5CJBA 1GC1C 3FO9A 1LEKB 4JDTL 1BZ7B 4QXTA 1SY6A 1DVFD 3JWOC 2A73A 4IEFB 1N8ZA 5D72H 2VDOH 2VLRB 4ESKA 1D9KD 2GFBA 4A6YL 5H94A 1OTSC 1TCMA 1MY5A 4GKNB 2AI0L 5I1JL 1T0MB 3WIIH 2V7HB 1BVZA 3C8DA 4XMKH 3SDYL 4MQTB 4S1RH 4TRPH 4Y2OA 3GSNL 1OAYL 1RVFH 3HNVL 4MNGB 1S7UA 3IDGA 1IM3A 5IROA 2EZ0C 3HR5B 2FR4A 2XTLA 3CFCL 3NIFF 1FE8L 3M17B 1WT5C 4YHLL 1P9MC 4CJ0A 4V1DD 1H0DB 4I4WA 5I1AA 3I6KB 3T8XB 1ZHNB 3X3FL 3VRIB 4OB5L 3MV8E 2Z31B 2SEBB 3K2MC 4U6TA 1ZVSB 2LU3A 5JOFA 2C3WA 2EE9A 4KVNH 3FCTB 1OF2B 2OQJA 3IFPB 2YMXL 3BVNA 1HINL 4JO2L 4N1EA 4P9HL 4UUJA 3SDAC 1E4JA 3BQUC 4CVZA 1YNKH 1R0AL 4Y19E 2EDEA 5TE6L 3KPSD 5JIKA 4XP1L 4M43L 4MYWB 4DEPC 1XGTB 5C3LD 1OGAE 1LWRA 5DJAA 1EBPA 3WXWL 3MRNB 5CJ5A 5DR5H 2A74B 5E8DH 3PV7A 4LLVA 4O9HL 4Z95H 5DLML 1FIGH 5I1EL 1QVOB 2DQTL 4LQ1A 3G6JF 2FO4B 4FXLA 3SKOA 1FGNL 5LQBL 1IC7L 5IB4B 1GC1L 4L29B 3KJ4B 5I1DB 4ODHH 1EJOH 1LO4L 3DMMB 1F6AA 2A9MH 3O3BA 1BIHA 5HGDB 1IEHA 5J11C 4FQCL 4LEOB 3WJLC 4P3WA 5K9JL 2AJXH 3T3ME 3U4EA 5EOCH 4YAQA 1WBXA 2Z91B 5MP6L 2QKIB 4K94L 3UO1L 3BH9A 1P4LA 3Q1SH 4BSWA 4EBQL 1HQ4B 4Z5RA 1B6UA 1ZT7B 3ARGB 3QRGL 1OTUD 3RGHA 3I6KA 1UVQA 5KVGL 1V3KA 4AIZA 1FV1A 1LK3H 5IOPB 2FHBA 3EYSL 4PS4H 3HE7D 5FA4B 5CJ8A 3QIUC 3Q5TA 5E8NB 3DURB 4U6YB 3BN3B 1DDHA 4ZFOA 4P4KD 3IRZA 2ZOKB 1HHGB 1H3WM 2BXYA 3D2UD 2MMXA 4H1LH 1PQZA 3D3VE 3BQUB 2ZNXA 1QFWM 2A74A 2Z8WC 4PPTA 5FDWB 1C1EH 5FHAH 1YEHH 1PZ5A 3U0WL 1MWAB 5HDBF 4M1DH 1LEKA 1B2WH 3ZE1F 2JJWA 4B0MM 2YD8A 1S9YB 1ZLVK 1BGXH 4H8WL 3DI2B 3X3GL 2QKIA 3BZDA 1VACB 1YECH 3HE6A 5FYLL 4FXKA 4Z7UE 5DGQA 4LHUD 2PTTB 3KPSB 4YXKH 1CFTA 4M4PA 1X5XA 4BSJA 3BSZL 2EDFA 4PRIA 5I1IL 5ETUB 1KJ2B 1ONQA 1TNNA 2BVPA 2DM7A 2B4CC 3G6AB 4QHLB 4X7EC 4R96B 1DUYA 4APQD 1FIEA 4M1CC 4GQPH 1IE5A 5D9SB 1OAQH 1ZLWK 2YSSB 1H9VA 4R97C 