5I1AB

Crystal structure of human germline antibody ighv3-23/igkv3-11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO388 LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1aB01
4BFGA 1G7JB 3IDGA 5INCA 4F7PA 4E41A 2DQHL 4KUZL 1WT5A 3WKML 3DX8B 5ALCH 3CFCL 4O5LH 1S7VA 1OGAB 4P57B 2Z4QA 1KC5L 1A9BB 2IMMA 3DXAE 3MBEB 2H26B 1CT8B 4H0GA 4V1DD 3G08B 3LB6D 3UBXB 3S37L 5ENWB 4OLEA 3TBTB 4JANB 1TZGL 3HNTH 4PJFE 1YEIL 4PP2A 3HS0A 1Q9WB 3SE3A 3SDAB 1K4CA 2A6DA 2FEEI 5K9QI 5A1AA 5F96L 2NX5E 3SKNB 4GMSL 3MJ9H 4XAKD 1EIBA 1QFWI 2GKIA 5D72H 3N9GH 3RWEB 1YPZE 2GFBB 2Z31B 1OLZA 3P77A 4E41E 2HT3C 1A2YB 4P23C 2GUOB 3CU1A 1RJLA 2EDOA 1OP3H 2QQNH 4P4KA 3SE9L 3F12A 1LP9F 5DK2B 5GJTH 1BLNB 1X5YA 2JTDA 2Y7QA 4YWGL 3UTQA 2HFGH 1ND0A 4J4PA 4LF3A 4X6BA 4KDTC 2OL3H 4U3HA 3OHXA 3DIFB 2EKJA 3RBGA 4HIJB 5EB9A 3C5JA 3B6SB 4D0CB 4ZXBB 3JWDL 3FN0L 4ZS6C 4ZODA 4BQ6A 3RA7L 4JPVH 3D25B 1X4XA 5EU3A 5DHYA 5FYLL 3RVWD 3RHWF 1FDLH 3OSKA 1HH6B 2CLZA 1NMBH 5LG1A 3S96A 5C92A 1B0RA 1KPRB 2X4UB 4OCMC 4PJIF 3RNKA 1CDIA 4HDIB 2R2HA 2C26A 3HMXH 1UG9A 5EBLA 2J6EL 1HWGB 2VH5L 1XH3A 4ALAH 4M6OH 4U0RB 2E6JA 3ILQD 1LO4H 5K9QG 1QLRB 4K8RH 3TCLB 3T08A 2ITCA 4OV6F 3BAEH 1CFQB 3O2DH 5D1ZD 3IFNH 3RVTD 4UILH 3V8OA 3BH9B 1C08A 3MO1B 4PP1C 1CE6B 2W59A 1X44A 5EA0L 4MJIA 2FATL 3SE4C 3W0WA 4EI6A 5A3IC 3VFSA 4JGJA 4OD3H 4ETYA 1V05A 5FECB 5IG7A 5I1EL 2F8XC 5E2UH 1WJ3A 2ZP0T 2ZJSL 5BW7A 2WM0A 2ZCKL 4AIOA 1WBYB 4OSUL 3EO9H 3ZYZA 1K4DA 1T80A 1U8KA 1QSED 3PDOA 4FQ1L 2VITB 3NCCB 4LLMA 2XQBH 4Y5YB 4XP6L 5M95B 4FHBD 5KSBF 4M5YH 3OL2A 4JZNA 1XF4B 4GG6A 2RQ8A 4V1DA 1M71B 2VZ1A 1FO0H 3HC3H 3FQRB 4OGXL 2CKBH 2ARJB 3V5KA 4UDUA 4XCNA 3AS1A 5JUEH 3CSYB 4NQXB 4UZGA 4MJIE 5BO1L 3E0GA 3W0WE 