5I17B

Crystal structure of human germline antibody ighv1-69/igkv3-20
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
216
Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 216
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B01
1XMWA 2HVJA 2IPKB 4EXKA 3MUJA 5FKPA 1HI6A 3V0VA 3MV7A 2J7LA 1NAML 5T1MB 1UWEL 3KXFB 5D1QC 1IGJA 5I6XB 1MLBB 1MCCA 2R9HC 5I1AB 5K9KA 1UYWL 4XMPH 5F8QC 3MLTA 3KR3L 1UWEH 4NQDE 4AK1A 3S7GA 1DDHA 1UZ8B 5IMKA 3UPCA 2HG5B 4CVUA 1S7WB 2JIXB 2YC1A 1SQ2N 1EFXD 5E56A 2ZCKL 2HT2C 4RMRA 3LKNA 2FGWH 4KZEL 1CXKA 1HQRB 2DQTL 3GJFB 4G5ZH 3C08H 4KFZC 5AAMA 3UJTL 1SJEB 3MV9A 4XNZB 1HQ4B 4RAUA 3BO8A 4IRZH 5SX5H 3UJTH 4JR9H 2BOBA 1U8PA 4Y4FC 1GIGL 2C7UA 2P8LA 3BD3A 1WIOA 4OLZH 3B2UD 5H37G 3UBXG 3JTSA 3FZUD 4F33A 2X70B 5HI5C 1B2WL 1GIGH 4RGMC 1F8TL 3HHRB 4EZMA 4LQ1A 4D9LH 1T22B 4P9HH 1QVOB 3OXRA 2P46B 4U6VL 4MDJA 5CSBA 3T65B 4WWKC 1K8DA 4KUZH 3RQ3A 5KANI 3DXAB 1KJ2L 3DUSB 5JO5A 1AGFA 2Q8AL 4OCRH 4TSBL 1PYWA 4PGEA 2ZP0T 5I8EA 1H8OA 3B3IA 5CEYA 5TDPA 3ZLQC 4TSBH 3QFJB 4Y1AB 5C09D 1WCBB 3WDIA 5GHWH 2JCCB 4NZUH 1UCBL 5EU5A 3B9KC 2D7MA 4LEXH 1LEIA 1RZ7L 5E2WH 4MXWH 4PLKD 1PVHA 3TO2A 2OL3B 3FN0L 5C0CB 3MLWH 2AI0L 1A6VH 1T1XA 5A40E 3WFCH 4XHJC 2EE9A 5DK3A 3DROB 3QBTB 4N0YL 1JZ5A 1NMCC 5BXFA 1JGEA 1OAZL 2YS4A 3C9NB 2OR7A 3QRGH 2BDNH 1UXWA 4ELKA 4YHIB 5FFLA 4GBXB 5D7LD 1EUUA 5GGVL 1QFUL 2GT9A 2QR0A 4Q2ZB 1NGWA 4Z7WB 1AGEA 4ZO9A 3QIUC 4U4BA 3S3PA 5GGVH 1QFUH 3JWOL 4YIQB 4LKCB 4GMSH 1IVLA 1V3JA 3TEUA 1FN4B 4BSWA 1IQWH 3JWOH 3O41A 4Y2DC 4WU5A 5H94B 1KCLA 4AIOA 1FDLL 3VXSA 4WFGD 3G5ZA 1R3HA 4NO3A 5KVEL 1D5MB 2YN5A 2NY7L 5TE7L 2EYTB 3VD4A 4OFVA 4R4ND 4ZDHA 3SHSA 5KVEH 1BD2D 3O6MH 1JWMA 2NY7H 1YEGH 3OX8B 4G6JL 3WYRA 3RX7A 1ES0A 1NGPL 3C2SA 1R3KB 1RK1B 1EBAA 1UJTA 2MOVA 3MLSL 1GZQB 5I2IB 4LAQH 3MOBH 3S35X 4LL9A 5J1SC 3MLSH 1I3GH 4W70A 4G7VH 5E95B 1K5NB 5D7IF 2V7HB 4ZS6C 3L9RA 4PY8J 1X6LA 3EO0A 4S1QH 3BKYL 2W9DH 1MCBA 5EBWB 2NR6C 3MRQB 1KEGL 1SVZA 2BP3A 4L8SC 5C07A 3QIWD 3HRZA 5L0QB 1RZGB 3E3QC 2Z8VC 3HE6A 4OCYL 3VGAB 4PV8A 1MJJB 3QFDA 4YFDB 4QRTB 5B21A 5KVGH 3L5JA 1S9KC 3GIVB 4JPIB 3K7UA 3CCHB 4HGMA 1DBAL 1KTKE 1OSZB 4R96B 4BQBA 4HKJA 3I9GH 3BZEB 4JY5H 3WNPA 5GPRA 3ULUL 1FV1A 3RUGA 2IANE 1W0VB 1DBAH 4MJ5B 2XZAH 3FO1B 4WVRA 4J3WA 5EUOF 5EU3A 4I8DA 1PDKA 1RAMA 1BEYH 5C2BL 3O9WD 3MYZA 3C60C 2Q1EA 3K4AA 5JW3L 4UQ3B 3P30L 1JJUA 4MS8C 3V5HB 4Y16D 1NCDL 4M02A 3P9WB 1D5XB 4V2BA 5E00B 1AGCA 1WBXA 1LWRA 4BFGA 1MWAL 4XAKD 3VXPB 2VDNH 2Y1VA 3EGSB 4AMKL 4L3ED 3MX0A 1L0YA 5F6HJ 5IHBA 1Q9WA 4ZSOB 4CN4A 4P2OD 5GRUL 2CUIA 4AMKH 4NBXB 5E4EB 4ZUUA 5C08E 4NQUA 4U1MB 5ID0A 3KGRA 2VAJA 3UBXB 5T3XE 3DX7A 4WHTB 5SWZE 2R29H 1T21B 3QZWA 3RWDB 5E8PA 4MCYA 1RUKL 2HP4A 5FYLH 3SDXE 2W0PA 5HHOA 5LGJB 4CN1A 3QUKB 2HFTA 4F7MA 4HFUL 2YBRA 1RUKH 5FA3B 4YHLH 3IXTA 3ZMRA 3H7BB 3LKRA 5JUEL 4GO6B 4HFUH 3HC4H 4NNYA 5L2KA 1JNNL 4EIGB 4MNQE 3NH7L 1CXIA 4H8WL 4EN3B 1M05A 4L5FL 1LNUB 5IR1B 4RMUA 4V1DE 4DN3H 3EFFA 5A2IH 3BXNA 2K7PA 5DRXB 3NH7H 4Y4HB 1I8MB 4HJ0D 1LK2A 1QKZH 4Z7VA 2UWEA 1PBYA 3O8XC 2JELH 2BC4A 3FQRB 3BMVA 3L3GB 3RVTC 2NY5C 3CDGA 4MXVE 4QTIH 5T5FH 5KSBF 3VXRD 4AEIH 1T66C 2JJSC 4JN2A 5J12B 1IC1A 5TDOA 5J7CC 5CJQL 3O2VL 5E8OB 2AVGA 3IT8D 4OFYD 1LP9E 5D93C 3OR6B 3SQOH 1IEAB 3O2VH 5B8CC 4N0CD 5CUSL 2X9YA 1DBBH 1IC4L 2EYSA 4PP1D 4MGXA 4JN1L 1Y0LA 2DTMH 1BZ7A 5HHQA 5CUSH 4ZPTB 1NGZB 1M7DB 4LSQH 5I74B 1EGJA 3GSNB 2Y5TA 5IFJB 4FZ8L 4M1DH 5DMKA 4NZTL 2CO6B 3OG6B 3OF6D 5ESAB 1J1XH 3PV6B 1GC1L 3IF1B 4NQDA 4HPYH 4LNRA 1J5OL 3IJYB 4NZTH 3CFDA 5CZVL 4PJFB 1NKOA 3FQXA 4IRSC 2VSCA 1J5OH 2VLJD 3EJZC 2IAMA 5CZVH 2PTTA 4KZDL 3BJLA 1TNNA 5E94B 1RUML 5E7FA 1I3RA 4WV1C 3KYMA 3TYGH 5TGBA 3WIIL 2VXSL 1CBVL 4Y4KD 4JFFB 5FEBA 4U6YA 2YRLA 2F54E 5DJ0A 4QT5B 1FL3B 3GBML 4IDJL 5J9PB 3WFEH 2GAZB 3Q2CA 3ALWA 3IVKB 2UYLA 1ETZA 1V3MA 2PO6B 1AD9A 3GBMH 4F57H 2X10A 1FH5H 2NLJB 5JW5A 3LKSA 1JYNA 1MRCL 3KXFD 1P1ZB 3BIKB 5IVOA 2E7BA 3V4UH 1A6WH 4OF7A 2G2RB 5GS1C 4WEMB 1ERNA 1MRCH 5B39A 1CGVA 3SGKA 5HYQB 2I27N 4GQ9L 1I7RA 3BH9A 3MRNA 2JLLA 1FC1A 2JIXD 5E9DE 3FTGA 3CFKB 1U8KA 2ZCHH 4P2QE 1GH7A 3QIBD 1ED3A 1WEJL 4OIAA 3MNZB 1WT5C 1YNTB 1ND0B 1JL8A 1WEJH 4LSTL 1INQB 1HYSC 4N0UE 5E0QA 4EDWH 4KVNH 3D18A 1UH2A 3UO1L 4JO1H 4PG9B 5GSVA 1WCQA 2JB5L 3HZKA 1YYLH 1NFIA 1AR1C 4AM0B 2DKMA 4KPHL 1G7PA 1GOHA 2FR4B 3RWIB 4JM4L 3RZCA 4DZBB 1U2CA 1U2HA 3UYRH 3VFPB 3TO4D 3E8UL 3DXAD 2QHRL 5LQBL 2Q3ZA 4XB8A 4X6CE 4ZUVB 5E4IA 1G9MH 3E8UH 2X09A 5DHVH 1JZ6A 1RZKC 4UV7H 4EI5C 5LAXA 2OXGA 5DWUL 3QFJD 3VFTB 3D2UB 4Y1AD 5DFWH 5FDWB 1FIGH 2VLRB 2BNRD 4M7ZB 3QUZC 1FCCA 1DSFL 3LAFA 2IMMA 3F12B 3R0MA 4NQVA 5DWUH 4C56E 3GKWH 2GW5A 2APBA 1ZHLB 3O11A 3TVMC 3T2NL 1DSFH 5TE4L 5C0CD 1W8NA 2BY3A 2FO4A 3SDAA 1QFWI 3RJDA 1RMFL 4HIEB 5FKAB 3U0TB 1JGUL 4ISVB 5TE4H 2CSPA 2OCFD 2H3NB 1CGWA 1N6QL 2DQEH 3WFDL 3RIFK 1JGVH 1JGUH 2OZ4L 4FTVE 5EORH 2DQCL 3FN9A 3WFDH 3OQ3B 3BRGC 2WIIA 2K1MA 1F11A 3RVWD 3T1FB 2DQCH 4GBXD 3PWLB 4MNGE 3BJ91 2VQ1A 2QV2A 3QI9B 1C1EL 1ONQA 4HWBL 2IJ0C 4O4YH 3CFCL 1UM4H 4P4RB 