3IS0X 5J9PB 3VWKC 1JZ3A 1KTDB 4K07A 5DRXB 1SEBB 1ZANL 2JJTA 4X8JA 4D3CL 5FO7B 4X4YA 1G7MA 1RUKH 3PGCB 3TV3L 2WUCL 2UWEA 3LHPH 3GHEL 5L2JA 1BGXL 4H8WH 4XGZB 1IILE 3H9HA 1MPAL 2X4PA 3QUXD 4UV7H 1BX2A 3KHQA 4IRZL 5F71A 5GJSH 3UYOD 5E7FA 4UDUB 4W4OC 2MCG1 1J0YA 4Z8FH 3O6FA 1IGCH 2YN3A 3EHBC 1ROWA 2HLFD 2IAMC 4PRIB 4Z7WA 5FCUL 1CGTA 3FTGB 5C0GB 3OR6B 4PJBE 3G5VA 2AABH 2Z91A 3FB6A 1QSVA 5CZXC 5GGTH 5HYEA 4WDIA 3VXPA 1CR9L 3SGJA 4GKSA 3ES6B 3MUGB 4FS0A 4MNQB 1CU4L 1JRHL 4P2RA 3FQXB 4NM8L 1LP9E 4YHZH 1CE6B 1I75A 3LB6D 2N1KA 4OFYD 3RA7H 3IB4A 2GW5A 4G7VH 4OZGB 1U3JA 1JPSL 4DVRH 4Z7VA 3V4UH 4HIJB 1FZKA 1NDMB 1L6XA 2X4OB 4RFOH 4JFOB 1KTLB 3H9HB 1DUZB 2ICEA 4HBCL 2ZUQC 4LHUB 3VFVB 5IM7A 1XF2B 1TJIL 3LCYA 2F9BT 2ICCA 3QNZA 4HX1B 2C4FU 1CGXA 3QO0A 3L95A 4G5ZL 4EDXB 4P4KB 1BF2A 3PNWA 4G8EA 4N1CA 3AREB 3FN9A 3SKJH 3V0VA 5CLWA 1CN4A 5D7IB 3IVKA 4DAGH 5ICYA 2CGRH 5CGMA 5IQ7L 5JHLL 3IJSB 1YYMH 3RWJB 1VESA 1LMKA 3DROA 3CCHB 3QXVA 4PJ8D 5F9JB 2E7BA 2Q7NA 1WIPA 2NQCA 1KPVB 3K80A 4PJXE 4GKOA 5JMOC 3TCLA 1FBIL 1N26A 2X4SB 4PP1D 1CGWA 2W92A 1I1AB 4JO2H 3OXRB 1PX4A 2ZCKH 2OR9H 3RPIB 3H3BC 2FATH 4MDJB 4OGYL 1OAZH 3DMMD 3W0WE 2R1YB 1JVKA 1GRWA 3OL2A 1KN2H 4F2MA 4JFXA 4NQDA 4LCCA 2C3VB 1NUNB 5H94B 4L8SA 3BO8B 5IHBA 4CKVX 5CJOL 1ADQH 4LP4A 5LGKA 3EFDH 1JGDB 4MAYD 2BFVL 1JZ5A 2C1PB 3MLTB 1BFVH 3GFUA 3ZKSD 4P2QD 5D7IA 1JZ8A 4NQCB 4L3EA 1YYML 15C8L 5GRUH 1VEPA 2OL3B 1TJIH 5EU3A 5IVNA 5KZCD 1EXUA 4HJ0D 5IGXL 1XGUA 2C1OA 4K71B 3E3QE 1VGKB 2BRQA 4QTIL 5F6HJ 5IB1A 3B9VA 3V5KB 3VXUA 3TJEL 1M7XA 3QUXB 2NY2D 1G6RH 4JDTH 3KPQB 4O4YL 5DMGC 4JGJA 3WSQL 3X13B 1FH5H 5KSBF 2P5EA 5GGVY 2Y07L 4MQXC 4X5WA 4K71C 4X7FC 5BRZD 3MUGA 3WN5C 1F42A 3WJJA 2IANA 2HH0L 2BOBB 3KJ4C 2EKSB 2DBLH 3F5WB 2EDOA 3IDYB 1EHXA 1QHPA 1C16A 