4PJHF 1U8MA 4ZO8A 1W8OA 3LQAC 2UZXB 5I71B 1HYRC 3T3PE 3UP1A 1OWWA 1JGDA 4HWUA 5JR1H 2R2BA 1MOEA 1REIA 2BVTA 3OKYA 1MJ8H 3QXAB 4F7TB 3EO0A 4G7VL 5DUBA 4FQQA 1JPFB 4HUMB 5DMIL 4M7LT 2Y1VA 2BC4A 1HHKB 1Z9MA 2VXQH 4JRWA 3T0DA 4ZOBA 1HH9B 4K07A 4AEHL 2BVPA 5E5MA 1VKXA 1CXKA 5C0AD 4ODXB 3KDMB 5HYIA 1IFHH 5C6TL 3SQBA 2YPKB 4X99B 1CD1B 4OIIH 3GNML 3MCLL 3JV4B 3CPLA 4GG6E 4O4YL 4V1DE 4OLYL 1P7HL 5L0QB 1QFOA 3CFDA 1FNLA 4MNGA 4YQXH 3H3KA 5D7JA 3QA3A 4WI3A 3HAEA 1FNSH 2X4OA 1NBYA 1P9MA 2R2EA 1XF3B 4M00A 1EMTH 4XAKE 1RSFA 4X6CF 4L8SC 4LCIH 4PTTA 4OFVA 5JHLH 3VGAC 3W9DB 1ADQH 1YQVL 1FNGA 5JPMB 3WJLA 1KV3A 5HYJD 5JXAH 3WNOA 2E6QA 1CN4A 4G42B 5FB8A 2MQCA 3WXVL 1U6AH 3PGCB 4JQVC 4YGAB 2W0KA 5F6IC 3KYKH 4X8XA 4GAYB 3WLBB 3VXSB 2IBGA 3O2VH 5D1ZA 5JHDD 2VXVH 2ZNXA 3PHOB 4XP5L 9CGTA 4UT7H 4MNGE 1QBBA 5EOCJ 3H42H 1P84K 1R3KB 1XZ0A 1F42A 3CGTA 4MHHI 2Y23A 5LGKA 3TYGL 4X5WA 5EPMA 2YOCA 4XMKL 1JE6A 2JKXA 5DJDB 4CN1A 4ZUVB 5L2JB 3GSOB 4UAOC 3J8F7 5KVEL 2NY5L 1HSAA 1PLGH 1VB9A 1QEWA 5I9QC 4JM2B 4QRTB 2AJXH 4F7MB 2Q8BL 1FFRA 2CDEB 2V5YA 4LASL 4M43H 1Y6KR 5DD6A 4ZUWA 4S2SA 4PTUB 5MHSD 2EIEA 3JZ7A 3DYPA 1CICC 3OKKA 1NLDL 1QSEA 2A1WH 4EUPB 4LDLB 4ZUTA 1D5MB 4TTDD 1IGML 1W0VA 1KTLB 2M8XA 4X6DF 2A83A 1JRHI 3TV3H 2HTLD 1GC1C 1GGUA 3BRFA 3GMOB 3EGSA 5EBWA 2R0KL 3NAAH 3LRGA 5DD0L 3RWDB 5FGSA 5L8LB 2CK0H 3FOMA 4JGMA 4XAWH 5HYEA 4WNQA 4GS7B 1X6NA 4ZO6A 4PLNC 1QVOA 3RGVC 5DDHB 3M8OH 3EO1A 5ETUB 4AEIH 4BZ1H 1JK8A 4LCCA 4RFEB 4XCYB 5GS0L 5JLZB 2DWDA 3GSXA 2KDGA 3C6SB 4UV7L 1CK0H 2BY3A 1KPVB 1C8PA 4DKDC 4EDXA 4MQTB 4XX1E 1QSEE 3GB7B 4HWEL 1JNNH 1XCTB 5C0AA 4MHHG 1CLOH 1PZUB 3FOLA 3NPZB 2H8PB 5IHLB 1N2RB 3ZDXF 2A9ML 3WXWL 1WCQA 4M1CC 3RL2B 1PX3A 2HJLB 4QY8B 3U6RB 