5I17B

Crystal structure of human germline antibody ighv1-69/igkv3-20
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
216
Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 216
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i17B01
4MXQD 1I8KB 1R3KB 3SO5A 1IC5H 3GO1H 4KJWD 3FQRB 3MA7A 3HI6H 2GSIB 3MLZH 4PREB 3BGMB 2AV1A 2QR0B 5F3HA 1IC7L 3WS6A 4DAGH 1A22B 2B4CC 4MNQA 1IEAA 4RGNE 3ARYA 1IC5L 3B9KC 3GO1L 4F7EA 1DBJH 1PKQE 2BXZA 2VLJB 4G8GE 3HI6L 4S11A 3MLZL 3D9AH 1U8QB 4HT1H 2BY2A 2IGFL 4F37F 2RFXA 3AM8C 1WGOA 3NCEB 4OLEA 5HGBB 4UU9B 4JZJB 5ESAA 4XXDA 4XZUB 1QSFD 3VGHA 5FM8A 2FHBA 2XG4A 4HT1L 5JDSA 4WWKB 4B50A 2ZUWA 4LCCA 4GXUM 1S7WB 3S4SG 5D5MF 1NGPH 5IMLA 1D5BB 1MI5E 4QNPE 5I0ZA 4M62H 4UT7H 4TUJB 5DD6B 1G7LB 4PJ7E 3V2AR 5DMGC 5IEKB 2GJJA 5MEQB 5JLZB 1QTYT 4PLKC 3RZCA 3U9UB 2N1KA 1YEFH 5DJCB 1NGPL 2EIZB 4RGND 2YD4A 4MMZC 4M62L 1GGTA 4P4KD 5T5FH 4UT7L 4G8GD 2UUDH 3I3DA 8FABB 2EC9T 3EDDA 3SDAD 3V5HB 5E2TH 1KJVA 5CBEB 5D1ZA 4BFGA 3ARFB 5GQBA 1YEFL 3UJJH 1UG9A 2C3XA 4Y8AA 1H3VA 1YYMH 5T5FL 4L8CA 3FQUA 4FFVD 4OZGF 2V2XA 1NDMA 1K6QL 3LZFL 3TESA 5E2TL 1VFAA 1B4RA 3EJYD 3UJJL 4M6MH 5T3XE 4PP1C 4KMQA 4P5KA 1KLGB 4ZUUB 1HHGA 3BX7C 2VR4A 4Y8DC 3TJEH 1YYML 1FGNH 2P7TB 5CGMA 4Z5RB 5ELIA 4PJAE 3K8MA 3GK8H 1CDIA 1I7ZA 1UYWH 2W9EL 4FQ1L 1VA9A 2B2XL 2ZWLT 3MJ7B 5FA4B 1FO0B 4U6XA 3BW9A 1R24B 4K23H 3TJEL 2VDQH 4FQQB 4OCSH 2ILLA 3HE6C 4U05A 4QXGH 2K3TA 2J6EH 2YPVH 5SX4H 3GK8L 3KVQA 3IDGA 1B9ZA 4R90H 3FRUB 3LDBB 4ZNEE 1UYWL 1YN7B 4H0HB 4OQTH 4OZFA 3P9MB 4P5MB 2RGSA 2HN7A 1G7HA 2VDQL 3T0EA 4WFGE 3EOBA 4QXGL 2F53B 1JK8B 2AQ3A 2YPVL 1YPZA 5AEAA 4BUGA 1I7TB 3IJYA 4R90L 4DZBA 4L8DB 2R4RH 3ESUF 2NNAA 1EAPB 1KCSH 5T3XD 1ZA6B 4XP5H 2AJSL 5EO0A 1KTLA 2UY7A 3GHBH 1TTFA 3X3FH 4QRPA 3C09C 4XCYB 4LGPB 3HNTL 4XVTH 4S2SB 4HKJA 1MCIA 2R4RL 2YA1A 1KCSL 3C6LC 4X4YB 1KLFA 1QSFB 1S7XA 2APFA 5EBWB 4LSDA 1QFUH 3EJZC 5TE6H 3R1GH 4H26B 3GHBL 1FHGA 4ZS7H 4IEFB 1JP5A 2DIJA 4XVTL 5CEZE 4PD4K 3WFDL 1BF8A 5TE6L 1QFUL 5KAQF 4WFGD 3O2WH 4ZS7L 2D7TH 4XNUH 5F96H 4IIQB 5F89A 4M1DH 4U1MB 2W60B 5ACMA 4U6YA 4RGNB 2PNDA 1IEBB 3MV8D 2DLFH 1RUKL 4P4KB 4K2UH 1ZGLP 1PKQB 4G8GB 3FCTA 3EYFA 2DLHA 3UTSA 3SDAB 2E7HA 2BMKB 3O2WL 4I0PB 1ACYH 3NIDF 5E8PA 2D7TL 4JDZB 4XNUL 1GJIA 1G7PB 1U8KB 2FH8A 2DLFL 1S3KH 4HX1B 1WTLA 4K2UL 5JO5B 4YE4H 1AC6A 4KJPD 3FZUD 2M26A 3IU4H 2GJ6A 1P7QA 1S7UA 1QR1B 3NFSH 4NQCD 1T1WB 2YD3A 4CMMB 3FN9A 1MI5B 2GHWB 1KC5L 1PX4A 2Z8VC 5D71L 1K4CB 5I73B 4PJ7B 1FV1A 3QXWA 4YE4L 3MRNB 4HG4J 3IU4L 3VFVA 3PGFH 3MGTB 1MFEH 5D1XA 3NFSL 2BHUA 2ZJSH 4PJ8C 4GS7C 1P5VA 2VERN 1B0WA 4ZUVB 2AXFB 3RWJA 4IHOB 5D1QC 3QEHB 4OFDA 4PJGA 1KB5A 4XT1C 3PGFL 1MFEL 3QWRA 1OWRM 1ZLVH 2EECA 1ODAA 1GOGA 1C16B 4H0GA 4XNMA 1INQB 4HUVB 1WLHA 2AI0H 4YXLL 1AFVL 3LMJL 3HUJE 4L3EE 4KJQD 5FB8A 5JOPD 1UZ6F 5HHXH 4OKVA 2FEDC 4YHIB 1T3FB 3R06A 1EEYA 4LRIC 4PJ9B 3NFNB 1I1AD 4G8FB 5L7XH 2FH6A 1C5CH 4AL8H 2AI0L 4OFYD 4PJAB 5HHNA 2V9RA 1VGKA 1FZKA 5MENE 3VDBA 5HHXL 3KGRA 3UJIL 2EIDA 2V5TA 5C6TH 2D7NA 3FQTB 4PRNB 3CC5A 3BDYL 3RVTC 1M7XA 3WJJC 2V5YA 5IHLB 3T3PE 1J88A 5L7XL 4YBLC 4AL8L 1UWEH 3FAXA 3VXTB 4WUUE 4HH9A 3C08H 5T3ZL 2DWEB 1ZV5A 3EYVA 4Z7UF 1GGIH 4RBPK 12E8H 4F37K 3V0VA 2D4FA 5IQ9A 4EKXA 4L3ED 3QZWB 4KK9D 3L95B 3O45B 2QQKH 3DYMA 1K4DB 3JTTA 3C08L 1DSFH 3C5SA 1CD1B 4P99A 4IM8A 1UGNA 3LKOA 4NOBA 2AJ3B 3RL1A 5CS7A 3VXRD 3A67H 4CVZA 1JPSH 12E8L 2C3VA 4JFEA 3OPZH 5MEPA 5KSUA 5MEND 2X4UB 4URTB 2PTUA 2QQKL 3W0WA 2RR3A 1DSFL 3MACH 2OTWA 1A47A 4BSVA 2YOCA 3B9KA 5GGSY 3A67L 3Q3GA 1JPSL 3VXQA 4YZFF 4WUUD 1LVEA 4NQEA 3QNZB 1MHHB 1YEHH 3MACL 4IRSA 4ZO8A 4LSPH 4XTRC 4KRLB 3BQUD 1MLCB 5HI3C 3KPNB 4HIHA 4L3AA 3F7VA 3P73B 5D5MA 4M5ZH 2FB4H 3WIHA 4MHHI 1R3JA 4KV5F 4S0SD 1CIDA 1JGEA 4AEFA 3MRQA 1YEHL 3UTZB 4LSPL 2R9HC 3O41A 5C2BL 4NKDB 1NGXB 1W8OA 2CRIA 2VZOA 1LWRA 4L8SC 4PRPA 2FB4L 4OCRH 2FSEB 1MH5A 1WV7T 1VADA 2NY1D 5K59F 2EDLA 1P4BH 1RHHB 3DGGA 1WFTA 4JLRB 1AP2A 3NFPB 4QYOB 5JR1H 2GSGB 3BRDA 1FL3A 4LP4A 2WWKO 2V7HA 3B8SA 3QFDA 3UYRH 1Q94A 1DTUA 4OCRL 4TUOA 4CJ0A 5DHXB 3GI9H 1F6AA 4JFFA 1I1AB 2FJGB 3A6CH 4RGOH 1NCDH 5E5MB 4DFIA 2R0KH 2QBWA 4XNZB 2O93L 3VWKC 3BAEL 4F57H 5L0QC 3LIZH 2AJVH 3SDXA 1NPUA 3UYRL 4G8IB 4HFWB 3PABA 3JV4A 1KJMA 3GI9L 3A6CL 1NCDL 1B3JA 2R0KL 3MRCB 4KROD 4HJGB 2I27N 1AHWC 4Y88A 1PQZA 4RFOL 3QA3B 3LIZL 3K2UH 3MLYL 2H32B 5ALBH 3RWFA 5HYSA 4EN3A 5C0AA 3O6KH 4ZDHA 1IM9D 1JHTA 2P42B 4HKZA 1FBIH 1MHEA 3GZKA 1MAKA 4B7IA 5C0DA 3AB0C 5BS0A 1T7ZA 4ZUWA 4N5UA 3WO4C 3HUJB 3QZWG 4L3EB 4ZNCD 3DHJA 3K2UL 1RUMH 5ALBL 4I3SH 3WS3A 3O6KL 4TVPH 2JCCE 2NR6D 1FBIL 4LNVA 5GIRB 3V4UL 2F5AH 1NEUA 1OB1B 4PIRF 1YMHA 4IRJC 4PY7B 5MENB 2LE9A 4F9LA 1WBXA 2G5BA 2IPUK 3LOWA 1D6EB 5D93B 4DOHE 3L1OH 3V52L 4I5BA 2F5AL 4APQD 3ZLQC 4ALAH 1GVIA 3WV0A 2BFVH 2NYYD 4NQDE 2WBJC 3R0MA 3FOMA 4WUUB 4H25A 2NY5L 1NGZB 5F21B 1U91B 3L1OL 3OR6B 1JF1A 3KR3L 3ZKND 5EOCH 1UWXK 3STZA 3N85H 3C6LA 2XXCB 3FFCA 4ALAL 3TPUB 4KU1A 4NO5A 1HDMA 1OWWA 1QP1A 3ES6A 4OZIF 2PETA 1ED3B 2P46B 3D48R 3N85L 3TCXA 3QEQE 4N0RA 