3CDFA 4K8RD 5K9JH 1J12A 2N1KA 5JDSA 4JDTL 5HSFA 3JXAA 1NUNB 1WBYA 5AYUH 3FB8A 3QG7L 3QDJE 2MQ3A 1XGUA 4X8JB 3WFHA 3BHBB 3SPVA 4OLWH 3WJLC 1BZ9B 1FZOA 4JDTH 3U6RB 1OP3H 3CH8A 5AG9A 3L3OB 3GHBL 5E8DH 4WWID 3C8HA 5DD5L 3MCG1 3UEZA 3A6BL 3FO2B 3LN9A 4J3UA 2IANA 4Z5RB 5JR1L 4QHNB 3ARBB 1X5XA 4MJIB 4OQ1A 3MPCA 4YDIL 1H3GA 3GHBH 4AL8L 4KY1L 1UG9A 5DSCB 3OPZL 1UJ3C 1S7QB 2VERN 5DO2C 3C87A 4H1LG 4U1IA 3EW3B 4X9IA 5F93C 3TYFB 3UTTB 3FCTB 3Q0HA 2GK0A 2UZIL 3RFZC 3IU3A 3G6JB 3LB6D 4RDQG 1QYGL 2H9GB 5HBBA 2DLTA 5HI4D 3HUJB 1E6OL 5ISZA 2HLFD 3OB0H 1B4RA 1QYGH 2Z31B 4M03A 2BVYA 1NBYA 5C08A 1U58A 3MBEA 4Z0XB 3MZGB 5CD5D 1Q0YL 1FVEA 5C0ND 43C9B 1NDGA 2IBZY 1XCTB 4X99B 3SDXA 1TZHB 4X7CC 4XCNA 3W11D 3GM0A 1LHZA 4DKEL 3RGHA 5DJ6A 5I1LB 2R2BA 3L7EB 4HF5H 4LSRH 4PJ8B 1XF4B 4EVNB 3PDDA 3EJYD 3E6HB 5MENE 1Q1JH 5E2UL 1DE4A 3S88L 4V1DA 3PGDA 2ED9A 5E2UH 1T0MB 1EO8L 3A6OA 3UTOA 1MCQA 2Q76A 5FUZH 4HDIA 1P4IL 1NAKH 5EUKB 5IK3A 1YNLH 1EO8H 5E6IB 1X5FA 4X9FA 3PWPA 1SMAA 4L9LA 5D2LA 1QFPA 4XBGA 4S1RL 1MJ7H 3O3BA 1P4IH 4NKMA 1I1YB 2IH3B 5A3IC 2VE6A 4I0KA 4RX4D 4X9HA 4KV5E 5HJ3B 1DQML 5BVPL 3W5MA 4JLRB 5HXMA 1N6UA 3ZDXE 1YY9C 2V7NA 5C3TA 3BUYA 1U0QA 1LP9A 4HCRL 2HT4C 4JHAL 5I66A 4UDUA 1R3IH 5BVPH 3V6ZB 1FE8L 1U6AL 4YEEA 1QR1A 4JHAH 4NWUH 3L5WA 1TCRB 3BX7C 2B1AH 3P4LA 3BWAB 1U6AH 5CEZL 4I0PD 1JUFB 1YC7A 1RJCA 1T2XA 5GISL 2A73B 1ZHNB 3SDDA 4EN3D 5ENWB 4LOUD 4WW1B 1C5DA 2EO9A 2X7LA 4J3SA 1QQDB 5ACZB 1A9EA 4Y4HD 4JAMB 2A74B 5FA4A 2AEPL 4MA1C 4PG2C 2CDFB 3MRHB 3AB0B 1Q72H 5EU6B 3INUL 4GRLC 1TVBA 3BI9X 1IGMH 4FQXA 4H26A 3ARVA 3N1FC 4PJEA 1KXQE 5I1JH 4DGIH 3NACL 4LBEB 2P24B 4UBDC 5EOCL 1NC4D 3GB7B 1KENH 3DUUB 4WEBL 1MI5B 3MV01 2H26B 1PX3A 3SGJA 4M8QA 4OGYL 4RGOL 5EBMB 4QXUL 4LP5A 1CE6B 4CNIA 1N6VA 5HGDB 4LVNC 2GYSA 2EDBA 5CJOH 1G7QB 3ZE0E 4JZNA 2P5EB 4HG4K 4RGOH 4Q97A 5IT2L 4OM0L 3Q6GH 4QXUH 1D6VH 3HTLX 4JHWL 2BCKB 3TPUA 1XIWA 4BH8B 1BWWA 5CP7B 4ELMF 4U6XA 4JDVA 5J1TC 3HE6C 4JHWH 4EI6B 5C7XH 2FSEA 3WCYA 2R8SL 4KRPC 1EHLL 5EIIA 3BRFA 1E27A 3TZVC 2XZCL 1WIPA 4GUPA 4XMLL 5E9DA 3W81A 2R8SH 1CGSH 2VRAA 3WE6A 1A0QH 4P2QA 4H20H 2BY0A 1X4XA 2FX8H 3P73A 1UFUA 1DUZA 5IB3B 1IKNA 1QFWM 2LABA 3T4YB 5MEQA 5I1IH 2KQNA 3HMXL 1MAMH 4UT6H 4GRWF 4HS3B 1HKLL 4PJ9B 1LDPL 5DJZA 3EOTL 3MRDB 1QRND 2I07B 3MROB 5F7EH 3IDYC 4LRNH 2W65A 1HKLH 5CLTA 3TIDB 2JK5B 4XMKL 4H1LB 1UWGH 4H25B 3SE8L 4K3JH 2PW1B 3IETA 4HIJB 4E5XA 2H6PB 1EERB 2ZPKL 2H41A 2PO6D 4OT1H 4XMKH 1C5BH 5BQ7A 1MHHB 1G7LB 3RWJB 3CZFB 4OB5H 2D03H 1HHHA 3GO1H 3BPLB 1NCTA 4X6CA 2K9UA 1TQCC 4WEUD 1BFSA 2XV6B 1B88A 1SY6A 4P3DA 4U6TA 4CAGA 4N5UA 4LGPB 3UC0H 1FL5A 4JFDE 4Y5VA 3BKMH 3MODH 1F4YL 3GMPB 3JV0A 2FL5B 4R2GB 5GGSA 3S9DB 5K9OA 3BUTA 4FQHA 3MGOB 1BIIB 1CLZH 1FG2A 4C56A 4EQ2A 4OZFA 3HPLB 1VHPA 1AGBB 3C5JB 4MA3A 5TPWL 1JZ7A 1HHGB 4QRRB 5FGCE 2XN9B 4JM2C 1IAOB 5HYSG 1KGCE 3B2VH 5I16A 5IB1B 1KN2L 1NANH 5CIPA 1E28B 2P43B 5EU7C 5DRZB 2UY7A 2YWYA 3IFLH 5TPWH 5CEXA 1U3HB 1H3PL 4FQQA 1G7HB 1AI1L 2HFFB 4QTHB 3WKMH 2RJMA 4DW2L 4F7PB 1A7BA 2NY2C 5C0JB 3MA9H 1B9ZA 1P7QB 1UB5A 3RUGF 2KQMA 3S6CA 3QDGA 4AH2B 5F1OB 1T0NA 3BDXA 2NX5B 2X42A 4LCWB 4QHKI 5GGRA 3G5YB 4ZXBD 4M1GL 3ZKMC 2GIYA 2X1OA 4HGWA 1OTSD 1YDPB 3PDOA 1RI8A 4MNGA 4NZRH 3CSGA 1HZHH 2BVPB 1UKTA 3HC0B 1J0IA 3EFDH 4CADB 4F80A 5L8KB 3L1OL 2ZCLH 4P9ML 4XNQB 4M1CC 3D2UD 1AP2A 2EDNA 2VLRD 3TIEB 3L1OH 4CVWA 5KS9F 4Y4FB 1MFCH 3GGWA 4DCQB 2YZ1A 3VFOB 4NQCE 1YNKL 4GS7C 2ZJSH 1FNFA 2BHUA 4RGMB 1OARH 3V0AC 2H8PA 5ICZA 1DQDL 2F74B 1Y18A 1SM3H 1DN0B 3V5DB 3P4OB 5I1DB 1WK0A 4NN5C 5E6YA 4WWKB 3LKQA 1KT2B 3ZYOA 3HC3L 3T8XB 4UT7L 2Q8BL 2NXYC 2VXVL 1PSKH 2IAMC 2AABL 2V6HA 2OXHA 3B5HA 2CGRL 4S0TD 5FUOL 4F7TB 2C4XA 4PREA 5FYKD 1DUYB 4QRQB 4N90E 4JFQA 1FZJA 2AABH 4WFHE 3X17A 3ALXA 5C2UB 5IJVB 1CVSC 1ZTXL 1CD8A 4PJCE 4XH2A 3FT4A 3QEQD 3QI9D 1MAJA 3B9KB 2EYRA 5T3ZD 1G9EA 1ZTXH 2ID5A 1RIUH 4Z0BL 1ACZA 3P0VL 1H5BC 5D7IB 1FSKC 5FO8A 5IV2B 2QTEA 3QA3B 3ARGB 5DJ2B 4ZUWB 3FRUB 5MEPA 5IJKA 1BBJA 2DJ4A 3SJVE 4NQXB 3GDBA 2RCSL 5INDB 4QGYA 1NMCB 4FQLL 1NCWL 1MQ8A 2RCSH 3FT3A 3ARBD 4MJID 3X14B 1WFTA 2ADJA 3ULUC 1IC5H 5DTFA 2XFXA 3EYSL 1N4XL 8FABB 2JF1A 3NTCH 2EECA 1I4FB 3LN5A 4TVSa 3JTTB 4UMGA 5K9QI 5MENA 4H88H 4YBHA 2BRRL 2HT3D 1CE1L 1ZLWH 2CUHA 3MGTA 4KQ4H 4G7YL 3UTTD 4HZLA 4KJPD 4GMTL 3VH8G 3D25A 1I8IA 2BRRH 1FYTB 5EUOB 2ATPA 4G7YH 4R97C 3MCKB 2RFXB 4MCZA 4Y2DB 2VXTL 4OZHF 3UMTA 3FT2A 3FB6A 5EO0B 5EO9B 2F53B 2BSSB 2IADB 4NQEE 5IF0B 1CT8B 3GSOB 5D8JH 4GG6F 3FQNA 2C26A 2Z31D 3UZVB 3WJJC 3UAJC 2O5YL 4WFED 5IM7A 3GMRA 4L1DA 5C0RL 1YUHB 4K3GA 4OGXL 1M7IB 1GGCL 2COQA 4RCAA 4UUJA 3X13A 1J8HE 4OFIA 2ESVB 2UUDK 3MV8B 1QACA 3ROOB 4X7SL 3BYTA 4YFLI 5DJCB 3G04A 1MIEH 4K7PY 2XOTA 3H9SE 1K4DB 4HQQL 4H8WC 1VFAA 4WO4A 3WLWD 1U8HA 2EDYA 3NFSL 4HQQH 4L8SB 1BF8A 2N4IA 5E6ID 4EKXA 2LE9A 2CMRH 3V4VH 5HHPB 3D39B 2GJ6D 5TDNB 2VIRB 4OTXH 5JOFA 3ULUF 1MEXL 2VLKA 5HYSB 5F7MC 2I60H 2GCYA 3MO1A 1GAFL 1MEXH 4KK8D 5DS8A 2XRAL 3RZWA 3PIQB 3GZKA 3F58H 2HN7A 5IESH 1I3VA 4NJAH 3L7FB 2JB6B 2VMFA 3WEXA 1GAFH 4PRHA 