5F9OL 2BOCA 2NZIA 4GRWF 5J06A 4X6DE 4BFGA 3C6LA 3WSQH 3EOBB 3HC4H 1NMBL 5C07E 4JY4A 1SYSB 5F1SA 4X6EB 1HI6A 4RFNC 3MOAL 4DGYH 1NFDF 4S1QL 4R7NA 1AGCA 5EU3B 4PJ8B 1LO3L 3O3BB 3LKRA 1A7RH 2IBZY 5C9JB 2BY0A 3O6MH 4FQXB 5CSGA 1ZVYA 3ILPA 5EZJB 1K6QH 4ZUVA 2A1WH 3VFOA 4PY7B 2WK2A 3IKCB 5SX4I 4Z7OF 4D9QD 5JNYB 1CD1B 3HNSL 3DPBA 5TFSH 3P11L 3DUSB 5CWSA 3U82B 2EDLA 2HYMA 2DTML 5D7LD 3HUJE 1KJVB 1EHNA 1IKNA 4PJBB 4PRHD 1T04A 1MFBH 3T0EC 2L0DA 2YWYA 5DD3H 1ORQA 3VFWA 4S0SD 4PJHB 5HXMA 2M8XA 4I0PC 3FFDA 4JFFA 4NN7C 2W38A 3CLEL 1JN6B 3MJ8B 4LSUH 4PJ5B 1YNTA 3DUUB 3Q3GA 1E6OH 4PGBA 5ADPL 5BVJA 3FCTA 1I7RB 4OZ4A 1OAQL 3STZB 2DQCH 2VUYA 1MIMH 4PGJA 2X2YA 5FA3B 4OBSA 4YHIA 2FJHA 1FFQA 3CXHK 3RY4A 3D9AL 5K9OB 1SVZA 3DX9B 2COQA 2JKXA 5MERB 4BH8A 4FQXA 4YQXH 3I75B 5IT2H 2XFXA 5KSVB 3BSZH 1ODAA 3BZFA 5C0BE 4R2GC 1S78C 4BQCA 4DN4H 3G5ZA 3H8NA 4RX4A 4DN3L 4XPFH 3WL9A 2YZ8A 1A9BA 4OCRH 1Q8MA 3DXAA 2BSSA 1QFWH 4LASL 2XICA 2VLJB 2ATPB 5TE4L 1T83A 3Q0HA 2CDFB 4AMKL 3DRQB 2FX8L 2GJ6A 2ZOLB 5KZCB 3QI9B 2DYPA 1I8MA 2DRUA 4YPGA 4UTBL 1VPOL 5EIIB 3HRZB 3MRFA 1L0QA 2APFA 3B2VL 4XVTL 1K4DA 2ADJA 5FF6B 1M6OB 4LCCB 2JB5H 1SEQH 1QKZH 2BSTB 2Y36H 2IANB 4OD1L 3HS0A 3GSNA 3EYSH 4JFDB 4IOFD 5FA3A 1FL5A 2NXZC 4U1HA 5L7XH 1T0NA 3BP4B 4NO0A 2I60L 4ZPVA 5IF0B 3MJ7A 3ZDZF 4KJWD 3GMOA 1ZSDA 2AGJH 2CO7B 4KRNA 1RUQH 1N7MH 3P77A 3MODL 3CDGA 4X6CB 5EOCL 2NTFB 5CJXA 3JV6B 1JNLH 3WNPA 3RVVC 5J6HA 2BVOB 1KCUH 4KUCD 1OTTC 5SWSE 3O4LE 4YXLH 1DL7L 3OKDB 1H3GA 2XI9A 4WFHD 5CS7A 4OFVA 2MCPL 4MCYB 4NHCH 4XVSH 1BFVL 3AMLA 5BZWB 2WNGA 1AD9B 1QSFA 3K46A 1G0YR 3BX7C 4KJPD 4Z95L 2DKMA 3NACL 4POUB 1MI5A 4QRSB 3SY0B 2ZUXA 1Q0XH 4JQVA 2P24B 43C9A 4RIRA 2EKSA 4L4VD 3FQTA 4ZO6A 4TN9A 2ARWA 2P47B 5B3NA 3MXVH 5DK0A 5CLTA 4LLMB 2DLGA 3BPNB 1KFAL 