1R5IB 4YHNB 4WHYH 4NQXB 3JBG7 5ISZA 2Y72A 5FGRA 5H94A 5FOBA 1NEZA 2JJTC 3U82B 3RKDC 2AJXH 5HI4C 3EOAA 4JANB 1N5AB 2ZSVA 2EDHA 5ENWB 1OW0C 5EG6C 1EJOH 2PCPB 3HC0B 4KKAD 1D5IL 4XP4L 5T1LD 1J87A 5E56A 5FGSA 4H8WH 3I3BA 5IEHA 4Z76B 4AY0A 1GGCH 1Q9WB 1BBJA 4NO2A 1H3TA 1OP3H 3CH1B 1EJOL 2EDBA 5LCVH 5IW6B 4GRMB 1I75A 2HYMA 4NO0A 5IJKA 4H8WL 1IMHC 1HQ4A 4KROB 1GGCL 4N9GA 4UDTA 4O2EA 4WV1B 2I60H 3ULVE 1FN4B 3PP3H 1CL7I 2X44D 4PJBE 2XKUA 4NKQB 5LCVL 3TBSA 4OLWH 2IAMA 4PJ8A 3RVUC 4P3DB 3SDCC 1AR2A 3IDJA 4ENED 5IBUB 6CGTA 3E6HB 2I9LB 5HPMB 4POYA 3BGFB 5D1QA 1PLGH 2EXYC 3TBYA 4NNXB 4JGMA 3S3JA 4OBSA 4NQSA 1T0NA 1JUFB 5DWUH 4K8RH 1KPUB 2OTUB 3FO2A 5KOVC 3S6CA 2CLZA 3EDFA 2NY6B 2EEBA 4D0DB 4ZFOL 3BEVA 1UCBH 3SE3C 3OAZH 2G9HA 3Q6FB 3AS2A 1T1XA 1T89A 4P2RA 2YUWA 2NW3B 4K8RL 5EUOA 3DV4B 1HKFA 1EZVX 5EBMB 3GJFB 4YGVB 2WIIA 3W9DB 3HRZB 43CAB 5C0CE 3IDYB 3U30B 1UCBL 3MBEC 5E94B 4K3JH 5IB1B 1OTSC 1IZKA 4PBXA 3TBTA 4G7YH 3KYMB 1UQSB 2P8MA 4U1NA 5FUCC 2VIRB 4EI6A 1JGLL 5FKPB 3WJJA 2JIXD 5GRVL 3IS0X 1PDKA 4Q9BA 5D7LE 4RDQG 4F7TB 1XGYH 5BVJB 3BXNB 3MV7E 3U48A 2JCCB 1X5YA 4Z7UA 5LKNA 3QAZC 4NRZB 4G7YL 5HTSA 3PWUB 3DVIA 32C2B 5L2KA 4HK3N 4MQTB 1S9KC 4X6EA 5ERWB 5IROC 4HMCA 3B9AA 3BHBA 4FMFA 1OP5K 2VKWA 1TQBC 1XGYL 3TH2T 4ODVL 3OKYA 1VFUA 3CFJA 2AV7A 4DOHB 5TE7H 3VFUA 2NY0D 3I75B 2Y25A 4GQPH 2DJUA 4NQTA 1P53A 5FHAL 3EAKA 3BUYB 4NQDB 2B4CL 3QH3A 4KKNA 3NMEA 4C54A 2H6PB 2IBZX 1F13A 3PGDA 4JQVC 5K9KB 1N2RA 3NBNA 3HNVH 2G75B 2ZCLH 1J12A 3VXUE 5I19H 3MC0A 4U3HA 1DQQA 5B38B 3OKEA 1T83C 3X13B 1NFDF 5D7LD 3K4DA 2CIIA 5JPNA 1R3HA 1NAMA 3MV7D 5C0BD 4XPGH 5F9WC 2YC1B 4YH6A 2ZCLL 5FECB 4XB8A 3HLAA 5I19L 4HH8A 3QEQB 2VABB 2E9IA 3BP7B 4KDTC 3WSQH 2AS5M 3FT4A 5HGDB 1ZLSH 3QDME 1CG9A 4ODXB 1F6FB 4BKLB 3RWHB 2QHRH 4XPGL 4OV5A 3ECBA 1N6QH 3WSQL 1YN6B 4NDMB 4M6OH 4ZMAT 1RZKC 2XXMB 1OD9A 1ZLSL 2N7BA 1UFUA 5DQDH 4L8SA 2FJFB 3FMGL 3DPBA 3U4EB 4O02L 2HJFA 4GMTH 1PEWA 3PWVB 4XNYH 4FQCH 2A2QT 1QPXA 3QUKA 2MHAA 2IH1A 2Y5TB 3BKJH 5HDOA 4DCQA 3IYLW 4M6OL 3T8XB 3RNQB 25C8L 3N1FC 5HI5D 5I30H 4LKCA 3HS0B 1BOYA 3DXAE 2JB5H 3EW3B 3NACL 1NDGB 2DBLH 4V1DD 3NA9H 1CXKA 2V5RA 3U9PL 2C3WA 4GMTL 3VJ6A 1MFCH 2CKBL 4XNYL 5T5NG 3KXFE 4U1JB 3BKJL 3VWKA 1RY7B 5E5RB 3QDMD 4NNYB 4PJBB 2HFFA 4ZUTA 5C0IB 2JB5L 1OY3B 4TTDD 5SV4A 3CPLB 1XGRA 1J05B 1LP9F 5CP3H 2DBLL 3NA9L 2W65B 4DEPC 2JIXB 4M43H 4O2FB 2X4NB 1MFCL 3D0LB 4H20H 1O5DT 4CJ1A 3O2DH 3O81A 9CGTA 3UJTH 3H0TB 3KNBB 4JRWA 4U6HA 3EO1B 3HN3A 3QSKB 4X99B 3CFCH 4KWUA 4QRSB 2UUDK 3RGVC 1EEZA 1BREA 1WZ1L 5BV7H 4A6YH 4M43L 1JWMB 5F1IB 1CDYA 1UH3A 2V17L 4H20L 4X0KA 2HJLA 1N6VA 1EAJA 2P8LA 4WI5A 3GSOB 5J4MA 3K80A 3UJTL 1GIGH 2NY0B 3FRPG 1FC2D 3DXAD 5CSBA 3HRPA 5D7KE 5DJ2A 1U58A 1P4LA 4PYGA 4W4OC 4U7KA 4JGUA 5BV7L 4A6YL 4CVWA 3LSOA 4PP2B 4PJEA 3SGDH 3KXFD 5C0CB 3ARGD 4IRJA 5I1CL 3V8OA 3C6SA 2A9MH 3J7HA 5DJ8A 5DO2C 5D9SB 5ID0B 5GHWH 1XEDA 4BA8A 1P9MC 5B38G 4K3EH 3NH7H 3MRHB 4PJFE 4TRPL 5D7LB 1B0GA 1INDH 1IBGH 2AABL 2KL6A 1XIWD 1A6AA 3MV7B 4FABH 1F4WL 2WBJA 4KH2A 1ZT7B 4LLYB 1FL6A 3BKCH 5GHWL 4YX2H 2WIMA 5FCSH 4OI8A 2W07A 3U0WH 4KI5C 1INDL 1IBGL 3UPAA 1FORH 2F8VA 1ZSDA 1Z2KA 1Y6KR 4HS6B 4FABL 2FRGP 4OZIA 5HHPA 4KI5F 1S7QA 1YUHB 3PHOA 4JHAH 3ZTJG 2AJZA 3DO3A 4NCC1 3BKCL 5CHNA 4BFIA 4YX2L 4X4XB 5HYFA 3T77A 1AXSA 2OI9B 3OKDA 2X9WA 1NBYA 4I2XE 3U0WL 4YHKH 4XPTH 3BP4A 1FORL 2NY7L 3L9RB 1LEIB 1QO3B 1ZHLA 3VXUB 1EFXB 1QLFA 4GJTB 1MOEA 2JJTA 3BPNC 2J6EA 4RQQB 3RFZC 1J18A 3DX7B 2ARWA 3MRPB 1NFIB 5H2BA 3K4ZA 1DLFH 4YHKL 1G7IB 4XPTL 1OW0A 3QDJA 4OQTA 1A1MB 4P57A 5F7YC 1CXLA 3L3JB 4PRBA 2DN7A 1BZ9B 2KQMA 5GRWA 3ZKXB 5J9PA 1B0RA 3ZDZF 2FCBA 3MROB 1DEEB 1DLFL 2DLGA 4X6BB 1EX0A 2X70A 2BERA 5FYKD 4KUCD 5EU3A 3R0NA 3OHXA 1A9EA 3D3VD 4YXHL 3RGHA 3GBNH 1QRNE 1DANT 4NGHL 5CUSH 5GGQH 3MRRB 3VGFA 3VI3F 1NANH 4M7ZB 2YUVA 4D8PA 4OZ4B 4NZRH 1FG9C 1QBLL 2ITDB 3NIGE 3WNPA 1S9VA 4MNGE 1I4FB 4JPIA 3QUXB 2DDQH 5CUSL 3G6JF 3DXAB 3CMOH 3R8BB 3BISA 1CTOA 4DVBA 1FNGA 3QUZC 3OKLA 3UYPA 3GSVB 3KXFB 5HYQA 3MFFA 4XNZC 5HXMA 3F12A 1PG7L 2HKHL 3P4OA 1INEL 5EH1A 3HHRB 1NCUA 5CIPB 3ULUE 5IM7B 4GRLA 4HUUA 5EWIL 1HHKA 5IB3A 4OI7A 5GGSA 2XKNB 1NSNH 1QRND 1C12A 1XIWB 5MERA 4XWOD 3P77B 4S1SL 2CR3A 1D9KA 2O26U 4JREB 3UCRA 4GRWH 1XF3A 3TYFA 4LVNB 4R4ND 4CMHB 4FG6C 4FXGB 4Y5VB 3IXAA 1S5IH 1RK0A 4P2QA 3SOBL 1QFWL 1PZ5B 4KPHL 1NSNL 3E2HC 4X8XA 2YXFA 2ZKHH 1SEBA 3RWGB 1WEJH 3X11B 2OBGA 5D7IF 2GI7A 2LV4A 1KT2B 3MLPA 1YY8B 2HTKD 1GAFL 2Q8AH 1BJMA 4WEMB 3LKRB 2C1OB 3C9NB 3QXDB 5I76A 1W2KT 5TDPB 1S5IL 3OX8A 1Q38A 3MZGB 2OJEB 1JYVA 5E24E 4WWID 2H8PB 3VRIA 1WEJL 3PGCA 1CLZH 2EYTB 1AE6H 3ZKQD 5D4QA 2W9LA 3ULSB 3DUHA 2Q8AL 4KC3B 4GUPB 4QHLA 4L9LC 4K7PY 5CEXA 1N3NA 2BVPB 3T2NH 4F33A 2OMBA 1LE9A 3EYOA 1BLNB 4PJFB 3PF2A 5FYLE 4WCYH 2WAHA 1A0QH 1UH2A 1I1FB 1A6UH 1CLZL 5I8EB 1AE6L 4KUZL 3KHQA 4JQVA 1K2DA 4MJ6B 4Z7OE 4CNIA 5B8CC 3IFLH 3FQXA 3T2NL 1P69B 3O6LH 2XZCH 4U1IB 1KUMA 1MHCB 3IDNA 2QSTA 3VMNA 1WCBA 4R97B 5T1MB 1T83A 1VKXA 1WAAF 1XF4B 1A6UL 3RWIB 1EMTL 4I18C 4BJLA 4PRDA 3KPLA 3CU7A 