5E2TH 4YHNB 5C0FA 4F7EB 4KJWC 3SKJH 5FGSA 3GNMH 2BOCA 5HPMB 1A7QH 5DQDL 3C60B 6FABL 3HA0A 3S35H 5J89A 4DVBA 2ZUYA 4S0SD 3PHOA 1KTLB 3BE1L 1IT9L 4BYHA 4CVZA 2WUCL 3VXTB 4LCYA 1U8MB 3ARWA 1RIHL 2PXYA 5TJWK 3L3JA 3OAZH 2VABA 1JPTH 4FXGB 3BZFA 2WUCH 3EO1A 4IS6A 1GC1C 4ODVH 4O58H 4MD4A 1U41A 2C4FT 3PWJB 2PTVA 4MYWB 1FZKA 2ATKA 4QXGH 1KLUB 5CZXD 3MRGB 3HB3D 3NFNB 4LRIA 1ZLUH 7FABH 2C4FU 2W1NA 1H8NA 2E27H 3DYMA 2R56L 1O7SA 4BFEA 1H15B 1ZHKB 3P11H 5F9JB 2R39A 5F1IA 5CJXA 2R56H 3QHTC 5AUMB 5C0AA 3OKLB 5HHXH 1FO0L 1MI5D 4RWYL 4DUXA 1JZ3A 5AAWA 1JPGA 1U3ZA 2CLZB 4NN6B 2IQAB 2XTLA 1FZMB 1GCFA 2IEPA 1SEBB 2XICA 4HX1B 5H2BA 3KYNA 1ZT4A 2VDRL 3S96A 3TN0C 2HMIC 1FO0H 1YEHH 1MJ8L 4WTZG 2P5ED 1X6NA 2YD5A 5C0EB 1DEDA 4I3SH 1D5ZB 5L88L 3ES6A 3I6LE 1J05B 1KF9B 5DK0B 2HTKD 1F4WL 5GGSY 5CHNB 3U4BL 1KCVL 3QEUB 3O8XB 4UINL 4JFDA 4ZFFB 2ZSWA 5F7YC 2Y36H 4HUWA 1S78C 3K8KA 5D93B 2AV7A 4TUJB 4EDXB 1OCWL 3NIDE 5B8CB 3TNMA 1HSBB 1YECL 4GQPH 1AO7B 3GMLA 5MI0C 4PJ9D 5IGXL 4JPVL 4HK0B 1OGTA 2OJZL 3CIQA 3RDTA 1IGIH 4DJMA 1A7NL 1XH3B 3G5VB 1J1PH 4YEFA 3LHPH 4X80H 3CLEL 2ICWJ 1ODAA 4M7JH 3VH8B 1FORH 3Q1SL 3HFML 4NC1E 5D7JB 4AZ8A 4B7LA 4XPHL 1AQDB 2NY3C 1GGBH 3WXWL 4R3SB 1GVIA 5CBEA 3T09A 4IRSB 3U4AA 4MVBD 4YHOL 3VXOB 3O2DL 1KBGL 4PRID 3F7YB 4QYOA 4U1GB 5KAQF 2V2XA 3BP5A 1NEZG 4YHOH 5FB8A 3RWEA 2BVOB 3QULA 5FYLE 3O2DH 4R2GD 1ZVHA 4OFDA 1UA6H 1QSFA 2ZKHL 5IVXE 1NJ9A 4OQTA 1KPRB 3VXMD 1ORSB 2NW3A 3C8KB 1CS6A 3THML 3BSZL 4PJBE 4NQCA 2ZKHH 2VL5A 4XVUC 5TQ2L 4L3CB 2XN9D 3SDDC 1MFDL 1JHLH 1LO3H 1RK0A 1MUJA 3DTXB 2FDBP 1PLGL 5TQ2H 5JPMA 1MFDH 3RGVC 5HHNA 2EH7H 5KTEL 4TOYH 5D1QD 5JHLH 3T2PA 3NIGE 2R9HD 3VXNA 5DHXB 1P7QD 4LVEA 1F4HA 4KJYA 2X1WL 4JREC 4LDEB 2NX5D 1KIQA 3ILQC 5KSVA 1RUAH 2WLYA 3UYOD 3QXTA 3D3VE 4PJCA 3FAXA 5DYOB 3BQUC 2HT2D 4WNQB 3PWNB 3JBG7 4WI7A 3RP1A 5GZOC 1GOGA 4MMXC 4QRUA 1Z9MA 3FQTB 2NY1C 2X89D 3RPIA 1YEIL 4WCYL 2OL3L 3NABL 1INEL 4HXAL 1N3NB 3WN5B 4Y4FD 5D2LF 3UTZB 4M3KB 4PFEA 2J8UE 3SJVA 3DVGB 5ICYA 1K6QL 1OB1B 1G1CA 2GJZA 3HS0B 5ESVA 5E8NA 1MLCA 1DQQA 3AREA 4ZUTB 5FM8A 1K6QH 2DI9A 3M17A 1WC7B 3L3IB 5HYIA 1O7VA 3SGDH 2XTJE 12E8L 4WWKD 2I9TB 4PB9L 1QLFA 2BVUA 2R69L 3MUGB 4ODHL 1LEGA 2OSLB 3BEVA 3FMGL 3LOWA 4TQEH 3U4EA 5BRZE 3T0EE 3AU1A 2R2CA 4TSCL 2NTSP 3RWFA 2J88L 4UIMA 1RZ8A 3FMGH 3HNTH 1LD9A 3MOAH 3QUZB 3VE0B 3K8MA 3B9KD 2X4QB 2X2YA 2DLEA 3LRHA 3HLAB 3A67H 4QEGA 4WU7A 4K8RH 3GK8H 5E6ZA 2FYYA 4PBWD 5IW3A 4Z7UF 5EZOH 3TVMB 1DL7L 4P3CL 3UJIH 1U8OB 2Q7NA 4NRZB 2JJUA 4NKDA 3OKMA 1A5FH 4PJEF 4AIXA 3VU2A 2EE3A 1NMBL 1YA5A 2FX9L 4PJHF 3V0WH 3U36A 2ICEA 1J8HA 5ANMB 1BOGA 1KCUL 2OP4L 3QO0B 2FNBA 1S7TB 5EFIA 4LHUD 2WWMC 1GGUA 3IGAB 2YUZA 2D7NA 1JGDB 2AJVL 2OMBA 3I6KB 1U9KA 2OP4H 1F3DJ 3RTQA 5KVMC 2OTPA 3C5ZC 1EHAA 2AJVH 3OJVC 1A1MA 1FYTD 1PZUB 5DZLA 5IIEB 3P3YA 4NQSB 4J1UB 4U7KA 1HI6B 5GJSL 3LCYA 4Y2DD 3V0VB 4Q9RL 3U7YL 2MWCA 5JHDB 1CQKA 1IRAY 1S9XB 3BKJL 3QCUL 1IGJB 4HWNA 5GJSH 1ROWA 1VFMA 1ACYH 1MCLA 3KLDA 3L3HA 3NMEA 4HS8H 4JO2L 3MLTB 5KJRL 3BKJH 4J3VA 5ADPL 2DBLL 2HYMA 1UVQB 1DDHB 2PR4L 1WZKA 3TM6A 5JOPD 5KJRH 2YC1B 3T3PF 3FONA 3VMNA 1XF5A 4KK9C 2DYPA 1UJ3B 2FD6L 1KB9J 2DBLH 2VAAA 4C54A 2QL1A 4UOJA 2PR4H 4YXLL 5J8OA 1KJ3H 4YBQC 1S9VA 2ESVD 2FD6H 2GTWA 5LXGL 2V5TA 4YXLH 3BO8B 4P46C 3S3JA 4Z95L 3SDCA 2Y06L 4M5YL 4ZS6D 1A2YB 2GEEA 2BOBB 1U8PB 2Z8WC 1NEZB 1T7XA 2C7UB 4DZ8A 4XNMA 2QSVA 4Z95H 2Y06H 4M5YH 3KJ6L 3HG1B 2XT1B 3JTSB 3PP4L 1DCLA 1WFOA 1I9IL 3I3DA 3QZWG 4RFNC 3AM8A 1E0OB 3PP4H 3NIFE 1I9IH 4NYLA 1OLLA 4MDJB 2BZDA 5CZKA 4PRNA 3HCVA 1K8DB 1EO5A 4LSUL 2DWDA 1C5CH 4HEPG 5JO5B 1FAKT 3MNVA 3RL1A 3L3KA 3RY4A 2UVEA 5H37H 4PUBH 4TNWK 4YDVB 1QNZL 3B3IB 5CEYB 5TDPB 3ZZ1A 4E41D 3MJ7A 3WHXA 3HE7C 3VA2C 2EDTA 2FCBA 4OIBA 4IIQC 3C60D 5EU5B 2AQ1A 4D0DA 5F7HA 4C57C 3F7RA 1JP5A 1KCKA 1LEIB 4CW1A 4MS8D 3IS0X 4FQCH 2MCPL 3TO2B 4MMZC 4Q58C 3KLAA 1NFDE 4G8GD 4PR5A 3VG0H 1T1XB 1Z3GH 2CK0H 1JV5A 3VG9C 5IROA 2X4RB 4HPOL 5C9JA 3NA4A 4QF1B 3VFWA 5ELIA 1VESA 2NYYC 1EEYA 3DIFA 3DRTB 1X5KA 2E9IA 5BXFB 5IW6A 1JGEB 2VZOA 1W72H 2OYPA 3HRPA 1UXWB 5CBAA 3BESR 4ELKB 1OAXL 5EOQH 2J6EH 4LLQA 1U95A 2Z4QB 4Y0GA 4W4OA 5D7KD 2GT9B 2QR0B 1NGWB 4PRPB 4P23C 3GSWA 1ZLSH 3AMKA 2MPAL 3LPFA 1XR9B 3DOSA 4XNUL 1M71B 3S3SA 2X9XA 1PX4A 1CDBA 2LVCA 4DK6A 5DJYA 2MPAH 4LF3A 3GSNL 3EOAA 2QQNH 2AEWA 4WU5B 2FHBA 4GRWB 5AD0A 4MD0A 5MERA 3GSNH 3MSPA 3GMNB 1D3CA 2P45B 2VXUL 3BZ4A 4EJ1C 5IBTH 3U9PL 1XGYH 3G5ZB 1R3HB 4NO3B 4ZO8A 4LHQB 5T5NG 2ZOLA 1C12B 3GJEB 3KPQB 3DV4B 3G08B 3TBSA 4OV5A 3MACH 2ITCA 3GSXB 3MRCA 4GRLB 3O8XD 4ZDHB 1MREH 1MCSA 3RVTD 1JWMB 1OGAA 2PTUA 4JFEE 5SWSB 1A6UL 3CU7A 4H5SA 4XCYA 1KXTB 1QSEB 1T66D 5IVXA 4Y88A 3DX9B 1J0YA 2F58H 4L9DA 1A6UH 1B0RA 3BEWA 4O5LL 4L8DA 2IMNA 3WNMA 4PJBA 2VTFA 4XBEH 1QG3A 1MFEL 4RGNC 5FGBA 4XVJL 3C8DA 3DX6A 1AO7D 3O6FA 1FG9C 5DURB 3EO0B 1IFHL 4XXDB 5EZIL 4HWZB 1MFEH 4WO4C 2VUYA 2CUMA 3H3PH 5B39G 3LRSB 4YNYB 4ZTOH 1YPZE 3DVFA 1B0WA 5EZIH 4TNWF 2B0SL 5HYEA 5C07B 1NAMB 3HRZB 3I02A 3HE6B 5E7BA 1P4BH 3QFDB 2FWOA 3NOIA 4KRPB 5K33A 5EA0L 