4R8WL 1GIGH 4LIQH 1VFUA 5DFWH 4TSAH 4D94A 1CFTB 4J3TA 2Z93A 4JPVH 4MDIB 3IDXL 4C83B 4U3XA 5ACZB 4Q6IC 5E8EA 2UVEA 1RVFL 1URLA 3HNVH 4N5ED 1FL5B 1G1YA 3ULUE 1FLRH 3BKJL 1S7XA 3EYFB 2VDQH 5IQ7H 5IB3A 3FAWA 2CGRL 5JHLH 3GMLB 1Z0MA 2E9JA 3GI9L 4IRJD 1CXKA 3SKJL 1B90A 5DTFA 4N90E 3KPPA 4OIBA 5D93C 3OG6B 1IQWL 4O00A 4YDJB 2R4RH 2ARJA 5F7NC 3L7FA 5C07A 4PJGA 1IKFH 3D39B 5EG6C 1CXHA 1S7QA 3HI5L 2F8VA 3MO1A 4QOKB 4PRBB 4MNQE 3MLZH 4HHAA 5JOPE 3VXPB 5DT1L 1J11A 4M6AA 3NCCB 2DLHA 5DRXA 4J4PD 4GRWH 3REVA 1IAIL 4U1JB 4I9WE 3FRPA 4N0CC 3P9WB 3MSPA 4ODTL 1DZBA 3KXFB 3AGVA 1RFDH 4U6HA 4N9GA 3SPVA 4NQXB 3WFBH 4HFWA 4C54A 1G6RA 2O5XH 4K94H 4ERSH 5L6YL 1CLCA 1BVKA 2CR6A 3PDDA 4K23H 2XKUA 5C09B 2E9BA 1QBLH 1TMCB 1ZHLB 3UTTD 4P23C 4GOSA 4QXGH 3P4MB 1W72B 4PJ7F 3AREA 5F7MC 1T1XA 1Q1JL 4IIQB 3EYUL 4Y2DA 3MGOB 2R0KL 3NVQA 2PW1B 4GMTL 3HLAB 5IG7B 3QDAA 1CLYH 4NJ9H 1TZHB 1YEJH 2FX7L 3I6GB 4YDLB 2BXZA 1HIMH 3LKOA 2EYTB 5T1KD 5HY9B 2YR3A 1A7PL 1A1OA 1FLTX 4JAMB 3QG6A 4M7LL 3PWLA 5K59F 4UIKH 2OTUA 1PGRB 4J3UA 2EO1A 1S7WB 3S35X 1MRFH 2BNRA 3SQBA 2Z35A 1VKXA 2ICES 4OIAA 1A64A 1GHFL 3L3JB 2RR3A 3RWDB 4JFDA 4U0RB 5EIVA 4FFWC 2X4NA 4FXGA 5DRZA 1WQVT 4TULL 5LBSH 1PEWA 1JNLL 3PQYD 3TO2A 5KTEH 2Q8AH 3NN8A 3SGKA 3U4AA 4NO5A 5IP4A 1WAAA 4PJDE 5DD6B 1ACZA 5FOJA 3V7AE 1OW0A 2JJSC 3B5TA 2LU4A 1I1AA 1RD6A 4OCYL 2VL4A 3T1WA 2WIMA 1RZ8A 3AUVA 1PQZB 2L4OA 4ZS6D 4PB9H 3RY5A 3O4LB 1KPVA 5FKPB 1KF9B 3BQUA 1A7BA 4WU7B 4MWFB 1F4AA 1YPZA 3LKOB 2O26U 3TPKA 3PQYB 5FV1L 2HFGH 4XVTH 3DHMA 1Z9OA 4P2OD 3VFPB 5JW5B 3RU8L 2CD0A 2Y6SC 3RU8H 5IOPA 3E6FB 4WW1B 1OAUL 3GSXB 5BOPA 5F44A 4R90H 1KJ2L 4KHTH 4HMCA 4POYA 5DYOA 5GGSA 1KLUB 3QCVL 2QQKL 4UAOC 2RFXB 1V3LA 3ZKXB 4AJ0A 1QYGL 4PJ7E 1F11A 5MENE 2AEPH 5TF0A 4JY5L 3JTTA 1JYNA 4WO4C 3IF1B 