5E00B 4P49A 1RZJC 4ZFFA 4I2XB 2XZCL 2CDGB 4HK3J 1TQCC 4KDTA 2EDQA 2PYEE 2QADD 1V7NH 3O3EB 2NX5E 3CCHB 1I8LC 3KPPA 1Q1JH 5DC0A 1MCHA 5CJ5A 4L4TA 5D7JC 3KLSA 1YEEH 3OXSA 1AD0B 4YDJB 3GGWA 4LPVA 5F1NB 1J1OL 1U36A 5ACZB 4Z0BH 5FYLD 4M4PA 3ME0A 5CD3A 1V7NL 3GMQA 3OXRA 3T2QA 1BD2D 1Q1JL 3L3GB 1R5WA 3LKSA 3QDGE 4W70A 3U7AA 3TNMB 3CZFB 5LQBH 3CXHK 2HFGH 1IGJA 1IL1B 1XCQB 3PWNA 3EGSA 4QF1A 4XX1E 2EH7H 3W81A 3PV7A 5F88B 2HH0H 1AGEB 5FFLA 3OF6D 35C8H 4OD2B 5IBLC 3V5DB 3J8F7 1WBYB 3L5WA 3WFCH 1KULA 1QRNB 5LQBL 2ZOKA 2HFGL 1X5AA 4UQ2A 4LL9A 3NN8A 3SO3B 4WV1C 1GC1C 2EH7L 2VLME 2PYED 3P4LA 3L5XH 5DK0B 3VH8A 2NX5D 2HH0L 5KVEH 1EFQA 35C8L 2NY2C 5ID1B 4ISVB 4U0RC 3CDCA 4MNGB 5D6CB 3VGAB 1T4KA 2DM7A 4X9IA 2VXTL 2XRAH 5TQ0H 3QXAB 1OGAE 5C0GB 3FONB 1QQDB 3VFRB 3BO8B 3L5XL 2E7MA 4RNRB 1BIIA 1I3GH 1ADQA 3GMMA 5DHYA 4LHJB 2Z0BA 4WI3A 3B3IB 5JQ6H 3BD5A 2ERJB 4HWZB 4NRXB 4WJ5A 5A2JH 1QACA 4M00A 2E6QA 3HE7D 1IQDB 2A0LC 5DC4B 5CCKH 4J1UB 4NZDA 3O8XD 5JW4Q 2R23A 1I3GL 4G8EB 5BVPH 2LU7A 3CFKA 2J2ZA 4HKXA 3S3SA 1HZHH 5JQ6L 1A6PA 2VN4A 2YZ1A 2B1HL 4ODWA 3LS5H 1JTPA 1JZ7A 2VLMD 1NC4D 4HUWB 4HUNB 3OAYK 4LBEB 4RX4D 4MA1B 3MCG1 4MVBC 2NXYC 3BESR 3U0TA 4TN9A 1W0WA 1P9MA 1HZHL 4P2CG 4ONHB 1OGAD 2IBBA 5DRXB 2GTZB 2OR8A 1FDLH 2VXVL 3T4YA 4NKOB 3V7AE 1NBVH 3MMEA 1HCVA 4Z95H 5EFIA 1K5NA 1QEWA 4DGIL 4F15C 2QADB 2X4RA 5DEGA 3DSFH 5EZLA 3MUGB 2HT4C 1V7ML 3AREC 1FDLL 1LO2H 3FN0H 4NC1E 1MQKH 4L8BA 5A3IC 1U3HC 3WUWB 4Z95L 4QRQB 4OM1H 3MUJA 2P1YA 4XVUD 2XQBL 1PVHA 1G7MB 3GSWB 5C08A 3ROOB 3QWOA 3DSFL 4L5FH 4N1CA 2MOVA 4NZUL 3QEUA 4LLMA 3FN0L 1LO2L 1U8HA 1MQKL 2EDJA 4OF0A 4NZJA 2I9TA 2NW2A 5FF6B 2IH3B 3JWDC 2DWDA 2XACC 5D96B 4OM1L 3MRDB 5CZXC 2DQIH 2VLKE 4WW2C 1I9JL 4L5FL 1CF8H 1QPPA 4EI5A 5CSZB 4WW2F 3HR6A 3C5ZB 3RWDA 5E70A 3I6LE 5HD8D 5JXEA 2EE9A 1MELA 4GKZA 1QLRB 1S7RB 2PYEB 5EPMA 5KVFH 4K9EC 1J0YA 2NX5B 2CKNA 3HMXH 5DRNA 2SEBA 2ZNWA 4MCYA 1E4XL 4ETYA 1FFNA 4MX7B 4UDUA 1N8ZA 1A14H 2X4TA 5B22A 1YECH 3TO4C 3CUPB 5EIVA 2BX5A 4MSWA 1U8NB 1J0KA 3TNNA 5KVFL 2AEIT 3HMXL 2R0WH 3P2TA 2XY2A 4XAKE 4EVNB 5KVGH 1RU9L 3QDGB 1A14L 2UZYB 4NQUA 2VLRD 1YECL 1IAMA 4KKLD 3D2UA 3HE7B 3RWEB 2D7QA 1ZHBB 2V2WB 4JFPB 2VLKD 4ZXBC 2R0WL 3F5WB 5F93C 2NLJB 4Q6IB 3LV3A 5GXBB 1CFQA 2WWKT 4N0UA 4HXAH 4JZNB 5KVGL 3HMWH 3IVKB 2H1PH 5EZJA 1URLA 1B2WH 2DOCA 2OXGA 2BVYA 3QUZA 4O2CA 1FFRA 2R1XB 3TN0B 5FKAA 2ICES 3R4DA 4AYFA 1FO0H 4YHYC 3PXJA 3IFOB 1FG2B 1IILE 1B2WL 5EBLB 1I1YB 1NL0L 4PJBF 4P48A 1PYWB 3W5NA 3PP3K 3LHPH 1OGAB 4Y4KC 3BP5B 2EZ0D 3IFPB 1DQDH 1DDHB 1VB9A 1LO3H 4YHOH 2X4SA 4XAKD 1MVUA 3DVNB 2APTA 3T65B 4HV8A 1T04B 4K55A 1PEZA 4KXZI 2EYRB 2BK8A 5CMAB 5D7IA 1CFTB 2XN9E 2IFFH 1A4JA 1DQDL 4XGZB 2DQEH 3ZDYF 2J5LC 2L7UA 3HZVB 3U4AA 4CDGC 4I77H 4CRPA 2XQYG 5D2NE 2VKXA 3V8CA 2Z31D 4XH2A 1KB9J 2JLLA 5C70A 4HZLB 5E95B 3VRLE 4PLJC 3OAZK 4WI7A 3Q0HA 5ANME 2IFFL 2DQEL 1SJHA 3MREA 1XH3A 1T22B 4JRYA 4H1LB 3UMTA 4L3CB 4Q2ZB 2GK0A 4I77L 5KSBE 1J0ZA 5K93A 1IAKB 4OGXL 2PR4L 4JN1H 4L9LA 3CSPA 4M8QA 4LSTH 4YHMH 3V6FA 2WLYA 4Y4HD 2Z8RA 2A6DB 4NBZB 5GISL 1TFHA 5LGJB 5ETUB 1JGUH 2X10A 1MFAL 3BZ4B 3UPRA 4JJHA 4JN1L 1EERB 4AMKH 4FXKA 2VXQH 4WEUD 5DI8B 1UM4H 1ZLWH 5B8CA 2EXWC 3QIUA 4ZOBA 3RDTB 3V6OC 4YHML 2JB6B 2XN9D 2VZVA 3ZTNH 4RGMC 4PJDA 1QRKA 4JZOB 2Z35A 4I18A 3S5LB 1JGUL 2ICWA 3PJSB 1AIFA 3NVQA 3B6SB 5E6ID 1AGCB 4Z7VE 1TCRB 1A6ZA 1NCWL 1LO4H 1R5VA 5DMKB 4MXWL 1F4XH 2QSVA 1CDGA 5IMOB 3ZTNL 1I8LA 5JHDA 4LPUA 3VW3H 3MLSH 1TTUA 3RUGF 4J8RA 5D7JA 1BQUA 2ZOLA 1XF1A 2RQ8A 4L4VA 8CGTA 2VLKB 1YC7A 4PTTA 2D0FA 3V79C 1F4XL 3LEXA 3FO9B 4FZ8L 3LKQA 5GGVH 3VW3L 4HAFA 3TA3D 4JKLA 1X5JA 2X4OA 4HDIA 5IR1A 1AY1H 3IU3B 1A9BB 3FT3B 3WL9B 3O6FD 3KPMA 4LLWA 2GFBA 1QKZH 5F3BB 4PG2C 3MCLH 3PXHA 4YGAB 3SCMC 1T1YA 4YPJA 2OR9L 1DUZA 5GGUA 3VFWA 5EUKA 3PG2A 3IT8D 4POZC 1JPFA 1AY1L 3LN4B 3SEPA 3DMMD 3MOBH 4X9FA 3BKML 1UADC 2DMCA 5ADOL 3KLAA 3WHE0 3MCLL 1OTTD 3NCCB 4KMLB 1MCPH 3T3MF 2FWOB 3MV11 1G6RB 4UBDD 4P0DA 3WEXA 2FX7H 1FNEB 5T3XH 1P1ZB 3VFMA 3NCMA 2VE6A 1HSBB 2DD8H 3LQZB 3U4BH 1N5YH 1EHNA 4XMLH 5ICXB 1U8LA 4G5ZH 2DRUA 4GKNB 1BQHG 1II4E 3P0VL 3GJEA 4KJYA 3QJFA 2A6KA 3H9YA 4XHJC 1GGYA 4M7JH 5IB5A 4XVJH 4H1LG 5T3XL 4BZ2H 3F7YB 4Y19E 1BEYH 2DD8L 3U4BL 1N5YL 2BRRH 1JGDA 1H8SA 1WJ3A 3BH8A 4V2BA 4K7FB 4LDEB 1LNUB 4JN2A 4Y2DC 3V6ZB 4G5ZL 5B4MD 4H5SB 3S3PA 3B2UC 1HH9B 2YN5A 3HI5H 3QHFH 4Y4HB 3V7AG 1KSRA 4M7JL 2GUOA 4XI5D 4BZ2L 3RX5A 2I5YH 4Q58C 1BEYL 2BRRL 1EBPA 5GGRA 3QO0B 2YPKB 2EDXA 3H7LA 4G6KH 3QXTA 3L3HB 5HVHB 1D5XA 1KCRL 3OJMB 1CE6B 2XN9B 2VMFA 3HI5L 1ORSA 2X7LB 3I02B 4LMQI 5I6XB 3L5JA 1WK0A 3S5LG 3PNWA 1T2XA 2OLDA 5D2NB 3LY6A 4RIRA 4P2OD 4LCWE 2BC4A 5L8LB 4N0CD 3ESVF 5GS1A 3CDGA 2GIYA 4HXBH 4CN4A 5L2JB 5DDHB 2R29H 5ANMB 3VFOA 4BQ6A 1J11A 3A6BH 1OAXL 4GKSB 2Z4QA 3SDDD 5BOPA 4Y19D 3GMPB 5CP3A 5HHOE 5F1OB 5E03A 5J12C 4UIKH 5KSBB 2Q76B 4WY7H 1MCKA 3MV9A 2IQAA 1T03L 3O2DA 3ARBD 5E7FA 5DF0A 3ILQC 5DZOA 1NAKH 5CEZH 3NPSC 4HXBL 2ED7A 4LEOA 4ODUB 5TDNB 5BJTB 1YEJH 3N0PB 4MD5B 2FX9H 3QI9C 1AXTL 4ZPTA 3TA3B 4UIKL 3N9GH 