4WUUA 1A7PL 2KPNA 3UJJH 1FIEA 2XKNA 3LEVL 3LEXA 1N2RB 4N8VA 3D3VA 4IDLA 4IRSD 4HKJB 1U91A 3BN9C 3IDJB 2IGFL 1DANT 5EA0H 3KPOA 2C3HA 1FV1B 3RUGB 2XNAA 4LLWA 3Q5TA 4OAWA 1OY3B 3FQWA 1F42A 3CX5K 5D71H 3CSPA 1DANU 3I50L 4ENEC 4ODUA 5D1XC 1F4AA 2H45A 4S11A 4N8PA 5BO1L 2B7DT 2DM3A 2EDLA 2J8UA 1ZA6A 4YGVB 1KCRH 1Z5LB 1SJHA 1XGRA 4YFEA 3EYQC 3TA3A 1AIFA 3IDYB 1A3RL 1KN4L 4JFOA 1BVKB 4BZ2L 1AGCB 3MRBA 3LS5L 3QQ9C 5F7UA 1FVDA 1ZKAA 3PUCA 4RIRA 3EYFB 1A6TA 1SVCP 3SCMA 3BGMA 1T6WA 4ZNEA 3DVIA 5EDXA 5DK2A 4MQTB 5GGUA 2VDQL 4UTAH 1YMME 4LRIC 1R0AH 2XPGB 3CDCA 1TQCB 5ID0B 1R6VA 2C5DC 1XGQA 2A9ML 2DWEB 5BRZA 4FQ1L 5EOCJ 1CD1A 3QZWB 1S8DB 2ZUQC 3GMMA 5L6YL 3ALPA 3MLVH 5HHOB 3KPLB 5IQ7H 1MHEA 3SKNA 4FQ1H 3AAZA 3EZ8A 5JOEA 2AJ3B 4U1KB 3K74B 5DXWA 2YBRB 4IHOB 5DVNA 1X5YA 3IXTB 4QLRA 4U0QB 5DDHA 5EN2A 5TE6L 3LKRB 1KIRB 4A2MA 2VDOH 5E08L 3W9DA 5KSUA 5KOVC 1WV7T 1QFWL 1TJIH 5IMLB 1M05B 1HYSD 4AT6B 2FJHA 2H32H 1T5WB 3EFFB 3CFBB 2OQJA 2C1PA 4NRXA 1SEQH 1LK2B 3CXHK 4R4NC 5ECJE 1HWGB 1AR1D 1JGLH 2UWEB 4K3EH 1IKFL 1G6RB 2DI7A 1BJ8A 4EQ3A 1CDJA 3CDGB 5FYKL 4AENA 3BISA 1OWWA 5J06A 4RQQA 1IKFH 4JN2B 4JO4L 5TDOB 2FGZA 4OZGE 5FYKH 2BNUA 5FM5O 3M8OH 1WGOA 2DM4A 4X6BA 1IGTA 3V52L 1HXYA 4EI5D 4J4PC 4OJFH 2EYSB 4AYFA 1QBLL 1K8IA 1AKJD 3S4SA 1Y0LB 2R0ZL 1VPOL 3QUZD 1BZ7B 5HHQB 5T3ZH 5J13C 4JHBA 4TULH 2E7CA 1RJLB 3H9HB 2Y5TB 3RVXD 1A4JA 2VWEE 2HRPL 1FC2D 1J10A 3TVMD 1N64H 3VMOA 1I1AA 3V95A 4GW5B 5GS0D 2A9NH 4NQDB 4LU5H 4O2CA 2IPUG 1FFQA 4JE4B 1RUQL 3IDNB 3IKCA 1I9JH 3CFDB 2B5IC 5H35A 5KAQG 3IYLW 4ONHA 3FQXB 4GG6B 1RUQH 4HC1L 2AJUL 2NXYB 1D5BB 5DHVA 1PQZA 2IAMB 2PTTB 1ZSDA 1FBIH 1OW0A 1KXVC 4XCEB 5F3HA 1S7UA 3AS2A 5DR5L 1FJ1A 4M9PA 1A47A 3FRPA 2FH8A 1I3RB 4JFYA 4F2MA 3KYMB 4HH8A 2X05A 4YE4H 4NO0A 2DM2A 2XWJA 4U6YB 1LQSR 5EO1A 4NHUA 4FP8L 1FSKB 5F3BA 3LD8B 3O4OC 2UYLB 4JQXA 4XPTL 1ETZB 5HTSA 5JHDD 1AD9B 4U0RB 4TTDC 2ADGA 4MZ2A 4DEPC 3LKSB 1RZIA 2P5WA 5J56B 1PG7X 4XP4L 1H3UA 3QUYA 4I13B 5FUCE 5CINH 3MRPA 3D87B 5B39B 1HIML 1DVFA 3MRNB 1HCFX 3FTGB 5M94B 5DUML 4OCSL 1U8KB 3NPSC 3ZTNL 4HFWA 4FFVC 4WI6A 3H7LA 1Q0XL 1CFBA 3WV0A 1ED3B 1IAIH 5DO2D 1FVCA 5DUMH 2AERT 5C09E 1C7TA 3ZTNH 1TZIA 3OKKB 3LKPA 4NHCL 2A1WL 1I1FA 3O2WL 1CFSB 1NFDA 1FGNL 1PW3A 4ZFGL 3DMMC 3HNVL 4R97B 1S5IL 1ITBB 5SX5K 5E1HB 1U93A 3ZTJG 3D18B 4PY7A 2KDGA 4ZFGH 2EXYC 3HG1D 5HVHB 2P4AB 3HNVH 5HYJE 1MWAB 3L5XH 3HZKB 2ICWB 4NJ9L 4NUGL 5FDYA 4H0IA 2X4SA 5F89A 5D7SL 1P84J 2F8OA 4PJDF 3RZCB 3NBNA 5L7XL 5JIPA 4MZ3A 3VGDA 3MXVL 1T03H 3LMJL 4TPRL 1CIDA 1FNSH 5D7SH 4CU6A 1UXSB 1S9WA 1T5XA 5DQ9A 15C8L 2G60L 5D7LE 2OI9C 5T33H 1HOCA 1EVUA 4YX2H 3Q6FB 1A3QA 2VC2L 2WWKO 1DJSA 3R8QA 3V9FA 1YJDH 2V9QA 3C2AH 1KTRL 1NDMA 4HJJL 4Q6IC 4Y5XA 4DOHE 4X4YB 2HJKA 1M1SA 4PV9B 2W9EL 3O6LL 1Q9OB 3SDYH 1CLYL 4HJJH 1NH6A 2FO4B 3SDAB 1OAYH 1FHGA 5GRJL 4WFGE 3JV4A 5DMIL 3U48A 1SBBA 4JFEA 2YOCA 5A3ID 3FL7A 5I76B 2CDEA 5GRJH 4P57B 1N5YH 3CC5A 1BD2E 1YY9D 3N50A 3SKMA 4AY0A 4APQC 2HT4D 1BJ1H 3VCLB 4PRPD 1JHTA 5F71A 1PKQA 1TJGH 2VQ1B 4M6AA 4R26L 3SE4C 2AV1B 4MB3A 3DSNA 5DMYA 4NBYB 4XNYL 1YPZA 3U2SA 3BPCA 3BN3B 4M93C 3LSOB 3PJSA 2I9LA 3VWKA 3JZ7A 4X9BA 5M7QA 1DBML 1OPGH 3WFHB 3SPVB 5DMGD 4F58L 2R23A 3PV7A 1BJMA 3MFGB 4U3HA 3FB7A 4NZDA 5I8CB 3NCJH 5HI3C 3VJ6A 4F58H 4ODTH 4GRLD 3NFPA 1G1YA 4OKDA 4FQ2H 5DJAB 2PYFA 4GKZA 2A6JB 3CVHH 5SWSD 1BX2A 4KXZI 1QSED 1VADB 1VERA 1EMTH 4QRPB 4UBDD 5DUPL 4DN4L 4HH9A 1CGXA 3F7QA 1H3VA 5BOZG 2JKXA 5FV2A 1LMKA 4M5ZL 2R1YA 2GK0B 5IMMB 2AK4D 1AE6H 2NY4B 5DUPH 2IFFL 2IFGA 4NM4L 5DURD 4NO2A 5IB5A 3STLA 2J12B 5ISZB 4OUUB 2NW2A 2Y4SA 4AEHL 4OZIF 2YD3A 4XAKE 3HE6D 1NBYB 1MCEA 2XWTA 4E0RB 1QBML 1JHKH 2APXA 4L3EE 5DT1L 3B5TA 4AEHH 4KRPD 1AXIB 3OGCA 1WZLA 1FVEB 4G6KH 1FAIL 4N9OB 3TZVD 5SV4A 1WSST 3RU8L 1WISA 3MJ9H 4NPYA 2JJTA 4FXKB 1RSFA 1FGVL 4XCNB 4PGCB 3QNZA 5DJ6B 1UQSA 3CK0L 4QKXB 4YHZL 1JI2A 4NWTL 1FGVH 2D7PA 3HI1A 1DE4B 3CK0H 2CD0A 1QR4A 3PGDB 1JPFA 2Q76B 4JFPB 3RY5A 5FHBL 4HDIB 4OKVA 3HAEH 3FFDA 5IK3B 2IG2L 1HH9B 5GRVL 3PWPB 5ICXA 1TJHH 5BV7B 4L9LB 3VMPA 5D2LB 2FBJH 4DTGH 5FHBH 3O3BB 3WD5L 4NKMB 1C7SA 2VE6B 2IG2H 3P9MB 2R0WH 4P5TC 2WBJA 1VEMA 2Z8RA 1X5IA 4OZGA 2AJXL 2D31A 2EC9T 4ORZC 4GBXC 4UAOB 2V7NB 4YXHL 3VXRE 5IEKA 5KVFH 5I66B 2EC9U 4YR6A 4W4OC 1RZJL 2AJXH 3BP6B 5EU4A 1EEZA 2DOCA 3G6AA 4JFZL 1QR1B 5KN5A 5FYJD 1GL4B 1A7RL 3L5WB 4YC2B 3MLUL 3GFUA 3EYVA 4L8BB 1IM3A 2XG5A 5T1LB 4UZGA 5F88A 1N5AA 1E6JH 3W2DL 3SOBH 1KB5B 4JM2D 4C4KT 3SDDB 2FO1A 1C5DB 4M4PA 3ZYJA 2X7LB 3BD5A 4FFYL 3HZVB 2ZWLT 2CXKA 1A9EB 2D0FA 3IXAA 3RGVB 5FA4B 1A7OH 4Z7UB 2WW8A 2XIDA 3GSVA 4IOFC 4FFYH 1CFQB 3IDXL 2NY2D 2DQIH 2QSCL 1TVBB 2HKFH 3NVQA 5F97E 3WS6C 1SYSA 4FQXB 4AIZA 2EIDA 4YHKH 2H2SC 4PJEB 2VLJE 1BREA 3IDXH 3ZKMD 5I1HL 1EAPA 1JN6A 2QSCH 2ADFL 4HHAA 1GGIL 1LVEA 4PJHB 3H2WA 4P49A 2EICA 2VN4A 3T3ME 5BZDB 3RX8A 1NGQH 4JFHD 3F8UB 1IGCL 3JWDC 1Q9KA 4M1CD 2NY1B 1KPUA 2P8MB 4S2SA 3SBWC 1JF5A 1UH4A 5FO9A 2LAAA 3IS1X 2Q86A 4PJXF 3TPUB 4IMLB 1JYVA 4O2FA 3D6GA 1SBSL 5EWIL 1NCAL 4U6XB 4JDVB 3MOQA 3KXFE 2G5BA 4KJQC 