5DD5H 2H8PA 1MNUL 4LDEB 5E8EB 3OPZH 3DSNA 3BWAA 2A6DA 4FN0A 1QSFE 2AJVL 2H32A 3T0EB 1C7SA 2XYCA 4YBQC 2XQYG 4JO3H 3MROA 2VR9A 2APBA 3S35L 1BMGA 2C3GA 3BP5B 5LBSL 4PJAE 3RIFF 2HWZL 3W9DB 1AQKH 4DTGL 2DWEB 2ILLA 5I66A 2H45A 3BDYH 3PHQA 4HK0B 2Z8RA 5F3BA 5D6CB 4LVHB 4ZPTA 5DUML 5CUSL 5HVGB 4P2OC 1Q9KB 4O2CB 5LQBH 1IC4L 1FC2D 4FQXC 3RUGF 4PRBA 2EDBA 1KPRB 4YO0B 2MJWA 2ADIB 4TSCL 3S36X 4Y5YA 5DMKB 2K7PA 3D3VD 2MNUA 3BJ91 3NA9L 5C0BD 1J86A 2O5YH 3P4MA 2DQEH 2FH8A 3MJ9L 3JWDL 4H20L 3WFEL 3KPRE 2PYED 3QG6B 4XVSL 4S1SL 1HHIA 5IVXE 2R15A 3GJFH 25C8L 4NYLA 3HS0B 5D93B 1SYSA 2HTKC 3VA6A 4WI7A 32C2A 3KPOA 5F7KC 3MUY1 3BN9D 2IF7A 3M17A 3C60A 1JPGB 3HA0A 4KVNL 3W9EA 4X4YB 4YBQD 3C5ZC 3MJ9A 3KXFE 5DK2B 1RUQL 5CUSH 3QUKA 2HKHL 5JXAH 4F58L 4LK4A 5FB8B 3JV6A 5C09A 2C7UA 5HDQL 3HC0B 2BVPB 1RK1B 3IXTA 3MYJB 4P3DB 4Y2DD 3OKOB 4HUKB 3MRFB 4X98B 1FG2B 4CNIA 1RZFH 3WHXB 4B53A 5L2KD 1H3XA 4HUWB 4OLWH 4U1GB 2HH0H 3KGRA 2R0LL 3MNZB 4LGRB 4CADA 3SGDH 1KCSL 3S37H 3CMOL 3I75A 2B7DT 3G6JE 4LKCB 2P5WA 4NOFA 4OGXH 1CS6A 5JIPA 1F2XK 1IKFL 1KXQE 3WLBA 4AQ1B 5JTWA 5KS9A 5CP3A 4FMFA 5FO9B 3MLRL 1HH6A 2WUBL 2GY7B 2B1AL 4X6BA 4V2BA 1JNHB 5I73C 3ARPA 4J4PA 1Y18A 3JV4B 3ALWA 1D3CA 4ZSOE 3F58H 1T21B 5L88L 4M93B 1R3HB 4OF8A 4HKZA 3FONB 2NW3A 4DOHE 1YEEH 3NA4A 5D1QD 4M48H 1BQLH 3FQNA 3E3QC 3RTQC 5MEQB 1VFOA 2BNRE 3QPXL 1S3KH 4XCYA 3HR5A 1U8LB 2AVGA 5I76A 4GW5B 3MV01 1JUFB 3O6LL 3NABH 3FRUA 1FNSL 1PBYA 3GJFK 4LNRB 3DSFL 4UAOB 2E9WA 4ONFL 5IBLD 2YZ1A 1T1ZA 4S2SB 4H8WC 1VFBA 4RCAA 3MXWL 1M7DA 4KK8D 3TM6A 1WAAE 1J88A 4B5EA 1A6PA 1WFNA 3HZMB 1MCLA 4WEBH 4WEBL 2FJFA 1H5BA 4O2CA 5K9QG 1I9EA 3L5JA 5CBEA 4ZXBA 2E7LC 1DUZA 3F62A 1EHLH 2NR6C 1P4BH 2BSRB 2F19H 3CPLA 5GS0H 4J3WA 4YXLL 2D9CA 3W0WD 3OJDA 2CKBL 3OKNB 5DJ8A 3DNKA 