4WY7L 1DQTA 5EO9A 2VISA 3MOAL 5KG9B 4UTBH 2WUBH 3E8UH 4FFYL 5CEZL 4YHZL 3T1WA 1EUUA 1Z9MA 2FX9L 4YBQD 2L0DA 2R69L 4LKXA 2BCKA 3HAEG 4LCWD 4Z7VB 1HN1A 4ZODA 4UTBL 1HNFA 3KS0H 1J10A 5C0RH 1MREL 4YAQB 2J8UE 1QFOA 2IADA 3X14B 1CK0H 2AXGB 1X5ZA 3VD9A 4KKBC 4IMKC 3ARTA 3MGOA 3TO4A 4ZO6A 5AZEH 4CN6A 2FJHB 3DX9B 1IKFH 1IGMH 3HZKA 3GUTA 3G5ZA 1T5WA 4RWHA 2ICWI 3KLHD 2CDFA 1J8HA 4E41A 5HDBE 4NN7B 1G7QA 4PJIA 1NBQA 1AKJD 1IGML 4GBXC 3UXFA 3K1DA 2UV3A 2J1KA 1GSMA 4Z7QE 4UIMB 2XTJE 4CW1B 2H32H 4LCYA 3EHBC 3JTSA 5JOEA 2MKWA 3C60A 1REIA 5JW5B 3NABH 1IGFH 3HZYA 5L9DH 1E28A 2UWEF 1ZGLA 2VL5B 4LPYA 3QFJE 5D2LA 2BY1A 1E4JA 3DUUA 5F8RC 3SQOH 3GBMH 3NABL 1D5MA 2DQTH 3PHQB 3WIIL 4DN3L 3ZE1F 3WIFB 4YC2B 1XF2B 1HWHB 1IGTA 2X4QB 3GMLB 3DUSA 5MEOB 1MCOH 3ELAT 5HGGS 2I25N 3SGJC 3GBML 2HKFH 4N0YH 3MOQA 3BYYA 3SDDB 1SJVA 4MNQE 2DQTL 4Y19B 5GZOD 1JNNH 4LLAA 4JJ5B 4UOW1 3MJGX 1L4IA 2DJSA 3ARBB 3ARWA 3GIVA 1IM3B 2XTJD 1MCOL 3RNKB 1JTOA 1HI6A 2HT3D 1W0VA 4PGBA 1OARH 5DLML 3O9WD 4N0YL 3LQAH 4WO4A 2R2HA 1NUNB 4M9PA 2Z93B 4HLZG 4WEBH 3QFJD 2EDRA 1KLUA 1K8DB 3TZVC 1VGEH 3MRFA 4KK6C 2ID5A 5CWSB 5FOJA 4Z78A 5T3ZD 3QJHA 1OARL 3LS4H 3BWAB 4HC1H 4LVOB 2HLAA 5CD5C 1RZIB 3IETB 1E27B 4NQVB 4WEBL 3K0WA 4OUOA 4LCWB 3SDYH 4QHUB 1ONQA 3TT3H 1AD9A 2WWMC 4XP9L 4PJXE 3LS4L 4MXQC 2UZIH 3QNXB 4RZCA 4HC1L 4YHPB 3V6OA 3VWJD 4C83B 5HHOB 3RZWA 2ZCKL 3TJHD 1BWWA 4NP4L 5BXFB 3QIBB 1DQLH 2NY3D 3TCLB 4B53A 2VQUA 1F11A 3REWA 4OCYH 2ARJA 3AMKA 3SDYL 1J0IA 4HIXH 3TT3L 4F7PA 3QUMB 2CMRH 3REVB 1OVZA 3MRJB 1BJ1J 3DO7B 1JN6A 4GG8B 3RUGA 1S7SB 2Z91B 4BH8A 5DSCB 1HOCA 3MXVH 4JFOB 3SPVB 3FTGA 2JJWA 4MJ2A 4OCYL 4KQ3H 2XYCA 4YDLB 4U1LA 2VQ1B 4F7MA 3H6JA 3GSUA 4UB0H 4PGEA 1MCQA 1U0QA 2G2RA 1KJ2B 5FDWA 3L7FB 3MXVL 3G5VA 3I50H 4IRZH 3DX8B 3OGCB 1OGTA 3S36H 5IMMB 4GG6A 5KANI 1JNLH 5BOZG 2Q86B 5TFSH 2J8UB 4UB0L 1JV5B 3QIWB 4ZFGH 4PG2A 1PZUB 3V5KB 4ZAKB 2ZUQC 4AM0B 1U8IA 1MUJA 3SCMA 2WQ8A 3KYAA 3CD4A 1YNTA 4YWGH 1PSKH 4LSVH 5FO9B 3I50L 3ETBF 3QUYD 1RZ8B 1T20B 5BW7C 1KCLA 4AEHH 3S36L 4I0KA 3WNLA 3VXNA 2FEEI 1AO7A 1JNLL 3FJTA 1B88A 5D1ZD 5TFSL 1UVQA 2PTTA 5GS2D 4E0RB 3SGDI 2VDPH 5ESVA 1QHOA 3T0EE 5DRZA 2J8OA 4YWGL 1PSKL 3AMLA 4PRHD 2CXKA 5FK9A 5A2LH 2KBGA 5E9DA 1E6JL 3HCVA 4AEHL 4R7DA 4QTHA 2YXMA 4D0CB 4R3SB 3MUZ1 4U31A 3D0VB 2QQNH 3G04A 4U1HA 2XTJB 2VDPL 4QTIL 1BPVA 1VACA 1L0QA 3O9WB 5B39B 4QRPE 3MXWH 2FZ3A 3VXSE 5LXGL 3TFKD 1XGUA 1DVFC 4ELKA 3QFJB 4XCEA 4MCZB 4JY4A 1F4YH 4XNXH 4QCIA 5IGXH 1JJUA 3MXWL 4U33A 4QRRA 1ZS8B 2BOBA 1A4KB 2VDKH 3WN5B 2W1NA 2Y4SA 3AROA 5DVLA 3SE9H 3CFDB 3SGEI 3MA7B 1FFOA 2QSQA 4TUKH 3BWUC 1A7RH 1F4YL 5HHME 3T0ED 3MRKA 2AV1B 2XZQH 1A3LH 3WFBH 5F3HB 5IGXL 5FHBL 2NXZC 3S4SA 2A6IB 4MNQB 3VWJB 4QHKJ 1IEAB 3EFDH 2VDKL 3AU1B 1IFHH 4F7EB 2NY3B 2BOCA 1CFVH 4TUKL 4LLQB 1A7RL 4RAUA 3SJVE 3UTSE 4JQIH 4PJHF 5HHQA 2R4SH 2XZQL 1A3LL 3WFBL 2RFXB 5JIIA 1F3DH 2P24A 1IGYA 5FUZH 1RQ5A 3EFDL 3QDAA 4RA0C 3VXSD 5ESAB 2R1YA 3MLWH 1CFVL 4GAYA 3GI8L 3V7MA 5DEZA 2GJ6E 4JQIL 5JDSB 5KS9F 1KXTB 4LCCB 2R4SL 3WFHA 5DURD 4ODTH 3QPQC 2VZ1A 5IMLB 5I75C 1XT5A 5FUZL 1AQDA 3UTTD 1RIVH 2VSDA 3MLWL 5E6YA 5HHMD 1F45A 2AXHA 3RTQC 2BRQA 4ODTL 5C07D 4JM4H 2IC2A 3JV0A 4X6DF 4LP5A 3RDTC 2V9QA 4GH7B 1EXUB 2Q7YA 4BK5A 3ZTJH 3D87B 3IGAA 4PJ5A 3VFSB 5A1AA 1RIVL 5E1AB 1X4XA 4PJGE 2C4FU 1DL7H 1A1NA 3SJVD 43C9B 1IGIH 1KJVB 5D1ZB 1NMBH 1OAQH 3T08A 4HJ0C 3FOLA 2WINA 5C9KA 4Y2OA 4L8CB 2YEZA 4G80B 3OMZA 5F6HI 2V2XB 1DL7L 2BNQA 2GJ6D 4IMKA 1UACH 5J11C 2PXYC 1VFAB 3FQRA 2GSIA 5HDQL 3ULVH 4AQ1B 2MTPA 2YKLH 2JF1A 3VI4F 5F7FA 4K7PL 1H0DA 4R2GD 1I7ZB 3H42H 4C58B 2HT2C 4OIIH 4Q0XH 1LD9A 4EDXB 1HE7A 4GBXA 4NBYB 4U6XB 3EUUA 3ULVL 4QT5B 2YKLL 5MI0C 3IDGB 1FH5H 1W72L 2APXA 1PG7X 4UU9A 5HGBA 4NN5B 3H42L 2P5EE 4OIIL 1WCQA 4XZUA 4BFBD 4Q0XL 2KZ1B 2E7LA 1UKQA 2HN7B 5ITFA 2A77H 1G7HB 3K1KC 2ZCHH 4RMSA 2LQRA 3T0EB 1A6WL 2I07B 5KOMC 1D5BA 2VDOH 3U1SL 3IJYB 4DZBB 1DN2A 1G7LA 4QWWD 1SQ2N 5IEKA 1EVTC 3QB7C 2BSSA 1YEIH 2COQA 2ZCHL 1HWGB 3GHEL 1KTLB 5KVMC 4YUEL 1KTKE 4QRPB 4JFDD 5JZ7C 5GZNC 5EULV 5IFJA 2MNUA 3W0WE 3VXSB 3IJHA 1MJJB 2EDWA 2FBJL 1S7XB 4WNQB 4XCNA 1YEIL 2EIEA 4R96B 3KPRA 5DURB 4S1DC 5CBEA 3ARFA 3CXDH 1BQSA 3OKKB 4N8CH 4X5WA 3DURA 1KV3A 4MDIB 4PTUA 5IV2A 4NQEE 2HA1A 2P5ED 4G43B 2XWJA 4PJCF 5HHMB 1OM3H 1O7SA 1R3LA 5F89B 1G1YA 3CXDL 5D5ME 3TZVA 3GIZH 4U6YB 1FRGH 2NZ9D 3RVVC 3RWCB 4Z5RA 3N1MC 2Q8BH 3RBGA 3FCTB 5I6XC 1SY6A 4GW1B 4G9DA 3UTSB 3SJVB 1OM3L 3U46A 5CEYB 5E8PB 4OFIA 4TPRH 3ZHDA 1TITA 1N26A 1U93A 4PRPE 2VZSA 1FO0A 3GIZL 1FRGL 1IAII 4FQQA 2O5YL 2Q8BL 1TZGL 2DQJH 4K3HA 3B9KD 2GJ6B 3JWOC 3FRUA 1YN7A 1UC6A 2D03L 5IJVB 1QBAA 3P9MA 2HRPH 3F8UB 4JFFE 1A7BA 4NQED 1IT9H 1CGTA 3MJ9A 5F9JA 3VFGH 1I7TA 2DQJL 1ES0A 5BQ7A 3VFVB 1VESA 4R2GB 2IEPA 2XA3A 2CUHA 4FHBD 1L7IL 2HRPL 3RWJB 4A2MA 3U7WL 3O3AA 1ZVSB 1X5GA 3LQAC 4PJGB 3QCUH 3CVHA 4YO0B 4EQ2A 1L6ZA 1KB5B 3VFNA 4GW4A 4IJ3C 3WLBB 1ZVYA 4LU5L 5DMGD 4B0MM 2GT9A 1QSFA 4PRPD 4P9HC 3H7BA 1OSPH 3DNKA 4XNMB 4PLKD 1EGJH 5BS0E 5JNYA 3UZEA 3M17A 4AT6A 1ZHKA 4HAGA 3SE4A 4JDVA 