4Z7WF 4YQXH 2VDKH 3PWUA 5FF6A 1YEEL 1P9MC 4FG6C 3DURA 1RJYA 3VXUB 2Z35A 3WE6B 1BGXL 3PP3H 2NXYD 5TQ0L 4QNPF 2IAMD 1EFQA 1YEEH 5C09A 3P73B 4F7CA 1DUZB 5EOTA 2V5RA 1WAAE 3K1DA 5TQ0H 5MEQB 1L7TH 3X3FH 1ZEAL 3AY4A 1G9NC 4JFXB 3GSUA 1WFUA 4B5EA 1T7VA 4KAQL 3CVIL 1X7QA 5DHYA 2FX7H 2BNQB 5HYJA 3BVNA 1ZEAH 1CR9L 1XF1A 2W65B 5F1NA 4XP9L 4U1LA 4WHYG 1DBJH 4KAQH 2V2WA 2BVTA 4N0FA 5IB4B 4LCCA 4E5XB 5J6HA 4ODSL 1E4KA 4JZOA 4LLVB 3JV6B 2BMKA 4P2RA 4OD1H 3VWJA 5EBLA 5E4EC 3MJ8A 1HHHB 5HYFA 4NFDA 2BY1A 3GBNH 5D7LA 1QEWA 4P3DB 3DXAE 1VFOA 2PUQT 3ULUD 4B0MM 4YXKL 2DQGL 4Y5VB 3RPKA 4IRJC 5GGSB 5JIIA 1ZGLB 5K9OB 4C56B 4XTRC 3QFJE 1F58H 4Y1AE 4MAYC 4ZFOB 1I3UA 2BNRE 2NY6C 4OF5A 3W9EB 2JCCE 1JRHH 4MA3B 4LOUC 2XYCA 1Q9LA 2V5MA 4X6FB 3ESUF 4XXCA 5CIPB 3RWGB 4Y4HC 4X0KA 4KRLB 5I0ZA 5CEXB 1F90L 3TJHC 1BD2A 1UB5B 3UAJD 1F90H 3VXQA 2APVA 5JW4Q 3QDGB 1T0NB 1E4JA 5HDBE 1T83A 2E7HA 5J12C 3QG6A 3QUMH 5C92A 3K0WA 4HGWB 4BZYA 3PDOB 4I48A 4D3CH 2EIBA 3QHFH 3K80A 3OZ9L 4POZC 3WNOA 2KBGA 4LIQL 1BFVL 4CKVX 4OV6F 4P46B 2ARJA 4FFZH 3BW9B 4X7TA 3QIWA 2FLRT 1LO0H 2VYRE 4HBQA 3SDAD 1FFPA 4DKFL 2QQLL 2R0LH 4RFNB 5GSRB 4ZFZB 5ICZB 1M6OA 5DI8A 1Y18B 3QRFM 4DKFH 5C0GB 3LKQB 2R2EA 3V6OA 1J0ZA 2HKHL 2BXYA 1HXMA 4KGJA 4PREB 4XC1L 3D85B 4NQTA 2OM5A 4PJ7F 4K3DL 2XY1A 3N1GC 3O9WA 5JORA 4HLZG 4JFQB 4MB4A 1FZJB 2HKHH 3GUTA 4ODBD 3PABA 4XC1H 3E2HC 4TVPD 3RWHA 4KJWD 3FT4B 4XH2B 4Y16A 2ZUXA 2SEBB 2M8XA 3C09B 1A9BB 3B9AA 3RAJL 3C6LC 4JQXC 3P9LB 5HHVL 1RVFH 4L3EA 3K81A 2APWA 5MEPB 3VG9B 5JQHC 1ZGLP 3KPSD 4PD4K 4Q9CA 5EC2A 3MNWA 1LK3L 4HUUA 1MCIA 1UT9A 3KPTA 4P2OA 5F72S 4HBCL 1OP3K 3RI5K 4PJIF 1FNGA 2B2XH 1NLBH 3FT3B 1LK3H 2NY5H 2ADJB 3MRJA 4MX7A 4JGJA 3W5NA 3PL6C 2UZYB 4JKPL 2W38A 1CGYA 3LN5B 4XBPB 5MENB 5DD6A 4TTGA 2E7LA 1KC5L 2G9HA 2MQCA 4P23B 4QRPD 4K2UH 1J87A 5FHAL 3O3EA 4N1CA 3MGTB 1T20A 4JPKL 2VUOA 4UIKL 1KC5H 2WINB 3D25B 1D5IL 2PETA 3V79C 4DVRH 3TN0D 5DC0A 2ATPB 2HMID 5FV1L 4Y5YA 4GW4B 5C0IB 3HR5B 1D5IH 1P4LB 4KMTH 1AQKL 1CDCA 4UB0L 2BSTB 5JMRA 4ERSL 3FB6B 2NTFB 5ISZD 1DP0A 2ENYA 3T04D 1MHCB 1HYRC 4JQVA 2DB8A 3OB0K 5JXAH 4W6WB 3FQNB 1AQKH 3PHQB 4UB0H 5ITFB 4K7PX 3RVVC 4K9EL 1KUMA 3B83A 3VXRA 3GMRB 4OBSA 1P7KA 2ILLA 3G9VA 2YK1L 4AEFA 2D2OA 4LLDA 3IFNH 1MRDL 5KZCB 3E0GA 1N8ZA 1Q8MA 4OFYA 4UUJB 4A2LA 5C0DA 4MAUH 4CJ0A 1X5JA 1BBDL 1BZQK 3X13B 4JO3L 3OAYH 1MCOH 1HILA 3ZE2E 1H3WM 1FO0A 2IPTH 1S78D 3VGFA 1CL7I 4RGNB 4HIHB 1PAMA 2Y07H 4UNUA 5I15H 3NIFF 1R5VA 1VFAB 3GI9H 4WO4B 3RNQA 4KI1A 2GTZA 4HWEL 1NSNH 1U8HB 1EXUB 1BVZA 3OR7A 1AH1A 3PWPD 1LO4L 4BQ6A 3NGBC 4FQJL 1G84A 1GPOL 4W81A 1QD0A 4YLQT 1UB6A 2VLJA 3GIZL 3K4DA 2VLKB 2NY3D 2BSRA 1U8LA 4ONFL 5HGHB 1OSPL 2GCYB 2H1PL 2HAZA 5CGTA 4BUHA 1I8KA 3QEGL 4ONFH 3IFOA 2HN7B 4J3XA 4BSVA 3ORJA 1OSPH 2A38A 2W0FB 5I1CH 3DX8B 4Z8FH 3WEXB 1HK6A 4PRHB 3NZHH 4K3HA 3MREA 5C0FB 5D1XB 4PS4L 4Y4KA 5GGQL 4YHYB 4JY4B 2BOCB 4RISL 5E8EA 4JVWA 1BFOA 4DVBB 1V7NH 4HMDA 4S1DC 2IPKA 3RI5F 2MKWA 5C70A 5T1LD 1YN7B 3U7WL 5D1ZA 2CQVA 4XVUD 4LCYB 1I9RH 4X83A 3RL2A 1VFUA 1ZXQA 4I18A 3SDDD 3L3JB 2VABB 2P7TA 3BZFB 1MLBA 2MCG1 3EO1B 2MSPA 2NZ9C 4HUNB 4G9FA 4IS6B 3RGVD 3E1F1 4XCFL 3VFUA 1KYOK 3RY6A 1ZGLM 4XI5C 3SO3C 1BP3B 1FZKB 2ATKB 2ENSA 2HG5A 4BH7B 2Z92A 2AGJL 4PJFE 4X6DA 4KTDL 2D0GA 1RUPH 3O2DA 2DN7A 3ILQD 1QLEH 5HPOA 2QQKL 4HMEA 3VFGH 3KPRB 1RZKL 3QIBA 2HA1A 5F1IB 2ZUQB 3QYCA 1A14L 4KTDH 2FATH 5C0AB 1SJEA 3BQUD 4PTUA 4IBLT 1HQ4A 4CRPA 5GZOD 3MCLH 5JTWA 2GK2A 5H2BB 5BOPA 3KYNB 1ZT4B 2FJFB 2NY1D 4FQIH 5FOBB 2DL2A 3SGEH 4GAYB 1QRNE 2FB4L 3QXVA 3G6DL 1MF2H 5D5MF 3S37L 4M62L 5GS0L 3LS4H 3ES6B 2BFVL 4XNXH 1FFNA 1MQKL 5KBNC 2R4RH 1T22A 4M62H 2CLVA 1GOFA 3MXWH 4NDMA 3TO4A 4GXUM 3DXAA 4OCNC 5DVMA 4M6ML 1U8IB 3DUSA 4JFDB 3DHJA 4PJGA 3LQAH 2F9BT 4TYUA 3VXUD 4PJ8C 3IKKA 4FRWA 2ZSWB 4OBRA 1RU9H 1I7UA 3BPNB 3QFJA 4LKXA 1ZANH 4WUKL 2BNRA 4XVSH 3LZFH 3TNMB 2G5RA 2DJSA 4YHMH 3B9DA 1U8QA 1GHFL 4WTWA 5D2NC 4GSDL 5L9DL 4HW6A 2BHYA 3ARPA 5J13B 1OAUL 4LPVA 3RDTB 2BNQD 5DEZA 3ZT5A 5E6IC 3KYOA 3PQYB 3ARDC 5IB2B 4GW1A 3DROA 3VI3F 5ITBL 4UTBL 1R24A 4R7NB 5CKAA 3AGVA 3RWCB 5KW9L 4C83A 4ZYKA 1A4KB 3OXSB 3X11B 4TSAL 2WBJC 1WZMA 2B5IB 3C9NA 1RZFL 5KW9H 3R0NA 1CCZA 4FNLL 1XF3A 3QPXL 4OLXH 4BQCA 3OTTA 4QYOB 4PJDB 1RZFH 3BP5B 3L5HA 1L9NA 3QULB 5DUBA 4ZD3H 2BX5A 4M43L 2WWMD 2OJEA 4D8PB 4YIQA 1QSFB 4TN9A 1NJ9B 1M7XA 2YN3A 1KACB 2NW3B 5MEOB 3OKDB 4M43H 1FLRL 4GAJL 2C3GA 1FN4A 2MQ0A 3P40A 3C5ZD 2VLRE 4Y19D 2VR9A 5H94A 2EDRA 32C2B 4OCXL 1VACA 1RK0B 3QCVL 4LEOB 3REVB 1QRKA 5JPMB 3F7VA 4O9HL 5JMOC 3L5IA 4DEPB 1NBVL 5B3JE 5LWYH 3QCVH 1RJZA 3VXNB 2MNUA 2WUBL 1L4IA 4O9HH 3HMWL 1NBVH 3QDGD 2VDML 4KJYB 3CZJA 3K3QA 4HIXL 4BA8A 1R3KA 1FYHB 5KSVB 4Q9QH 1GZQA 1YN6B 5I2IA 1JIBA 2YKLH 4PJCB 4KK9D 5FYKE 3NCBB 3K2UL 3NCYP 4ZO7A 3NPSB 2HFGL 1BQUA 4HIXH 1AFVH 4R4FL 1D6EA 1H3XA 1E4WH 1K5NA 4YBQD 4TUOA 2V7HA 3K2UH 4QRUB 7CGTA 2HFGH 1J11A 4I2XA 3GMQA 3BDYH 3QEQE 4G8FA 3EUUA 1F00I 3L3DB 3RPIB 5CEZD 1ZT7B 3B4NA 4P46D 5T3ZE 2N7AA 3U0WH 3DMMB 4OFPA 1IGFH 2G75A 3SE3A 3VFRB 1FRGH 2R1WB 1RZGA 