5D5MA 4UNVA 3F65A 2NTFA 4R2GD 1MI5D 1DQLH 5D70H 1J5OL 2EC9U 3NGBB 4JHWH 1UM5L 1KJ3H 1CICB 2GK0A 1P6AB 1XFPA 4YFDB 1I3UA 3F5WA 3TYFB 4X7DC 4JREC 1RURH 4KGLA 3QHFL 4JB9L 5IJVB 5LCVL 2VXSH 4XMPH 3L3HA 1N0XH 5FCSH 5SWSB 3EW3B 5TPWH 1SJEA 5EUKB 1HQRA 3NGBC 1FJ1B 3MC0A 5DJ0B 1FYTD 3BD4A 4QOKE 4JZJA 4U7KA 3ZE2E 3RDTA 2Y4SA 5AWNH 5IFHH 4PGBB 2LVCA 4NC0B 5DRNB 1CFQB 1X6LA 3TZVD 1U92B 3UEZA 3HC0A 2IC2A 5EO1A 2H2SC 1T5XA 3T0AA 4HUXA 4G9FE 3MLYH 5DVOA 4BFIA 4DZ8B 3GKWH 1QFUL 1ED3B 4NYLB 4RBPH 3UC0H 5CCKH 3ARDA 1V7NL 5E1AA 4P23B 5DMIH 4KWUA 3GDBA 1RZ7H 3SKNB 1LEGA 1S8DA 3CXHJ 2HMID 5GGUB 3JTSA 4D2NA 4AIXA 4LLYB 2FO1A 4XP4H 3HHRB 1MWAH 1LE5A 4MS8C 5JA9A 4XP5H 3U7WL 3O8XC 2XWTB 1J05A 3L5HA 1NCUA 5D7IF 2VDQL 3B43A 3V6OA 2VXUL 2F8OA 1DCLA 4GW1A 5K9OA 2GAZA 4RQQA 5B8CC 3QEHA 4CW1B 1KN4L 5GRJL 2EDHA 2DM2A 2PTTA 2EE3A 4OGYH 5I73B 1X5LA 4P5TD 3GSRA 4KJPC 4KHXH 3W5NA 4PB0H 5D7IE 1KFAH 4S2SA 4LHQB 3V5DB 4L3EE 5BCAA 4LMQI 2BERA 4Q97A 3BT2L 4I77H 2NR6D 3M1BA 1E4XH 4H20H 1MHPH 3RI5K 5FXCH 4PRAA 3K3QA 3NA9H 1JPTL 4K8RH 4LAQH 3VXUE 5CGTA 2XA8L 5IMKA 1GL4B 4Z7NE 4HPOH 1R3KB 4H0IA 3IKCA 4EI5D 5CJQL 1NCDH 4CN6A 1XCTB 5I0DA 1H5BB 5C0CA 1NL0H 4N0YL 5GSRA 4M5YL 3KPLA 4DTGH 5CBEB 3QH3A 1W72H 3VH8G 1C5BH 3VFPA 1AO7A 1X5GA 1N7ML 4F7CA 4HGWA 1YJDC 4GAYA 3KNBA 5IB5B 2FZ3A 3CX2A 1DQML 4U6XA 3FT4A 1LHZA 5B39A 1ZK9A 3EKCA 1RK0B 3NIGE 5LAXB 4QT5B 2X4SA 4WUUB 3L3KA 5EO9B 5J1AA 2R23A 3S97C 1HSAA 4JY5H 4KZEH 2CUIA 1K85A 5CZXD 3SDXA 2Y07H 1DFBL 4X7TB 4TVPH 1UZ6F 3VFSB 2IFFL 2JCCF 2NY3D 3TEUA 2OMBA 7CGTA 1RJLA 4TTDD 2PN5A 2J6EL 1D5IL 2V17L 3EUUA 3QDHA 2UZIH 4PJIE 1B0GB 3TJEH 1O0VA 3KPMA 4DGVL 1TZGL 3PP3K 4KI5C 1ZMYA 3BKCH 5C08B 3OR6A 2AJXL 3OF6A 4F33B 1TITA 3C08L 4KPHL 1JWSB 4XHJD 3MRJA 3B9KA 4PJEF 1EPFA 1OP5H 5EORL 1DSFH 