3QCUL 2B1AH 1I8MA 5E8DH 4M9OA 1KGCE 3GKWH 4OKVB 4JQXA 2VXSL 1H5BC 1EEYB 1OSPL 4JFFD 4WDIA 2FNBA 3H8NA 3P30L 2NY1C 4WGVB 4ZTPH 5GSRB 4IIQA 1DBAH 4J7RA 5J13C 5J1SC 1VGKB 4PY8I 1FZKB 2B1AL 1A8JH 2YRLA 1IEBA 4MHHG 3GKWL 4P4KA 1JRHL 2HG5A 4XVSH 4HIIA 4OLVH 1H8OA 3SDAA 3TT1L 3BFOA 4JDZA 4PP1D 2D7MA 2XG5A 1U8KA 4YK4B 1HSAB 1IKNC 3PQYA 1UKTA 4J23A 4KDVA 2P5EB 3TBVB 3NCJH 1PY4A 5JO5A 4WFEE 3EYVB 4XVSL 1U8MB 1MCWW 1QR1A 5BS0D 1DVFA 1HEZB 3FFCE 3BEWB 3V0VB 5IQ9B 2GW5A 2YPLD 5FO8A 3HE6D 4OIAA 3JTTB 4C59B 5T1DH 4YEEA 1TNNA 1NC2D 3LKOB 4FQPA 1KTDA 1Z3GH 3GSXA 3RL1B 2GTWA 4X9GA 4MAYC 4CVZB 4WENB 1TCMA 3RY6C 5KSUB 4MDJA 5LJYH 4YIQA 4ZUVA 2AXFA 4IHOA 4R9HA 4Z7NF 3W0WB 3DYPA 1EHLH 2Q3AA 3F7PC 5T1DL 1KCUH 1RJLA 1A6TB 2X9XA 1Z3GL 1DP0A 3B9KB 1KTRL 3QULA 4QOKD 5I1AA 4Q97A 4M4RA 3ZHLA 5JW3H 3NIDE 1YY9C 4NWTL 1YC8A 1EO5A 2BHZA 3O4OC 4NQEB 1KCUL 4WFED 3M8OH 4RMTA 5GRXG 4JEGB 4HIHB 5KS9A 4M93C 4D9RE 3FFCD 5JW3L 4APQC 3EJZD 5D5MB 1OL0A 3L5IA 3L7EB 1WQVT 3HB3C 3BZDA 4OCXL 5FGBC 3MRQB 5LVEA 3EOYG 3OG6B 1YEGH 3DRQB 3M8OL 3VRJB 5DHVB 3FQTA 3G5XB 3DRTB 4PRPB 4JM2D 3RTQA 4X6DA 5FGCE 1MH5B 5IQ7H 4OTXL 2XZZA 1AP2B 1YA5A 2CSPA 3RKPA 4M48H 2V7HB 3QFDB 3RA7L 3VG9C 1Q94B 2ADIB 2DWEA 2P45B 3IFNL 4LLVA 3VD3A 2ZNXA 5BRZA 5IQ7L 4JFFB 2X1PA 4FP8L 4NYLB 5JXAH 3CSYA 2Y06H 3CK0L 3L95A 3D25A 3MV8A 4D9RD 1EUTA 2AJ3A 3JV4B 2R2EA 1KJMB 3RPIB 2CKBB 2PXYA 5I1HH 4I9WE 5JXAL 1TZHA 3RX8A 2ATKA 1PG7W 3RWFB 5HYSB 5EOCJ 3G6AA 1ZWIA 3MGAA 1JHTB 4Y16C 4HKZB 2YMXL 1MHEB 5C0DB 5BS0B 4NQCA 3QIWC 4RMUA 2VWEC 5EB9A 1AGDA 3HE6B 2OMNA 1Q9LA 1A3QA 5D1QD 1OLZA 3LRSA 3WS3B 5E4EC 1MCSA 2BVEA 2X5PA 5CJOL 1MLCA 4Z7UE 1HQRA 4FNLH 5HHVH 4BQ8A 1YMHB 5L2KE 4N68A 2FYYA 4ENEC 1WBXB 3PP4L 4EZMA 3UTZA 3CJJA 1JWUB 2X2YA 4JFZL 2FHCA 2AKRA 1NGXA 2HMID 2FEDD 3HC3H 4I5BB 5EDXA 1ITBB 1HILB 1KPVB 3F62A 3CDFA 3S34H 4H25B 1RHHA 4JLRA 3NFPA 3PL6C 3STBA 3ULUL 3C09B 1EA9C 1JF1B 3NTCH 3HC3L 3STZB 4OCLC 3PIQA 3C6LB 3FFCB 3O4LD 3RVTD 3MLTB 2Y7QA 4NO5B 4G9FA 1I1AA 3S34L 4YZFE 3S96A 4P46C 3ES6B 2HP4A 3WCYA 3CVIH 3TIDB 4MB4A 4HCRH 4BZYA 1IE5A 3D39E 2YBRA 4HFWA 4KVNH 4HK0A 1G9NC 4KV5E 4NCC2 1NEZB 5H94B 5FOBB 5FO7B 3WS6C 1XR8A 4HJGA 2HVKA 3CVIL 4W6WB 3EOAB 5F7WC 1MFBH 3TYGH 2ZSVB 2DI8A 2IQ9H 5FYLH 4FQJH 4Z9KB 1QSEE 2OSLA 1F2QA 1BGXL 1CXFA 3THML 2GQHA 1WUNT 5K59E 4NUGH 1EO8H 5IEHB 1X3DA 2APVA 4L3EA 4GFTB 5TF0A 1U6AH 1UB5B 3S8WA 1MFBL 3TYGL 4MD0A 4UQ3B 2IQ9L 4OM0L 1BBJB 5FYLL 4NO2B 4G3YH 4FQJL 5I9QC 1NUDA 3LB6C 3I6KB 2D7PA 3V95A 3VXRA 2Y6SC 4RISL 2ICWJ 1OB1A 1HQ4B 1F2XK 4PY7A 5DQ9A 5MENA 1U6AL 3H9SE 4LK4A 1CVSC 4UDTB 3D39D 4XTRD 4G3YL 1BVZA 1D6EA 1M4KA 5HI3D 1UCTA 5FGCB 4JO2H 3RZCC 4NIKB 5H35B 4PJ8B 4X4ME 4GS7B 2LAGB 4OLYH 1XF5A 4J2XA 1VERA 3HR5A 1TENA 1DJSA 2R9HD 5D1QB 1NGZA 1QSED 4HIEA 3BQUA 3TBYB 3ZE2F 5AWNH 4NQSB 1S78C 4JO2L 1T0NB 3GRWL 5DRWA 5FCUH 5C9JA 4KK8D 3TPUA 2CLZB 3JVGA 3BEVB 1ED3A 2G9HB 4XC3H 5AWNL 2EE6A 4XCFH 4K07A 5FCUL 4YHNA 3S88H 5C09A 1QFPA 5IUSA 1F4AA 1ZEAH 3FQNB 3H9SD 3SKMB 1U3JA 3VFPA 5DMIH 4HS3B 3BKYH 4ZPVA 3B2VH 4LPCA 4JANA 1IQWH 4O5LH 4XC3L 3TBTB 3CLFH 2HWZH 3HG1D 5ENWA 5F6IC 1KXQE 3S88L 4OT1H 2KDGA 5DJAB 4EI6B 4J12A 1ZEAL 5KSAD 2PCPA 2JE8A 3D85D 1C5BH 3HC0A 5DMIL 4X4ZA 3W2DH 3BE1H 5GS0L 3ARSA 3ARQA 4Z76A 4R4BA 1KCVH 4Z7UB 1IQWL 4O5LL 5KAQG 4JO3L 3CLFL 1MRCH 4GAGL 5CILH 3MPCA 4OT1L 5L2KB 2P48B 4OF8A 3BHBB 1NEZG 3WFEH 2OYPA 4PLNC 3D1MC 1DQJB 4WVRA 3UEZA 4OZIE 5EOQH 2O5ZL 4U3XA 1YPZF 4GAFB 5CILL 1IM9A 1SJEA 4OLXH 3UTPE 3QH3B 1NMCC 2N56A 3WFEL 4MNHB 1C8PA 4IRJD 4NFDA 1SVCP 1N2RB 4H1LH 1BVKA 2FL5A 2FATH 4UT6H 1LILA 2VDML 4HD9A 4J6RH 3VXOA 1DQQB 2H41A 4BSWA 2X6MA 3QPXH 5KSVB 3DI3B 2CIIB 5JPNB 2D3VA 3QDJE 5IB4B 2QQQA 4NM4H 3ARGC 2YA2A 4F2MA 4A2LA 2OTUA 2D31A 2FATL 3QISA 1CE1H 3HLAB 4J6RL 1Q0XH 5IIEB 5CP7A 3D39B 4FFZH 4D0DA 1T66D 3EDKA 3FT4B 3P11L 4V2CB 5GGTL 3MQIA 3QPXL 3CLEH 5E8NA 3HC4L 3CFBB 4FQHB 4APQA 4NM4L 4XHQA 1AGBA 4ZD3L 1GYAA 2ITCA 5EBMA 1CE1L 5FGBA 2APWA 1Q0XL 3ECBB 3HRZA 4LAQH 4OV5B 1A64A 1Y6NR 1QUNA 2RIKA 2OZ4A 4FFZL 2LTQC 3FQWA 1QSEB 3NIFF 3KYNB 2DF3A 3CLEL 5DTFA 4R7NA 4L8SB 1KACB 1UQSA 4HWNA 4ETQA 2HJFB 3IAPA 2F54E 1ZLUH 5BMFH 1ZXQA 3H3PH 3BRGC 5JW4M 4LAQL 1JI1A 1N0LA 2IH1B 4UUJB 1FZMA 3ZT6A 5F7NC 1RPQA 2VLJD 5EC2A 3NZHH 1R0AH 3PWUA 4PRIE 4W6YB 4OKDA 1ZHNA 5ERWA 3H9SB 4FA8A 2VLLA 3I9GH 3VJ6B 4Y5YA 2GITA 2KUTA 2FO4A 1YQ2A 3VWKB 5J6HA 5HY9A 5L0QB 5DD3H 4XP1L 2HFFB 5D1XC 4ZUTB 4B7LA 3NZHL 1R0AL 1XGRB 2R0LH 3BUYA 1TZIB 3OZ9L 3C8KA 2VYRE 3D85B 3I9GL 4XBEH 1Z9LA 2H6PA 4FTVA 4HPOL 5T1LA 3U7YH 1M1SA 2PKDA 1AHWB 1F58H 1I8IA 1V3KA 2EC8A 3HAEH 3EO0B 3K81A 1MLBB 3C2AH 1KEMH 4KKCC 5TQ2L 3QQ4A 2R0LL 5B38A 5IHUH 4DFHA 2BVQB 3X13A 2F54D 4P2QE 2C1PA 3AB0B 1G6RH 3IB4A 1YEDB 4X0KB 5FUCE 2HJLB 3WO4B 3SDCD 2P8LB 1F58L 3IXTB 1X6LA 4EUPB 4MA8H 5DMJB 5FECA 2HTLC 1U58B 3C2AL 3IDUA 2VABA 4PRID 1FPTL 3QNYA 5EZOL 2EXYD 3EOTL 4LSSH 3ZYZA 1X5HA 4L1DA 5HGDA 5HJ3A 4NKIH 3O2VL 3LSOB 4IRJB 4BKLA 3C6SB 3LEYH 3RWHA 5DJ8B 4KRPC 1N0XH 4Z8FH 1KXVC 1YN6A 1NJ9A 1NLDH 1A1OA 3KDMB 1AGFA 4NZTH 4FQIH 