4PJAF 4XCCH 1JMXA 2APTA 2YD7A 2Q7YA 4IMKC 5HY9A 1MLCB 1DQQB 5KG9A 4JPIA 3CCHA 1MPAH 3QNXA 4R96A 1PG7H 3BZEA 2APFA 4LCUA 3DUHA 4MJIE 5AWNH 4MJ5A 2ED8A 1QLFB 1R5WB 2BJML 3D85D 3UP1A 1LEGB 2OI9B 3BEVB 3QP3A 5IW1A 1QO3A 1DZBA 3U4EB 1BMGA 4UU9A 2EDWA 4UQ3A 3HE7D 3KWWA 3UTTE 2RHEA 4RRPG 3I85A 3S5LG 4MA7L 3G6JE 3KYAA 1D5XA 2GSIA 2ZUTA 4FZEH 4QWWC 1QHOA 3GHEH 1Y6MR 2D4FA 4DGYL 1FFOA 5C6TL 4GRWH 3HUJE 5LGKA 4XWOC 1E4KC 4RX4A 5BVJA 4GG8B 5F1SA 1WFNA 4PTTB 5C6TH 2NYYD 3MRFA 4U7MA 4PGJA 4OZIB 1E4XL 4WFEE 1F4XL 1VSCA 4WHTA 4YZFF 2GFBA 1J8HB 2EE2A 1E4XH 4OLVL 4APQB 4UT9L 2YD2A 5EFIB 5MEND 4JJHA 2B4CL 4JRXD 3JSSA 3DJ9A 4I0PA 4P23D 5FA3A 4F9PA 4Z77B 1ZT1A 4HEME 1R3LB 3NCFB 3RTQB 1S7VA 4JKKA 1ZLWK 1J0JA 1HH6A 4XZUB 1A1MB 3G5XA 1LNUA 5IR1A 3QQNA 4XXCC 4Z7OE 4M93B 4KHTH 4N8VG 4O51A 1U3HC 3IDMA 4K94C 4YGAB 4HK3N 2OR8A 3OHXA 5DJ8B 1J86A 1NAMH 1W72A 3JVGA 2GJ6E 5I1KL 2MFNA 3GMOB 1UYWH 2J6EA 3KR3H 3BAEL 3ZDZF 3RBSA 3O3AB 1NC4A 3MR9B 3FONB 1XF5B 5E5MB 1D9KC 4NNPL 2DYPB 2VXQL 5LCVL 5KZCD 1RZJC 3BAEH 4L1HA 4CL7A 2ZCKH 1MFBL 4KZEH 2DQTH 4NNPH 4I3RL 2GTWB 4RGND 2OBGA 3SDCB 4ZPTA 1NGZA 1M7DA 4MB5A 3NPZB 3RIAF 3GSNA 2K3TA 3CMOL 4M6NL 4QGTA 1KTDB 4RDQF 4JANB 4XNMB 4WO4D 4DZ8B 4MQSB 3VW3L 1T89A 3AROA 3CMOH 4M6NH 4NT6A 1AHWC 3IJYA 1I8LA 1B2WH 1RY7B 1F8TH 4PJFA 5TF1L 1EVTC 4M4RA 4LDOB 5TFSL 2XWBB 2VLKD 4PRNB 3HCVB 4Y8AA 3V6OC 2DWDB 4U6VH 4IEFB 3RL1B 3BN9D 5E94A 1KJ2H 1L6ZA 2XY2A 5TFSH 2PW2A 5DD1L 2Q8AH 5FYJL 4R8WL 3K4ZA 2YD9A 4MJ6A 5A43C 3QNYA 5T1KB 4YK4B 2ZOKA 5CJ8A 4ENED 3WHXB 4LLUA 4PRHD 1MI5E 5D1XD 5E5RB 1QRNA 1X5AA 4GKNB 4JG1L 4D0DB 4F9LA 2DF3A 1UCBH 1A64A 5JXEA 2XQBL 3ARGC 1A1OA 2P5EE 1RZ7H 1CFVL 3EYQD 3OJDA 1IE5A 3FN0H 3V5KA 1JV5B 3OAZK 2AI0H 3QQ9D 3BIKA 1JTPA 2OR9L 5C9JB 1CFVH 3VFWB 1JPSL 3DIFB 1G6RL 4PJXB 1B0GB 4ZNCD 5IW6B 2D7TL 4N0YH 4P5TB 2Y23A 5AYQA 5HYQA 1G6RH 4U3XA 1OAZH 3H8NA 2YPLB 1ZLUK 4LSSL 5CBAB 3S4SG 3CFKA 1T7ZA 4ZS7L 4LLQB 1U95B 3ISWA 3KPRD 3NA9L 3GSWB 5C0AD 5JA9A 4K7FA 4ZS7H 1YNTA 1X4ZA 1VGKB 1OQXA 3OAUL 4HAGA 1EGJL 5ALCL 4PJ5B 3EOAB 4G6FD 2EDFA 5ERWB 4EUPH 4M61A 4MD0B 5MERB 1YEFL 4EBQL 5ALCH 2DDQL 1FDLH 4AM0A 3QISA 4X5XB 5GIRA 3FB5A 3QUXA 2LFGA 5ABDE 3OB8A 2ZOLB 3S5LB 4OCLC 2DDQH 4M7LL 4ZXBA 4LLMB 1CYGA 3MRCB 5TE7H 5D4QA 4WY7L 1LEKA 3MUHL 1DEEA 3MLXL 1J18A 3VD9A 2X4PA 1OGAB 2YRZA 1TLKA 3MUY1 4ZPVB 4I0CC 4H5SB 4G6JH 4PRIE 1NGPH 5DZOA 3VFTA 2CRYA 1B0RB 3BEWB 4L8DB 5D9SB 2VLRA 4GLRH 5HDLA 1PJ9A 5JLZB 3VXME 4J4PD 2H32A 5BS0A 1OF2B 1ZHLA 1W0YT 1J0HA 2BVQB 2JJVA 1IGYA 4KKNA 1OP9A 2XN9E 3BKYH 1QOKA 4MNHB 3PQYD 4R90L 5GS2D 5FKAA 3TGXA 1KEGH 4QHKJ 1VFBB 3SKOB 1N7ML 2Z91B 2X6MA 2JE8A 4OCYH 4WUUB 3H0TB 1K4CA 4LASL 1N7MH 2XKNB 1J1OL 4N8VB 2O5ZL 2GUOA 2NX5E 4LVHC 3KPOB 3WNLA 3T1FA 2XNAB 4LASH 4LLWB 4OAWB 4JKWA 3FQWB 1J1OH 3ULUH 2M1KA 2FIRT 2NQCA 3PWLA 1YEKL 1L9MA 4NCC2 4ODUB 3QEQA 3QI9A 4G9DB 1QHPA 1VKXA 1QSFD 1TETL 1PZ5A 5C2BH 1OT1A 2XACC 2CR6A 4Z76B 2J8UB 1JF1B 1ZA6B 4LSPL 3SO5A 5JW3H 1NMAL 5D1ZC 3P30H 1V7ML 2DLFL 4OSUL 5CILL 4R7DA 1NCDH 4JFOB 2QKIA 3MRBB 1BZ9A 4L4TB 2DLFH 4OSUH 2W59A 2EDOA 5DZNA 1A6TB 4KGLA 3SCMB 3BGMB 4TTDD 1MWAH 1OT2A 3FO2A 4Z5RA 4NO5A 2X4UB 5DK2B 1F6AB 3MUZ1 1JI1A 2RR3A 3O3UN 4YFLF 5DSCA 2FEEL 2I5YL 5GRUH 5C8JA 1O0VA 1XGQB 3AFLA 3WIFA 4CDGC 5BRZB 1S7QA 1T0PB 4MQXC 1CD1B 1KLGB 1MH5A 4IRJB 5I1GL 1AY1L 3QXDB 4NN6C 4FABL 3AAZB 4FFVD 3N85L 3G6JA 4PJ7B 4KDTC 1I7TA 5JA8B 4MAYB 5DDHB 1DQJA 5EN2B 2NY6B 1L0QA 3MMEA 3RVUC 1DLHA 4O2EB 5ADOL 5KSUB 5JUEH 1Q94B 3HUJA 3DMMD 2V17L 3MRLA 1XZ0A 1JNNH 4LQFL 4H8WH 2FJHB 1ZV5A 2GITB 4L5FH 2OQJB 5D7IE 2Z31A 1SMOA 2O5XL 5L2JB 2EXYD 4PGBA 4LQFH 2R1XA 4Z0XA 4KUCF 3DGGA 3MTRA 4U6HA 4O02L 1TZHA 3QWOA 4JGMA 3VDBA 1PG7W 3BWUC 3LDBC 3ULVC 5I1LA 3TLRA 4HLJA 4LK4A 1J0KA 4PJIB 1AD0A 1XF4A 3QDAA 3I75A 4O02H 5K59F 4TVPL 3IJHA 5CJQH 3E6HA 3EDJA 2V2TA 2VR5A 1BM3L 3EOBB 2VQTA 1Y6NR 4X6BB 1IGTB 2FIKB 3CFJA 1HXYB 4PIRF 2H2PC 4TVPH 1Z9SA 1PY9A 1ULVA 1HWHB 1K8IB 3S4SB 4NKIL 1IC4H 1QLRB 3QAZC 4JN1H 1FYTE 1S9YA 1F6LL 5EUKA 4U1HA 1A4JB 5J1AB 1MY5A 2GJ6A 2WANA 4JQIL 4OLUL 5D7JC 4OIIL 2C9AA 1I1AB 4FZ8H 4LPXA 1OP5H 2IH3A 2EIEA 3NCEB 4O2CB 3MA7A 4X6DF 4K9EC 2Y5EA 5HJ3A 1T1YA 1GC1H 5AG8A 3IKCB 4JLRA 3EYOA 4ONHB 5F9OL 2PYEB 4U1GC 4J3OC 4QHUB 3NZ8A 5DHVB 1PQZB 1RURL 3MRMA 5JOPE 1ZSDB 4KZDH 2KZWA 5F3HB 4APQD 1S7UB 1AR2A 1W0WA 4PRAB 3BWAA 3F7PC 1RUMH 3E2HB 1JUFA 2ESVE 4GKOA 5F44A 3UROR 3RTQD 1U8JB 4NO0B 5F9WB 3FJTA 2XWJB 3WIIH 1NC2D 2ZSVB 3ARXA 2VXSH 1CBVH 1RPQA 3TH2T 5ENWA 4NHUB 2W0LA 5F3BB 4IDJH 5ACZA 3C6LB 5FCUL 4JAMA 2A74A 4ZUSA 3U46A 2ADGB 4D0CB 3MRHA 2P5WB 4PJGF 4U1SB 5BJTA 3EYUL 2W07A 1JF6A 5HGAB 3E3QE 3QUYB 2P44B 3ULVF 3MRPB 5HI3D 3ZHKA 4POYA 3EYUH 4U05A 5IFHL 1WWWX 2RQ8A 1X5GA 3ABZA 4LBEA 5IHLB 2P24A 2Z93A 3PL6B 1OAKL 4I77L 4GQ9H 3C6SA 2H26A 4HFWB 1S7SB 4E41E 1I85C 5KSBE 1FVCB 5HGDA 3NAAL 4OM1L 2P5EA 5LKNA 3WN5C 5T1DL 4PRBA 1F3DH 2A6KB 3PXJA 4LIQE 3C5SA 2BCKA 5CCKL 4LSTH 1U93B 4NKOA 4BH8A 3N1MC 5CP7A 2IALB 5BV7L 3VGGA 4G8GE 2PCPA 3UO1H 3I3BA 1S5HB 2AEQL 1UWXH 2JB5H 3I6GB 3ZDYF 5CKGA 