4ORGA 2GJZB 1T03H 3BZEB 5C0JA 2ATKB 3RWCA 3TBYB 3GHBH 3VMOA 3QEQA 1J1XH 4G7YL 4K3JH 2K7QA 4MSWA 3HAEA 1QQDB 1YQ2A 1CE6A 4OGAC 2VIRA 5EBLB 4HH8A 4NWTL 2Z31A 3AC0A 4RGND 4OLUL 3HE7C 4OJFH 2KL6A 1M1SA 3MNZA 1XF4B 1T89C 4EQ3A 4PJDF 3VJ6B 5HJ3B 5INDB 3TBVB 2FR4B 4JY4B 4P2QA 4GFTB 3QJFB 3C6LC 1PFCA 2HT2C 3TBTA 3A0OA 1ZVHA 5C6WH 5LGJB 3Q6FA 4KMQA 1EEYA 4EI5C 4NN5B 3PWNA 1CFSA 1OP5K 4LCUA 1OAXH 5HI4D 1VEMA 1HKLH 3GJEB 2OJEA 5SWSD 4YHLH 3MO1B 1VGEL 2VN7A 4KJQC 4QOKA 3TBWA 2E8YA 5HYQB 1JMZA 5DQ9B 3LEYH 1MAMH 1FGVL 2NXYC 35C8H 2Q20A 1V8HA 4KI5E 3DVGA 1NAML 3MRJB 4K9EL 4NZDA 2V5SA 2YEZA 5INCA 3WIIL 3HLAA 4KZDH 2X4QA 1D6EA 4U33A 4LKCA 5KVDL 3W2DL 2AXHA 4EI5B 1IJ9A 1E27B 4PG2A 4Y5YB 5DMKA 1UYWL 1FFNA 4Q9CA 1I9IH 1XF5B 3C87A 3QFJE 4XNUL 2FEEL 4NM8H 3TT3L 5IHUL 4JFQA 1JYXA 4LSDA 4WFGE 3TPUB 2MSPA 5E2TL 3HZYB 1JIBA 5F9OH 4UQ3B 1CDCA 4RAUB 1FFOB 4GAYB 4CUCA 3LS4L 3BUYA 3GJFB 3DIFB 1QLRB 3DGGB 3PP4L 1X5YA 4CRPA 2UYLB 3FOMB 3ARXA 5DSCA 3SE8H 4NUGL 4GKZA 2FNBA 1NDGA 3QUZB 4Z76A 4Q58C 4R4NC 2J1KA 2FEDC 5I74C 2B2XH 4G6FD 4X9HA 1CF8H 3BH9B 4FFZH 3VD7A 4WW2F 5KSUB 1ND0B 1ZHBB 2P42B 3L7FB 5ERWA 3T2NL 5T1LA 5HYQA 3W2DH 2X4QB 3JWOH 5HHME 1OWWA 4QF1A 3WFDL 3DVGB 1JMXA 4NN7B 1TCRB 1X5JA 1KNOA 1MHCB 3ZKNC 3OR7A 3MLSH 2AKRA 3MLWH 4LLVB 4CVWA 2VSCA 1BLNA 1FN4A 5JPMA 1CTNA 1NBYB 2FJGA 4UU9B 3QR2A 3WXVL 3TNMB 1DJSA 3RWHB 2NMSA 4NQCD 2YUXA 2VZUA 5HHPB 1T6WA 1REIA 2BX5A 4EUPG 4WHCA 1JBJA 5D7JC 4OB5H 5MI0B 3UJTH 4KJQD 5T1LD 1F8TL 2Q1EA 2ZG1A 1JK8B 2Y25A 3B9DA 3ABZA 1WBXB 1RZGB 3C5ZD 1PKOA 2I9LB 3GK8H 3KLDA 2DF3A 4WI2A 4NHCL 5DA4A 3EGSA 1YEEL 4NHUA 4ZAKC 3OGOE 4PJFF 3LPGA 4LBEA 3GSWB 3G5XB 2R9HC 5DJ2B 2X10A 3S36L 4PUBL 1EAPB 3LZFL 4G9DA 4GXVL 5D1QC 4JM2D 4PJIA 4TOYH 4N8CH 5DC4B 3GIZH 4DZ8A 1ZHKA 3OV6A 2AGJL 5IG7