1B0GB 1IC4H 1CN4A 1BP3B 1A6AB 3GMNB 3MRBB 2WBJB 2P43B 4YK4C 3LEYL 2CK2A 1S7TA 3KG5A 4WTWA 4CN1A 5ABDE 3PL6A 4X8JA 3MBED 2ADFH 1OTSD 1ND0A 4P2QD 4NZTL 2K7PA 3HS0A 1NFDE 4FQIL 1IC4L 4ODSL 4DVRL 1EH9A 1ZSDB 4LHQB 1NDGA 4OZIB 3RVXC 5HHPB 5B3JF 2ZUTA 1S7QB 3PHOB 2AJZB 1HXMA 1IC7H 4P46A 2Q1EA 4BFIB 3KWWA 5JPMA 3IDMB 1SYSB 2ADFL 3T77B 5ACLA 1I7RB 1NBYB 4B5EA 4YNYA 3BYTA 3BP4B 3UBXG 2DQHH 2NY4C 3CPLA 4I4WB 3C87A 5FM4A 2IGFH 1ZHLB 2W65A 5DGQA 4EXPX 1RZ7H 1XR9A 2F53D 2X4NA 3D0LA 4X7CC 2HTKC 1SBSL 4MS8C 5A2KH 3PWJB 5H2BB 2GCYB 3QDJB 4X99A 3U6RA 2DQHL 3MX0A 1BZQK 3JUYA 1BBDL 4P57B 3T04D 3VMOA 1BQLL 4PRBB 2XFXA 3JWOL 1Q9OB 4HLZH 1RZ7L 5F1IA 2DIAA 3EYUL 4IRSC 5F6HJ 3PHSA 3CZJA 1S9YB 5J9PB 1X7QB 3WDJA 4U1KB 3FB7A 5EU5A 5DJYA 4FQLL 3UYOD 2X70B 4KAQH 2WBKA 3N1QC 4S1QH 2C3HA 1A9EB 2IPKB 1CFNA 4Y5XC 5DD0H 3MNVB 4LPWA 2BY3A 4KAQL 1MCLA 4S1QL 3OKOA 1NCCH 3RU8H 4D8PB 1LP9E 4JHWL 4QXUL 2F54B 3MRHA 2X05A 4JVUA 1A7QL 5INCB 3DSNA 1S9VB 3SDCB 3MV7A 5C0BA 3BPOC 4JFQA 4EUPG 5DD0L 1NCBL 1B90A 1T0PB 1X4ZA 4GXUN 5AYUL 4PRIB 3MCKB 4Z77B 1K6QH 1NCCL 3LZFH 4PUBH 3RU8L 1U95A 4ZG1A 4I0PD 5FAAA 1N64L 1FNGB 3OKLB 5FYJE 4ZO9A 5HYQB 3MLRH 4HS6A 3MFFB 3F12B 3P4OB 4HULB 1MF2H 2IALA 1YUHA 6FABH 2O61A 3S36X 5C6WH 4TSAL 3KYOA 4PUBL 3SDXF 3TWCH 1HHKB 5GGSB 2W9EH 4FQ1H 1FJ1A 2ATPB 2JJUA 3SY0A 1G9EA 5K9OA 2B2XH 1C12B 3MLRL 3L9RA 1MI5D 1LEIA 2CJUH 3N1GC 1MF2L 6FABL 4MJ4A 4EN3C 3TYFB 4RQQA 1I9RH 1CU4H 1Y18A 1S9XB 2DYPA 3MBEB 3WKMH 3X17A 3MNZB 3TWCL 4P2QB 2WV3A 3NCFB 5DFVD 4G42B 4V1DA 2VZ3A 2CJUL 4OGZA 1BZ9A 2C5DC 1FIGL 1FAKT 1JPST 1I9RL 5I15L 1CU4L 5I2IA 1V3MA 1G9ML 3WKML 1H3GA 4AH2B 1A21A 1MJ7H 3MROA 5D6DA 3QAZB 3QDMA 2HVJA 5FYJD 2X1OA 1FFPB 1ZT1A 3RGVD 2AJSH 1ULVA 3VRIB 3PGCB 4KI5E 4F9LC 3HI1A 1HHJB 1QYGH 1TQBB 3D69A 3RY4A 3EJJX 4QHLB 5CEXB 1N3NB 3HNTH 4F33B 1MJ7L 1DLHA 2GJZA 3EYOB 3KPOB 3TO2A 4BYHA 4EDWH 2ICCA 4PJ9D 4GW5A 5C08E 4WW1A 5DS8A 4HWBH 3ARDC 1QYGL 4R6UA 3B9EA 5I1LA 1EGJA 4M7LH 1G0XA 1I4FA 1J0JA 1K2DB 3UZQA 4CNIB 2J4WH 3O8XC 1BZ7A 4D3CH 3FO1A 1DBKH 3WFDH 1NFDB 3SQBA 4EDWL 1WCBB 1MWAL 1M7IA 4ODHH 1VKXB 4HWBL 3Q6GH 3V0WH 3GSVA 3KPLB 4HEME 3ARGA 4M7LL 4RMQA 2VR5A 5F9WB 2PF6A 4ZFFB 2J4WL 3ZDZE 2RCSH 1RUKH 4D3CL 1DBKL 4EIGB 5DJDB 5IM7A 3BJ91 4ODHL 1DR9A 4KI5D 2CDEB 5D72H 3EDEA 3Q6GL 3V0WL 2ZSWA 1XIWA 3GGWB 3P77A 2BVUA 1J1XH 1CGVA 5I1JH 2RCSL 1S7VB 3QUMH 5HGHA 3VI3E 3RHWF 3G5YB 1F97A 3GMQB 3OXRB 5JDJA 3NZ8A 4U1GB 3OB0K 5D72L 4HUKB 3LKSB 1PZ5A 5DA0B 1CQYA 3QWQB 1J1XL 5CKAA 3RWGA 1KC5H 5I1JL 5D71H 1KT2A 2NZIA 3QUML 3G6JE 1M7DA 3PWNB 3EGSB 4HJJH 4QF1B 5J6GB 5K9JH 2C1OA 3C9NA 3QXDA 5TDPA 3ZL4L 4JKPL 3IDXL 4N0UE 2OJEA 2DI7A 4HBCL 3L5WB 2QHLA 5DQJA 5IJKC 4PY8J 2ENYA 4OCWL 3SKNA 5CEZD 3NN8B 2EYTA 4HJJL 3X3GH 4Y7MA 5K9JL 1LP9B 4LMQE 1KJ2L 1WC7B 1RJYB 5LAXB 2IAMC 4JFXB 3WDHA 2X9YA 3HZMA 4DEPB 4QRUA 1HKLL 5EC1A 4K7PX 3MBXL 4YXLH 3X3GL 1AFVH 3LMJH 4WHTA 4MJ6A 2DJ4A 4MZ3A 1JNJA 1BIIB 4U1IA 3GMMB 5DHYB 4ZS6C 5EOTB 2OM5A 1T21A 2Q6WB 1A5FH 3RGVB 4WJ5B 3LD8C 1M71A 3RWIA 5D7IE 3D3VA 4RMWA 3TVMC 5E00A 1KB9K 3UJIH 1T89C 5FDYA 4L29A 5IESL 4HKXB 1A5FL 3BDYH 5IVZA 1GHFH 4ODWB 4YXKL 2ZUYA 1L7TL 5EUOF 1AD0A 2R8SH 4JRYE 5ACZA 3TGXA 5T3ZH 1EO7A 1YJDC 1EIBA 4CU8A 5F7DA 4H88H 3IKCB 5E08H 1XGQA 3T0WA 2FX8H 1GHFL 1WBZA 2P49B 2DMKA 4NWUH 4Y4FC 4NFCA 3BGAA 5E2WL 5JQHC 3T4YB 2R8SL 3MMEB 2ZZUT 3RBSA 1IL1A 2UYLB 2WM0A 5IW1B 4HGKC 5GJTL 1Q9KA 1K5NB 1ZMYA 4OD1L 3H9ZA 1QEWB 4FFWC 4FG6D 4H88L 5E08L 3DROB 2X4RB 3K46A 5DEGB 3H9HA 2FX8L 1AGEA 5EZLB 2QQLH 4NWUL 1WAAE 4XBPA 1Y0LA 4O4YH 1G0YR 1LK2A 1BFVH 4DTGL 4K94H 5DK0A 5C08B 2ZPKL 2QQLL 4QEGA 3AS3A 5GSVA 4YHLH 1C7TA 3QEUB 3QQ9C 1U8HB 4LOUC 4O4YL 2DM4A 5D6CA 2NW2B 1BFVL 3GSRA 2BNUB 3QXAA 4CAGA 4O58L 1NGYA 2DWDB 1QQDA 3VFRA 2D2OA 2DMBA 3BPNB 5I8OL 4L4VE 4K94L 2Z31C 3ET9F 3IDIB 2WLZA 2QV2A 4N8VB 4G6MH 4YHLL 4WIQA 2IG2L 4FS0A 4I3RH 3RL2A 1KIRA 3LH2L 1PW3A 4NRXA 5HDLA 5D8JH 4MMXC 1IQDA 2MFNA 4GKZB 4J1UA 1MJ8H 1KJ3H 5EZIH 5C2BH 5DRNB 4ORGB 2SEBB 2YRPA 4MCYB 1TXKA 2C4XA 3WFZA 4G6ML 1FFNB 4I3RL 2H9GA 2X4TB 3FB8A 1KIPA 5D8JL 1ETZA 3TNNB 4HWEH 2ZUSA 1MJ8L 1KJ3L 5EZIL 4DUXA 1OLLA 4Y5XA 5GS2H 1PKOA 1OCWH 1V3LA 2XQYK 2DLEA 3BIKA 1YMME 1FL5B 2HFTA 5CGYD 5D7JD 4W4NA 5DVMA 3G6JB 4HWEL 3QCVH 1TPXB 4NKOA 3BAEH 1MCFA 5E6IC 3LV3B 4HCRA 1OCWL 4M7KH 1CFQB 1CXIA 4N0UB 4GXVH 1NGWA 4K3DH 5EZJB 5IKCB 1CT8A 2P5WE 2EDTA 3QUZB 4O2CB 5C3LD 1A7PH 5IF0A 3QCVL 4RFOH 5FKAB 3GMRA 3MLYH 5HSFA 4M7KL 3U79A 1QA9B 1DBBL 4GXVL 4K3DL 3GSWA 2A74A 5DK2A 3ROOA 5IBLD 1BD2A 4DKFH 1I7UA 5FA3B 2PW2B 3V4VH 1A7PL 1I3RB 1X5IA 2X4SB 1MVUB 3AS0A 4HV8B 5FF6A 3MRDA 1YMMD 4DKFL 2NY2D 3V4UH 2EYSA 2OX5A 5D7IB 5DD1L 4ERSL 1A4JB 3E2HB 1FVEB 5CSZA 3V4VL 3AS1A 3DMMC 1QVOB 4K71C 1TIUA 1KBGL 3W82A 1XZ0A 1EBAA 1JL8A 1QLRA 1S7RA 5C0NC 1HHHA 2P5WD 3V52H 3MNWA 5AYQA 3FHQA 4UBDC 3MREB 1XH3B 4JRYB 2FD6L 4PJEF 3VXMA 2NY5H 2A0LD 1YNLL 3WXWH 2NY6D 4KHXH 3MV9E 4L9LB 1HYSC 3L6FA 4PV8A 4RRPG 2WW8A 3KR3H 2IANA 4M8QB 1G6VK 1JZ6A 5ICZA 1T6VN 4N8VG 1DN0A 3V6FB 4KFZC 1KN2L 2V6HA 5DVKA 1NH6A 3ABZA 4E42A 