2CIKA 4RNRB 4ONOA 5F89B 4KPHH 1WQVT 3CVHA 4R0LA 4Y7MA 3T2QA 1MIML 4JM4H 3CGTA 3ZTJH 1NPUA 1S9WB 1XFPA 1T5XB 5DQ9B 2QHRH 1MIMH 1UZ6F 3T4YA 5LQBH 3VD3A 5LG1A 1U36A 4L4JA 5D7KE 1HOCB 3FQUA 5C6WH 5T1KD 3ARYA 3O4LB 3RHWK 3M07A 4HS3A 4PJ9A 1Q38A 3CX2A 3U0PB 3MLYL 1MFNA 3T0BA 2I07A 4G43A 3LIZL 1KB5L 3RVXC 5D6DA 2HJKB 5I17A 3TIDA 3EDDA 4YO0A 3MLYH 1OVZA 2QEJA 3LIZH 1KB5H 2H6PA 5GS0C 3BP4B 2C3VA 4I4WB 3T2NH 2E9WA 4K7PL 5D5MB 3WXVL 3NGBB 2LTQB 3CZFA 1RMFH 3JV4B 4ORGB 2VSDA 4JFEB 1OL0A 3MJ9A 4WI9A 4NUJA 1N6QH 4K7PH 4P5TD 4PRIA 1QTYT 2CDEB 2Z0BA 4OLEA 3WXVH 4M6OL 1EO7A 5IFAL 1DQLL 2YPLD 3WSQL 2OZ4H 3SKMB 3QDMB 4Y89A 3VXMA 1IL1B 1B6DA 1JHTB 1PKQB 1NKRA 5HDQL 2GJJA 3UTQA 3X3GL 1AGBA 4YDLB 1HHGA 2CK2A 2IF7A 3MQIA 4XRCB 2XN9A 1C1EH 4HWBH 1AO7E 5EB9A 3HAEA 3BPCB 3CFCH 1E28A 1WWAX 3TJEL 1MSPA 4J8RA 4PJ5D 3V4PL 5DRZA 1P69B 2I9LB 2HFFA 4QTHA 3VWKB 5D1QA 4F7PA 2D9QB 1TFHA 2YRPA 3QG7H 1UM6L 1P7QA 1Z6JT 3FB7B 2NX5A 4LDLB 3CUPA 2EE6A 4PB0L 3O45B 3SO3B 2FZ3A 4IOFD 3NFPB 4YBLC 5DD5H 3A6BH 5JW4R 1YDPA 5JR1H 1CDIA 1OGAD 1EZVY 1ZA3A 2PYFB 4GKZB 2H2SD 1FPTL 4YDIH 4AL8H 3HC0A 4KY1H 4CADA 4E42B 2R4SL 3OPZH 4XPFL 4UNVA 4KKCD 1C16A 1LO2L 4HH9B 1FPTH 2X89A 3L95B 3ECBB 2A6IA 2UZIH 4Y4FA 4DCQA 2HRLA 2W9LA 4NO2B 5IB5B 3TV3L 5HVFB 1FQ9C 1C8PA 1E6OH 2P8PA 3KYKL 2CXGA 4EEEA 4WFFD 2DQFA 3LPWA 5DGRA 5SWZA 2XWTB 1DN0A 3RHWF 3V5DA 3OGCB 3KYKH 4WWKA 4WUUD 1KT2A 3T8XA 3U1SL 3K46A 1SY6L 3VGEA 4KJQD 4R4BA 4F7TA 3SKUD 1Q0YH 3VRJB 4FG6D 4NPYB 3HZMB 3U1SH 3N0PB 4WI2A 2PNDA 5LVEA 5IJVA 2MTPA 4X4ME 2M2DA 4DKEH 3GSRB 4MNQA 1TTGA 4ZFOL 3HI1B 4PLJC 4RMWA 3B9KA 3P4MA 4L3AA 3RIFF 3BYYA 4PRDB 1K9TA 5D2NB 3S88H 5F7FA 2VITA 1CFNA 4TNVK 5IV2A 3OBAA 4PGZA 1CZ8L 3QA3A 3FFCE 3FRUA 3QQ4A 3TC9A 3Q3GA 5DFTA 3FFDB 3ARDB 4L4TD 3V6FB 1YYML 1RQ5A 1AJ7L 3HI6L 3UDWA 4S1RH 2WBJB 2FECI 4PJAB 3QO1A 5LGHL 2D31B 1BQHA 3HI6H 1DQMH 1KJVA 1I4FA 4LHUA 3JTTA 5CJ5A 5IEKB 5LGHH 1G6VK 4YR6B 3PGFL 4HCRH 3QIUA 4X7EC 3BFOA 4IRJD 1FE8H 5KN5B 1CDHA 3LH2L 5A1AA 3MLZL 4XX1G 5DEGA 1FYTA 3PGFH 3EYVB 4XTRD 3KG5A 1IM3B 2EKJA 4MAYD 5CEZH 4WI4A 2NY6D 3MLZH 5F88B 1N5AB 4Y2DA 3CH1A 3JUYA 1U92A 5C0BB 3TT3L 1CXLA 5EO0A 5GISH 5EO9A 5DMGC 4X9GA 3WUWA 1R5IA 2YD1A 1CT8A 3EZJB 3GSOA 4Z78A 3TT3H 5IQ9B 5EIVA 3IXAB 3KLSA 2NPLX 3TJHD 4LPWA 3GSVB 3CXDL 5IEHA 1YUHA 2WZPD 2AEPH 5DLML 5KSAA 1M7IA 1YEDA 2ZG2A 3INUH 1SYSB 2VZSA 4CMMA 2NZIA 3V7AG 1JN6B 1RHHA 1EEUA 4HHAB 1F2XK 1QSZA 3MJ6A 5ANME 4OI8A 2ESVA 3NACH 4HV8B 2J2ZA 2F54A 5EOCH 2B4CC 4P5KA 1TDQA 5DJCA 4POZD 4M48L 4WEBH 2AQ2A 4KQ3L 4D0BB 1IM9A 1FNLA 4JDZA 1Q9KB 2IH1B 1A6AB 1K4DA 4OGYH 1NANI 3O0RL 5FO9B 2DKUA 3RX5A 4L8SA 5K9QG 5DFVC 4OM0H 2AJSL 5IT2H 3O0RH 4OCWL 5ID1A 4O2FB 1F3RB 2RIKA 4LARL 3ZE1F 5HHPA 5TDNA 5JHDE 2VIRA 3T77B 4LPTA 2DKSA 3QUMA 4J7RA 35C8L 5IVZA 4GXVL 1EHLH 4ZTPL 2J5LC 3QWRD 3K2MC 6CGTA 2XZCH 3DURB 4YAQB 3QQ3A 5FAAA 2PYED 4XMLH 2Z35B 4HXBL 1I1RA 3FO9B 4PGDA 1YMHA 4TNVF 4ZTPH 4E41A 5KSBA 4K23L 4YHNA 4F7CB 4F7EA 4CGTA 5EOTB 1PY4A 1EHNA 3WBDA 2AXFA 3C60A 4N0UA 2ORBL 5DJDA 1WLHA 3O6KL 1G0XA 4JFFD 4LPCA 1KTLA 1KULA 4G8IA 3IJSA 3GSUB 3HMXH 1U8MA 3UPRA 1X7QB 2IBBA 4KVCL 1ZMYA 1LDPH 3O6KH 4M7KL 4G8GA 5DHYB 2XZQL 5HYJB 3EOTH 3BVNB 4UV4L 5F1NB 4U1LB 1HNGA 5E1AB 1H0DB 3CFEB 2V2WB 1YQVL 3C6LD 5J6HB 3HG1E 3SE8H 3PWJA 4JZOB 1KJMA 5CGMA 1S7RB 2ZPKH 2BMKB 2P5WD 1YQVH 4KKLC 2CRIA 3CJJA 3MRIB 4LMQE 4P2RB 3VWJB 1NL0L 3MJ8B 5GGTL 2EKSA 1H15A 3KNBB 3BIAX 3P4NA 4ACPA 5D7LB 1NL0H 1JNJA 4XAWL 1G7JA 5GGTH 4IOIB 5AUMA 3PL6D 1BQLL 5E24E 1CL7L 1XR8A 2DD8L 1F4YH 3CPLB 3WL9B 1Y6KR 3MLRL 2ARWA 1BQLH 1BWMA 4HUKB 1IARB 3NCYS 3UCRA 3MLRH 1UH3A 1D5ZA 3HI5L 4KI5F 5AZEL 1KN2H 1RULL 1TENA 5DK0A 4FTVA 1KCSL 1H3PH 1AI1H 3HI5H 3QEUA 4ALAL 3RVVD 4DW2H 3VXQB 1KCSH 3PNWB 4NKQB 2WAHA 3QG6B 4ELME 1MCDA 2JJSA 2EDJA 4OI7A 4BELD 3MRKB 1CXHA 2HLAA 4M1GH 4I48B 5MP6L 4P2CG 5J0BA 1D9KB 3BH8A 4JZJA 2F8VA 3H42L 1NUDA 5B8CA 3WIHL 1HSBA 4MA8L 4PRPE 1KFAL 3O4LD 5EIQA 3H42H 1NCCL 4OD2B 4NC0B 4P9MH 3QDJA 4HK0A 3WIHH 3MBXL 2ARJB 1KFAH 2YPKA 2O26U 5IG7B 4X7TB 2OK0L 4GRWE 3J7HA 3LKOB 4JG0L 4AEEA 1AHWB 1FFPB 1YNKH 5FYKU 4OFKA 1HHKA 2V5YA 3TCLB 1ZVSA 4JRYB 3VA6A 3QPQC 5DI8B 3VXOA 1DQDH 1CU4L 4G80B 3A6CL 1KNOA 4QOKB 1XEDA 2ZUSA 3STZA 3HC3H 4UT7H 2VXVH 2Q8BH 2CO7B 2AAVA 1CU4H 5FUOH 5SWSE 3OMZA 4Z7NE 2CGRH 3A6CH 1QSEE 5JORB 3QDMD 4WV1A 2Y7QB 3PABB 1YJDC 3ZL4L 3RWHB 3VRLF 2HJLB 4HUXA 4XP5L 1FL6A 2AK4E 4L3CA 4TUKL 5IMOB 3LY6A 1CLCA 1DFBL 4S1DD 3LD8C 3QWQB 4WI3A 4Z7VF 2UWEF 3DTXA 5IHZB 4Z0BH 4HS6A 4HAFA 3P0VH 2NY0B 2VR4A 4U0RC 1TZGL 1DBKL 3JUZA 4J12A 5KVDL 3VDCA 2FJGA 2XKSA 1NFKA 2NZ9D 4S1SL 5EC2B 4J6RL 1TZGH 5GS1A 3WLBA 3SGKC 4LAJH 4XI5D 2VZ3A 1FNGB 2Z9TA 1OD7A 4FQLH 1NCWH 4X4MA 3MRJB 5DYOA 2AJZB 4NCDA 4HG4J 4P3WA 4XC3L 3RUGE 5DD6B 3PWNA 3EYSH 1N4XH 3S34L 3MGAA 5CFHA 1CE1H 3AMLA 2AXGA 1WT5A 4HKBA 2ITDA 3S34H 4LP4A 1X9QA 4GMTH 3FFCA 4M9OA 1KELL 1TCMA 1IC7L 1R3JA 1TTFA 1TPXB 1OB1A 1EV2E 5HVHC 5GXBB 2VDLL 4Z18A 2VXTH 2GHWB 5CLWA 5GS2H 1P7HL 3E6FA 4NSKB 2ZUWA 5KS9E 3RZCC 1WC7A 3L3IA 5J57B 3I3EA 1QP1A 3KVQA 