5ADPL 4PRAA 3ARDA 2VDRH 3OJVC 3WXWL 3UPRB 4KHXL 3RWEA 3RPKA 1M6OB 3RHWK 2R0ZH 5B8CB 4HFUH 3UTQB 3F5WA 3O8XA 4MVBD 2NLJA 1NMAL 1MIEH 3SGKC 2X41A 2B0SH 1TJHH 2Z35B 4NPYA 4I18B 2VDRL 3QCTH 2R1XA 1AIFB 1VPOL 1NC4A 1X5KA 2R0ZL 4RX4A 3UTOA 4HFUL 1A6ZB 5T33L 1MCRA 1TQCB 2H2PC 3IFOA 2YK1H 1MIEL 2B0SL 2H2SD 1TJHL 1CXHA 2HT4D 1PYWA 5D7JB 5LBSL 3ARED 1D5IH 4XP4H 3QCTL 3BP5A 3MV9D 4L4VB 5A3ID 1SJXA 1U3HD 1LDPL 3DVNA 3T65A 1CFSA 4PTTB 4N0CC 1C08A 3O0RH 1FZOA 1T04A 2YK1L 4TULL 3LEXB 4NQDD 5DC9B 3LKQB 4MGXA 4TQEH 2X4OB 4Y1AE 2EYRA 1J8HE 1JPGA 4HQQH 4E41E 5CMAA 5IR1B 2Y36H 4XGZA 4JPKL 1P4IH 1WFUA 2GFBB 1JYXA 1SHMA 4MLIA 1NCAL 3O0RL 5CZXD 2QKIA 2XA8H 1T1YB 4XPBH 1IJ9A 4OD3H 1DUZB 3VFWB 5EUKB 4XPHH 4TQEL 2DICA 4HQQL 1JPFB 1BQHA 2PN5A 2P8PA 3O11A 3RRQA 2Y36L 2CQVA 3MRIB 1T22A 1P4IL 3KLAB 2VDLL 2H45A 1BFSA 3QEQD 4DW2L 1JPTH 1CGSL 2XA8L 1TETL 3VCLA 4XPBL 1I9EA 5I74C 1YMMB 4OD3L 2XZAL 4XPHL 1KB5L 2HFEA 2NY2B 4HIJB 2VTFA 4AEEA 4U0RB 3TO4D 2A6DA 4I0CC 3VFMB 1OT2A 5ETUA 5J1AA 1ZLUK 3BZ4A 1JPTL 1U41A 3EFFA 1ZGLM 1E4WL 2ADGA 2P5WB 4Y1AD 1J8HD 2JB6A 3GJEB 4KJYB 4N1EA 4EJ1C 5IB5B 4JZOA 3ZDYE 5D70L 1AQKL 5E8OA 1JGDB 4KK5C 3L3KB 3TVMA 3PJSA 2GEEA 4ZXBD 1RI8A 3DIFA 5IFHH 1AGCA 2LVEA 4JN2B 1TCRA 4GRLC 2I24N 5KW9L 5DMKA 1OTUD 3BH9A 4LAJH 1NKRA 5IMOA 2WP3O 1JGLH 2GUOB 5IB2A 2VLRA 3DBXB 1D9KC 3ULVD 4RFEB 2CGRL 4M6NL 5GGRB 5IFHL 5HYJE 2NXYB 1MPAH 1D5XB 4MXVF 1ORSB 3FO9A 1RVFL 4OUUA 4Y4FA 4WU7A 2OQJA 1XGTB 3PNWB 3KAAA 4Y4KD 4AIOA 4D0BB 2B39A 3IU3A 1A9BA 3FT3A 4LFHD 4ODVH 1P2CA 3WL9A 3KS0J 1TVHA 5ILTL 3S35H 4PR5A 4NFBA 5JIKA 2BC4B 5F3BA 1MPAL 4F15B 5FHAH 4ZFZA 2B4CH 3ILPA 2Z4QB 3V6OE 1JYNA 4OI9A 3OAUL 3AREB 3B83A 4RBPH 3LN4A 4UINH 5J56B 3MV9B 2IQAB 3S35L 4CVUA 5IK3B 1U3HB 3HAEA 3AVEA 2CR6A 3E6FA 1RJZA 4LEOB 5INDB 1WT5C 1PX3A 1CL7H 5E99L 1H15A 1RV6X 1T5XA 4PLJD 7FABL 3ARPA 2KPNA 2EH8H 4NO3A 3RUGE 1BJ8A 3I6GB 4UINL 1LEKA 3SKOA 3TBWA 5C0CD 4JDTH 1G6RA 4YFEA 1GXEA 3K74B 4LF3A 1FNEA 2V7NA 1JWSA 1P1ZA 2VISB 5HYJD 3LQZA 2H26A 4PGCA 1CL7L 4Q9RH 2Z31A 1X9QA 4HF5H 4WW2B 5ICXA 4JG0L 5GRJH 2X09A 4LPTA 2EH8L 4M8VA 1NGQL 1FYTE 4LKXB 4JDTL 5DHVH 1T7WA 1WICA 5CAYB 2FO1A 2PYFA 3UAJD 3WIHL 1DBMH 2CO6B 4YDKH 4U6TA 4OGAC 4FQ2H 4Q9RL 3P40A 3QXVA 2EXWD 4HF5L 1LNUA 1Q8MA 3V6ZA 3L3IB 1UB6B 5GRJL 1HH9A 4Y4HA 3MGOB 3TO4B 5SWZA 5IBUG 4AEIH 1I1RA 3FMGH 3S7GA 4O02H 4MA7L 1DBML 1O7VA 1KN4H 4YDKL 4FQ2L 3QO0A 1AO7E 2YPKA 2YD7A 5JMRA 1NBZA 1T5WB 3FFDA 25C8H 5JHLH 3G6DH 4HKBB 2J8HA 2CDFB 1DQMH 3L3HA 4U1GC 1J8HB 4Y1AB 4Z18A 4E41B 3T3ME 1CE6A 2XN9A 3NACH 3TJHC 3W11C 1G7QB 4AEIL 1KG0A 1F8TH 4OLUH 5J0BA 3VXUD 1EFXD 3U9PH 2QSCL 3NCBB 5E9DE 2EE2A 2CKBH 1KN4L 5FV2A 3KPTA 4ZXBB 5E6IA 5JHLL 3G6DL 1KNOA 4MJIE 1DQML 2OXHA 2W91A 1FYTD 1MY7A 5DDHA 1SYVA 4LCYB 3JTSB 4PG9A 4GKSA 2K9UA 1F8TL 4OLUL 3HZYB 3LEVL 2Y23A 2Q76A 1E28B 1ZGLB 3GBLA 4YHYB 1V3JA 1W72B 4X9HA 3DUUB 4W6XB 5E8EA 3EYQC 5TDNA 1WISA 2AEQH 5BJTA 1WZ1H 4MD5A 5LG1A 4POZD 3TA3A 1FSKB 1RZGA 4LNRA 4Y4KB 2V17H 5I18H 4O00A 1BF2A 1LO5A 1OHQA 3DUSB 3O6FA 4MQ7A 4NUJA 5KTEH 4NT6B 4JHBA 1UXSB 2AEQL 3QUYC 5E9DD 5I18L 1S8DA 1YNKH 5I1CH 2MQCA 2J5LB 3DMMA 1IAIM 3LRHA 4MJ5A 3RAJL 3QUXD 3GIVB 4MJID 3DLQR 4QHNA 5KTEL 1KYOK 2Y07H 3QG6B 4PGBB 5BZDA 2X4PA 4ZUSB 4YAQA 4FZEL 4BM7A 1FVCA 2R2HB 1FNHA 5LWYH 1LHZA 4TRPH 2AABH 3PV6B 1YNKL 1F4WH 1QD0A 2FLBT 5HYJB 3DX9A 2Y07L 5EU7C 4Z78B 3TLRA 2YWYA 3QJHB 3WUZA 2B20A 3B9VA 5C8JB 4Y2DD 5LWYL 2HLAB 3B2UD 1P6FA 2AW2A 1N59B 2DTSA 1ONQB 3BP6A 4F80A 2BDNH 3KHOA 3I84A 1PY9A 5DT1H 5I16B 3VE0B 4RZCB 4UIMA 2CLVA 1NCNA 4KGJA 1UWXH 5TJWK 4N5EC 3RP1A 2NY7H 3SGKA 4RGMB 4PJ5E 1GCFA 1CS6A 4YLQT 1F11B 4XBGB 4HZAA 5JW5A 2ARJB 5D7KD 5F44A 4F7PB 2BDNL 4JGJA 5MP6H 4OF3A 4OJFH 2ZG1A 5DT1L 2C9AA 3PWPE 3BOVA 2E7BA 1JN6B 4P5TC 3RUGB 2W9DL 4KY1H 1HOCB 5F1KC 1LK3H 5KN5A 3NGBC 4TTGA 1MJUH 1UA6L 4PB9H 5E5UB 2VZUA 3PHQA 1HYRC 2BNQE 5SWQA 2EDOA 4U1LB 5MP6L 3MRMB 4F7MB 4OJFL 3GSUB 3ILQD 1WWCA 3LN9A 4P2OA 4XAWL 2G2RB 4KY1L 1FYTB 2AJYH 4NHUA 4EI5C 3WLWC 1LK3L 3M45A 3QI9D 1MJUL 4PB9L 4IS6A 3SDDA 1OGTB 4Y19A 5GGRY 2K7QA 4YXHH 5JXEC 4WI8A 1QBBA 4JJ5A 5DYOA 1JYWA 4NGHH 3ARBA 5JORA 2FECI 3RNKA 1U8IB 1MUJB 3SCMB 1Q72H 2AJYL 1YNTB 4PJ5D 4UOJA 1G7JB 2C7UB 1QBLH 4LFHG 4WU5A 1AO7B 5L8KB 2UWEE 1UVQB 3F6LA 3PWPD 5ESQA 2NTFA 2VRAA 5JOFA 1K8DA 1R3IH 5ESVB 1GGUA 1Q72L 1PD6A 5DRZB 5FK9B 4PGDA 1CICC 1W0YT 2BNQD 4KKBD 1RZIA 3HCVB 5E9DB 5HGAB 4R7DB 4QTHB 1E27A 1UWGL 3ZE1E 2F19H 1TPXC 1QG3A 1PG7H 2HKHH 4UNVA 1INEH 3E0GA 4MJIB 4RA3A 1F00I 2AQ2A 4QHUA 1R3IL 3LRGA 3GM8A 4MQXD 1DE4B 2ZG3A 1UJ3C 1F3DJ 1VACB 5DJ0A 5I71C 5D7SL 4X5XA 1A6VH 5EWIH 1YEKL 4C83A 4HS8L 2ORBH 4JPWL 4CBPA 5BXFA 4F3FB 4S1SH 3TCLA 2F19L 4CVXB 4XCEB 4NKMB 2VL4A 4JY4B 4QCIB 5MHSE 1KPRB 4MA3B 3KPRE 3REVA 1CWVA 4UT9H 3MRJA 4Y2DB 1A6VL 3Q5YA 3SOBH 1N4XL 1S7SA 1QFWH 3AY4C 3EHBD 2ORBL 4PB0H 4KPHH 4JFOA 3SPVA 4H8WC 4O51A 2VDNL 3GMOA 4L9DA 4YFLF 1AKJA 1GAFH 3RJQB 2VQ1A 4UT9L 1OSZA 1SM3H 1CDUA 1RK1A 2DL2A 4F7CB 5IVXF 4PB0L 1ZLVK 1P7KB 5AZ2H 2BOCB 1VFOA 1RIHL 4OGYL 4N1HB 1QNZH 1T80A 3DX8A 5GRYA 3KJ4C 3OR7B 3BJLA 1XGPA 3TIEB 1SM3L 3HPLA 4P3CH 4YDVA 1JV5A 3V5KA 5TH2A 3MLVL 4AM0A 3C5JA 1IGYB 3Q5OA 5FO9A 1OP9A 2EKSA 5AZ2L 3SKUD 2R1YB 1RZ8A 1T20A 2VSCA 1QNZL 4QWWC 5J12B 4KUZH 1I1CA 3KPRD 1RMFH 4J3WA 3WFHB 3ULUD 1A02N 4P3CL 3FHAA 3GDBA 2W0FA 1K3ZA 3NPSB 3VGEA 1WT5A 1RZFL 4IDJH 3QI9B 4K8RC 4LSUH 1EMTH 1WWBX 3B5HA 4D0CA 1RMFL 3O6ML 1LO0L 3MV01 3TZVD 3B4NA 3QIUC 4LHUD 3BPCB 4I1NB 1ZA3A 2Q7YB 1T2QH 1KFAH 3IGAB 4PJ5B 1V8HA 1OQOA 2N4IA 4IDJL 5CD5D 4H0IA 4LSUL 4PBVC 1A1NB 1HXYB 3OB8A 4QHKI 3ZE0F 4Z7WF 1DUYA 2XWBB 4PJDF 4XMKH 1NLBH 1KCKA 1J1OH 2CUIA 1XCTB 3QFJA 3PWPB 4MCZA 2WWMD 2VUOA 2X40A 1IAOB 2WINB 1T2QL 1KFAL 2NZ9C 1E6OH 3V9FA 2YEZB 3DTXA 5DUBB 4YQXH 5IMKB 2BNQB 3ARRA 4YDIH 1ZS8A 4CL7A 1A4KA 2HLFD 3WN5A 4XMKL 1BFOB 1NLBL 4Q9QH 2FHFA 3CFDA 1JHLL 2BSRB 1YYLL 5I17A 3TH3T 4QRTA 5DVNA 2BVOA 1E6OL 2A6IA 4YQXL 3VWJA 4FMKA 4YDIL 1H0DB 1FNLA 3AU1A 4PGZA 3WXVH 4Q9QL 3LN5B 4NSKB 3HKFA 1LD9B 4JAMA 4GBXB 4LLQA 2J7LA 3RVWD 1A2YB 2DL9A 2V2TA 4LGRB 4DAGL 4DKEH 4P23C 3DV6A 3PQYE 5SX4I 2DKSA 1WTGT 3WXVL 3C5ZD 2IF7A 3UO1H 2UWEB 1DBJL 2VXTH 4U49A 5ITFB 3D9AL 5TGBA 2OCFD 3BPLB 2MCPH 2YUXA 4N0FA 4Z6AT 1MFNA 3JZ7A 4ORZC 1YDPA 4DKEL 3MJ6A 1M05B 4EUPH 4LGSB 4UAOC 3BZFA 3UO1L 3BZEA 4IOFD 2APBA 2BSSB 4X83A 1JIBA 5BO1H 3U0PA 2R2CA 5FXCH 2KH2B 1U92A 4PJXA 2MCPL 2E8YA 2CLRA 3WJLA 1EXUA 5IFJB 3QDGD 3U36A 4S10A 4LVHC 3IJHB 3T4AB 3VFSA 2B1HH 3QUYA 5E1AA 4XCNB 4MB5A 3WO3B 3C2SA 5BO1L 4PJHE 4AG4H 4FQXC 3KPRB 5H8DA 43C9A 3FB5A 4WFFE 4X5WB 3DURB 4UILH 3PQYD 4PTUB 5IV2B 4RFNC 4PRHA 2XWJB 4G80A 5GRZA 4C56A 1UEMA 3QHZH 2VXVH 3TN0D 4AG4L 1DVFD 5KS9E 2YD2A 3VGBA 1R3LB 4JRXE 5GS0D 1FNAA 3MRLA 4AENB 1UH4A 3CFEA 4OZHF 3TZVB 4LHUB 4UILL 4MWFA 4DGIH 3DX6A 1H9VA 1U9KA 4Q9CA 4G9DB 1V7MH 3ZDXF 2Z92A 3QHZL 4XWGH 3U46B 1Z5LB 1HHIA 2PO6C 3MO1A 1KF9B 4EDXA 4M6ML 1U93B 4X6DE 1DCLA 3S9DB 5GS1C 2XQBH 1LE5A 1FGNL 2NXZD 4QT5A 1LDSA 4NZUH 2YHGA 4XWGL 1U8PA 2R15A 3V6BR 2BNRA 2E9WA 4RAVA 4WFFD 2C26A 5JTWA 3P4MA 5BRZE 4K23L 4LRNH 4OCSL 3IAGC 5AAMA 4R0LC 2J6EL 5F9JB 3GB7A 2I07A 1I9JH 4P5TA 5BV7C 1ES0B 5BQ7B 3LVEA 3MV8E 5E2UH 3I2CH 4JRXD 3N50A 4OQTL 3K4AA 4IMLA 5GS3A 3TPKA 5ICYB 1MHPH 3QPQD 4LRNL 5AG9A 2M2DA 3O3AB 5C0FA 3CVHB 1E4XH 3VI4E 3VFNB 4GW4B 5E2UL 3VXSA 1MJJA 3I2CL 2GT9B 5IWLC 4WNQA 3RTQD 5IBTH 4B41A 3H7BB 4XP5L 4R96A 1MHPL 3L3DB 1CLYH 4NQCE 5JNYB 3ARXA 3X3FL 3M17B 4AT6B 3RDTD 1ZHKB 3OKKA 1WZMA 2ZUQB 4JDVB 4MDIA 1RU9H 1I8MB 4D9QE 4G43A 5I1DA 3UTTA 3E1F1 4JFYA 3IF1A 3ARVA 5IBTL 5BRZD 4JM2C 3ALPA 2DLIA 4ZYKB 4WDIB 3R1GL 1CLYL 3GSQA 2EDDA 5C07A 2A73B 3U83A 4HJ0D 3VU2A 4JM2F 1H3WM 2PW1A 5J3HC 3FL7A 3RWCA 4PV9A 1CICA 3T2OA 4GW1A 2HG5B 4ZOAA 5HVGB 4HIIB 3SJVA 2PXYD 5CEYA 4PJIF 4OIBA 5E6ZA 5F96L 1JZ8A 4M1DL 2E3VA 3PQYB 1UJ3A 4RMVA 5F70A 1NL0H 3BN9C 3C60C 1WIPA 3QR2A 3P9LA 3I6LD 1OP3K 5JA8B 2GAZA 4U7MA 5JOPE 2HT2D 1DVFB 1YQVH 1ACYL 2UY6A 5IJVA 4LHUG 5FO8B 4HUMB 3JV5A 3LQMA 1GZQA 4G9FE 2EE3A 4D9QD 2H3NB 3VFTA 1S3KL 5D2LF 5CBAB 4JCMA 4PJCE 1KTDB 1FSKC 3AY4A 3GSXB 2GTWB 1X6NA 3DWTA 2CRMA 1YQVL 2Q20A 1CDBA 4MDJB 4MZ2A 1U8JA 4YIQB 5SWSE 1RD6A 2ED8A 5EA0H 1JNHB 5IVXA 1FVDB 4U6VH 2NXZB 4I3GA 4D2NA 1ZVSA 4OQ1A 3OBAA 1RJLB 1MY5A 4YO0A 2A83A 4PJHB 3QHTC 3QULB 3WLBA 5I1AB 4M1CC 4NM8H 2ZJSL 3WUWG 2QJDA 1ZKAA 4OGXH 2PR4H 2W92A 5EA0L 4U6VL 3GSNB 5JZ7D 2YD1A 4WO4C 3K8LA 5GZND 4ZSOA 5EBGA 2DQDH 5KS9B 1Z9OA 2HMIC 5GISH 4HMEA 4JRXB 1K8IB 4NM8L 3QDHA 3VD4A 5IG7A 5GRVK 1MFAH 4G9FD 2X89D 3VXRE 2YD6A 4S1DD 5HYEA 4UNTA 5GSRA 4ZFOA 2ADJA 2AERT 5I75B 4JFDA 3HPJB 5L8JB 1S5HB 4FRWA 2C4FT 2DQDL 1UKSA 1P84J 5F9OH 1JTTA 4DQOH 4HMDA 2Y5EA 4X6DB 3RTQB 2ZUVA 5SWSD 2EEDA 1C5CL 1NCWH 4X6CF 3OV6A 1HSAA 4MXWH 3UP1A 4Z7WA 3RVVD 1F02I 4BH7A 3C8HA 4D94A 2P5EA 3TBVA 5C6TL 5F9OL 2FIKB 4DQOL 1RZKH 3DETC 4LLVB 3T1FA 1TVBA 1U8MA 5BRZB 5F7LB 3Q48A 2Q3ZA 4X5LA 5A16B 4ELMF 4U0QB 1HEZA 3BEWA 3CSYB 2OP4H 3CAFA 1UWEL 4GRWF 4KQ4H 3MR9B 4KGLA 2CRYA 3D25B 3MV8B 4FZ8H 1S9WA 1OT1A 2WQRA 1RZKL 2R2EB 4MD4A 4KRNA 4XX1G 5J11B 3BDXA 1GGIL 2PXYB 2YWZA 4WGWB 1TZHB 5C09E 4EOWH 2OP4L 4KXZH 2ATKB 4KQ4L 4L1HA 2R2BA 2OR9H 3G6AB 1ZWIB 3JV6A 3MYJA 2BP3A 1A6TA 2R1WA 2UVFA 4WTZG 3BKMH 4NQCB 5ADOH 4QY8B 4EOWL 3OPZL 2DM3A 4GG6F 1AGDB 2XNAA 5EU6A 1Q9LB 3AM8A 3LRSB 5MI0B 5HPOA 5CZVH 4P23A 2FR4B 1L6XA 5K9QG 5T1KD 1ADQH 1HQRB 5EN2B 2IMMA 2R56H 3D18B 5FYJH 3VGGA 5IW3A 2FYYB 3L7EA 4KDWA 2AXJA 4XRCB 3UX9B 5CZVL 3BVNB 3DRQA 3P0VH 1ADQL 2AKRB 3VRJA 1ZT4B 2R56L 3KPQA 5FYJL 5DHVA 3S98A 3GNMH 2FDBP 3G5XA 3DRTA 4LIQE 5C09D 1CD9B 4M5ZL 4KK8C 4Z7NE 3AXLB 4C57C 1VFBA 4YPGA 2EDNA 3ZHKA 3PIQB 3GNML 1BVLB 2ADIA 1WIOA 2Y7QB 4FQXA 3S96B 3CMGA 1MCJA 4G9FB 5CSGA 3ROLA 1P4BL 4NYLA 2CO7B 5JR1L 4PJCB 4GSDH 4OZGA 2EEAA 1KCRH 2VAAA 4KZDH 3RIAF 3PDOA 5IVOA 2WP3T 2YBRB 3PUCA 5IHZA 4OZHA 3RPIA 2CKBA 5SWSB 1OF2A 2YSSA 5KSAC 4HK0B 4RGOL 3KPSE 2XWTA 4RMRA 3OAYH 5JMOC 1XR8B 4LPXA 2HVKB 4GSDL 15C8H 1MEXH 3BSZH 4F57L 2AJVL 1B6DA 4KZDL 1OAXH 2MMXA 3G08A 5TDOA 1AR1C 2OSLB 5DEFA 4MAYD 1FCCA 4QXTB 3CX2A 4J3UA 3RJDA 1F3JA 1T03H 2PO6A 5F1SA 2ICEA 5DUPH 4YFLI