3HR6A 5T5NF 2O5YH 1P7KB 2CR3A 3REWB 25C8L 4JCMA 4MQ7A 1EJOL 3MUGA 3SQBA 5C0RH 2J4WL 4DAGL 4UILL 4OGXH 4U1JA 4LLDB 5HVWA 4PJ8D 3DO3A 4K55A 25C8H 1GGCH 3WS3A 4EI5A 1EJOH 3BDBA 4OQTL 1IAKB 1KG0A 3BP7B 4DAGH 1OTUC 1HILB 3N9GL 1AKJA 2YSSA 3IB4A 5FYJE 3VE0A 4MDIA 4LPYA 1MFAL 2X4QA 4X7SH 3MYJB 2D4DA 1R5VB 3RNQB 3TVMA 3U9UA 3V8OA 1U8OA 3OKOA 3SDAC 1MCJA 2WP3O 2AXJA 4RA3A 5EU7E 3DI2B 3VFVB 3ARDD 3NFSH 3EO9L 4HUVB 1CN4A 3LN4A 3NN8A 4WTZA 2L7JA 1UB6B 1DLFL 4N1HB 2BSRB 1U8LB 2WBJD 5DEFB 2J3SA 3P0YL 4KRNA 1CF8L 5GRVK 5ANMA 2YEZB 3TFKC 4LVHB 3QO0A 4TRPL 4BM7A 4DQOL 2F8XC 3IFOB 3IGAA 1HHJA 4BSVB 3QEHA 2XRAH 4Q9BA 2VJXA 4BKLA 1K2DA 4TRPH 3R1GL 3MREB 5B38G 1CDUA 5IOPA 5E8EB 3R06A 1SYVA 2Y6SC 4JFHE 5HGBA 5IIEA 5DQDH 3R1GH 4JCLA 4UQ2A 6FABH 4NQSA 4J1UA 3EBAA 5D1ZB 3TBWA 3RL2B 1RHFA 3BE1H 5C0BD 4MD5A 1IT9H 5JHDA 4I18B 4MXQC 3MFFA 5DJXA 4XMPL 1S9XA 4PPTA 1RIHH 3WJLA 1EAJA 4KC3B 2P7TB 2IC2A 3OKEA 4HT1L 4Q7DA 4G9FB 1NGYB 3FN3A 4X98B 3VFUB 5EU6D 1QBAA 4HT1H 5FGRA 1FNEB 4OZHE 2FGWL 1UVQA 4G5ZL 3C08L 3IRZA 2Z92B 4X6DB 3ILPA 1UJ3A 2MJWA 2WNGA 4GG6E 2MMXA 4G8EB 2HVKA 3OG4B 3QIBB 4IRZL 1J7VR 4JR9L 1HSAA 4PTUB 2NY4C 4UDTA 1CIUA 3PDGA 2CKBB 4OLZL 4QO1A 4RWYH 2MKLC 1X5ZA 1A2YA 1NEZA 4WGVB 2VDRH 2D0HA 1DTUA 1MJ8H 3HG1A 5GRXG 4D9LL 3VFSA 4P9HL 3B8YA 1KLFA 3FOLA 1FFNB 4KUZL 8CGTA 1CG9A 3MBEC 5L88H 4OCRL 2CLVB 1F4WH 4NRYB 4NDMB 3TO4B 1EDQA 1AGDA 3U4BH 1KCVH 4MWFB 1BJ1J 4PJGB 2BSED 3FKUS 4BFIB 3TNNA 4UINH 5D6CA 3ZKND 5GHWL 3LDBB 4G3YL 4YDVA 5F9AC 4LNVA 3D69B 2DIJA 4U1NB 4NZUL 1SJVA 1I7UB 3PP3K 3ULUE 3O3DA 1HCVA 4LEXL 4LKXB 1F13A 5E2WL 4MXWL 4G3YH 4M3JA 2BNRB 4HKZA 1UKSA 2X4OB 5C1MB 1WWCA 3MLWL 1A6VL 1OCWH 4NCC1 5B4MC 1U8QB 1G0YR 5GGRY 1YECH 5SWQB 3TH4T 1JZ2A 1QZ1A 3WFCL 3QAZB 5IGXH 5HYJD 2DIBA 4KRMB 4JPVH 2ZG1A 4QWWD 2OJZH 3KYOB 4UNTA 5BV7C 1KPVA 2X4RA 4L9LC 1A7NH 1F3JA 4QF1A 1AXSA 2XG4A 4GW1B 2O61A 4P59L 3DRTA 1R24B 3CLEH 3QRGL 2BDNL 2X41A 4C83B 4XWOD 4ZYKB 4ELMA 4NZJA 4ZAKA 3Q1SH 3UDWC 3K8LA 3SGDI 3UPAA 3HFMH 4P59H 4P2RD 3VWJD 4XPHH 2EIZA 4UAOC 3WXWH 2X4TA 3WFBL 4KDWA 1CFTA 3DRQA 1XF3B 2Z4QA 4F37K 2OTWB 4PRPA 1KBGH 2ZG3A 5DUBB 3WFBH 3GJFH 4GMSL 4WTXA 3D0LB 5CWSB 1XR9A 4YC2C 1M71A 3GRWL 2B20A 2OJEB 1IQWL 1FLTX 4OF8A 3GRWH 1ZWIB 4QRRD 1LILA 3THMH 3BSZH 4PBXA 1VACB 3GMNA 1LE9B 1U3HD 5E03A 2YWZA 5CD3A 2QADC 2K7QA 2WMPA 4QXTB 1WBZA 5HHMB 1H9VA 3D0VB 1PLGH 3F7VB 3O6ML 3SDXF 1YEGL 1C12A 4PG2A 3GJEA 3KPQA 3DV4A 3G08A 3UXFA 1TITA 3W0WB 3GSXA 1HEZB 4GRLA 1RJZB 2QSQA 3QJHA 5KTEH 4FQXC 4LCWD 5KSAC 3HPJA 5SWSA 4LAQL 3MOBL 4HJGA 3EDFA 1QSEA 3DX9A 3AUVA 1CVRA 1I3GL 4G7VL 1D9KD 1PEZA 3SGJC 2VLMD 4BK4A 1FFRA 1IEBB 1D6EB 2GI7A 4S1QL 3ZKQD 2AK4A 2W9DL 1WICA 4TUOB 2W60A 4TVPE 4YDJB 4I2XB 3GMQB 4G8FB 4XXDA 4HWZA 4P5MA 2E5EA 4MXVF 3LRSA 4YNYA 1YEIH 1XIWC 2OL3H 3NABH 1QFHA 1INEH 4WCYH 4F15C 4HXAH 5KVGL 2VISA 2G75B 1NAMA 4QHLA 5B38B 3PWVA 3I9GL 2Q7YB 5HY9B 4JY5L 3KPSE 5KG9B 4QCIA 1LP9F 5CJBA 2XQYK 3TZVA 4HKXA 4JVUA 1N2RA 3QNXB 4JRYD 4NIKB 5JNYA 3IDJA 2XZAL 4RBPH 2KH2B 4LCUB 1BEYL 4QOKD 1T7WA 2EH8L 12E8H 4D9RD 1BVLA 1IKNC 5KOMC 4PB9H 2Q6WA 2R69H 3S98A 1T6VN 4U2YA 4ODHH 5IW1B 1QO3B 2EH8H 4KKBC 4FOMA 4QRPE 5ACLA 4UU9B 1ZLVH 4N0RA 1CICA 3HNSL 3KWWB 4YGVA 1Z5LA 4TSCH 2J88H 1L7IL 4NQEA 2GSIB 2VDNL 3SEPA 1G7IA 3B8SA 3HNSH 3JV5A 5EH1A 1BVKA 3F5WB 4CVXA 3ARGD 1FFOB 1NBZA 1L7IH 5KS9A 3P77A 2NY0D 4WI5A 3DO7A 3EYFA 4F37F 5ISZE 1DL7H 2A0LC 4P3CH 5ESQA 3CSYA 1MCKA 5BVJB 3RBGA 2R29L 3MRFB 4M8VA 4K07A 2XPGA 1JNHA 1KJ2A 5FYLL 5DF0A 2DWEA 2QLVB 3S97C 1NMBH 4A6YB 2GFBB 4OZ4A 4Y5VC 3UBXI 4CJ1A 4WW2A 3WFZA 2FX9H 1S8DA 4PYGA 4YHLL 4G6ML 3QXUA 3KPLA 1KCUH 2AJ3A 3HC4L 3H9SA 4U1KA 3P2TA 1BAFL 4IHOA 3JWDL 4I0PB 2QSTA 2CDGA 1ZT1B 2YHGA 4G6MH 4I5BB 4L4VB 1TMCB 1KIRA 1S7VB 4DN3L 3UTSB 1HH6B 1BAFH 4JM2A 3JWDH 2HVJB 5IMLA 3G5XB 2YUVA 3M1BA 5FKPB 4X6EA 3D48R 4AT6A 1QKZL 1T5WA 3CFBA 2E3VA 4O51B 3MV7B 3O81A 3IDMB 5IKCA 4X5WA 2F53D 5DRWA 2JELL 2UY6A 3OHXB 4ZOBA 3V7MA 5K9KB 4Q9RH 3U7YH 4QTIL 4WRLA 5T5FL 4AEIL 2E6QA 1W72B 3PWPE 1G6RA 3KAAA 3QCUH 5IWLA 5D2LE 4P4KA 5IMKB 3ZHDA 1V05A 4JO2H 4YBLB 4MHHG 3SQOL 5I8KL 5ADPH 1NC4B 1ZOXA 3LKNB 1DBBL 4JZJC 3T4AA 1PKOA 4BK5A 2DTML 1MCRA 5I8KH 3BZDA 3MV9B 3MV8D 5C6PB 3ZYZA 4RAUB 1G9NL 4LSQL 1OM3L 3OAYK 4QXWA 1OHQA 4M1DL 3DNKA 1XAUA 5LXGH 4EUPA 2P8LB 1RJLA 1G9NH 4I1NB 4J2XA 1J1XL 3H9HA 1OM3H 3CFIC 4HPYL 3MRRA 4F33B 1T4KA 4GH7B 1ZAGA 4X6CF 4XB7A 4GW5A 5ETUA 3KJ6H 3D39D 4NT6B 4OZHA 3IDNA 1P2CA 3OXRB 4GG6A 2EO1A 4Z7UE 1YY8A 2PN5A 4WI8A 1AGFB 1D5BA 1PYWB 4PGEB 5EPMA 4KUCD 4LSUH 2JJWA 3TYGL 5I8EB 4XCEA 4PJEE 2PW2B 1GXEA 1RIVL 5DC9B 1B90A 3EHBC 4MJ6B 3QNYB 5JW4M 3UJJL 1MCWM 2X4NA 1QNZH 2ZOKB 5I0DA 4PJHE 4LLUB 2VNCA 3WFEL 1RIVH 4WJ5A 2VOTA 1QRNB 5A2FA 2WIMA 3C09C 5BW7A 4F57L 1FH5L 1K3IA 1H5BA 1A1OB 5D1ZD 3EAKA 2MCPH 5IJKC 3OJDB 3V4UL 1A6WL 1GGYA 3V5KB 4Z6AT 4W68A 4XP6L 4G9FD 5BZWA 4HPOH 4QY8A 4XP6H 3X12A 2ZCHL 4GRMA 9CGTA 3QJFA 1N26A 3VXUE 1AGEB 3BRDA 1OAXH 4MQXD 2YR3A 2AW2A 4K7FB 3OKKA 1F5WA 4EDWL 4NFCA 4KVNL 1KEML 1VEOA 1CFSA 3T3PE 4JO1L 3ZKXB 4XNUH