1MHHA 5F9AC 1DVFC 2CMRH 3SDCB 3OX8B 1OP5H 4C57C 1N7ML 3V52L 5FYJU 4LSQL 4YXLL 3B2UD 3RIAK 2PO6C 4YUEL 3KPSB 5TH2A 3OXSA 1JVKA 4Y5VA 3OJVC 3MNWB 3LIZL 2JELL 1O5DT 3DURB 2W91A 5F7DB 2Q8AH 1QR1A 3EOAB 4XMPH 4R3SA 1D9KB 3W5NA 1FZOB 3EFFB 4G9DB 3ME0A 3L3DA 4XGZA 4N0CD 1R3HA 5HYJA 1UXSB 4MCZB 2Z8WC 2NZ9D 4HQQH 2YD8A 2KH2B 5C0AE 5EOQL 1CL7H 4K2UL 1FFNA 4MLIA 3FQUB 5DD3H 1YMHA 1NAKH 4O2FA 4OGYL 3B3IA 2A77H 4EN3A 3STLB 2EDHA 3QQ3A 5JHDA 4MXQC 5MEPB 1K3IA 3D3VD 4PJ9D 8FABA 1OW0A 1S7TA 3C09B 4TUJA 5DJ6B 1HQ4A 1DUYA 3ARTA 3KJ6H 5IV2B 4OUUA 4QRUA 1QLEH 1AGBB 5KN5A 1WT5C 5DVLA 3Q6FB 3BZ4B 2WANA 1PEZA 4D9LL 3GIZL 3O3AA 4MD0A 4TOYL 1HHJA 3D39B 4GKSA 5HYJE 4TRPL 2FL5B 1AE6L 3GMLB 4ERSL 5FO9B 1L4IA 4LCUA 5I1AB 1MH5B 2HN7A 4U1NB 3EIFA 4CU8A 3KPLB 3MRNB 4XXCC 4YHYB 1FZJB 3W39B 3B9EA 2C1PB 4HCRA 2HH0H 1SYVB 5EU7E 5JHDE 3FO2B 4K7PL 2O61B 1KB5L 1M6OB 3E6HA 3ZZ1A 1YDPB 4KZEL 5EBGA 5DC4B 1NCNA 4OFYD 5FA3B 1OCWH 4DGYH 4PIRF 3DI3B 3N1MC 3TFKD 1LE5A 5IW1A 5BCAA 4RMVA 1FH5H 5KSAB 5GIRA 4KGLA 3GSUB 1DE4A 4PGEB 1HI6A 4ZPVA 2VE6B 1ZT7B 4P4KC 3WNPA 3U48A 3SKOB 3LMJL 1F4AA 1AD0A 5MHSE 4J4PC 4HIXL 1S9XA 4L3AA 3RRQA 1IAOA 5GJSH 2VDNH 3T4YA 1G7IA 3CFEB 2XA8L 4NN6B 1FG2B 3G04B 2BXYA 4DUWA 4WCYL 5H94B 4QXGL 4RWYH 4N90D 1IGJB 3DO7A 3K74B 3B8SA 1DFBH 4MQXD 4RDQF 2VDQH 3DBXB 4Z95H 1BAFL 3PP3H 3MCKB 4LKXA 1TQBB 3BP5A 2ZUUA 2FBJH 1ZLVK 5TFSH 4LHUA 1V3JA 5IB5A 1U93A 5DRZA 1IGTA 3WIIL 4TSBL 1SEQL 5D5MB 3SJVB 5CZVL 4EJ1C 1A3RH 4X4XA 4AENB 2BCKA 4HF5H 3LHPH 2BJMH 2IFFH 4KKLD 5BV7L 3L95B 6FABL 1FE8H 4X6FB 1RMFL 4H20L 3C2AL 1IGIH 4MAYB 3CFKB 2X70A 5H2BA 1T0NA 3QJFB 1QQDA 4U6VL 4YXKH 1MF2L 5TQ0L 4TQEL 3SDXA 4WDIB 4P59L 1FIEA 4PGBB 2EYSA 2F53A 3KJ4B 3QNZB 5INDA 1M7DB 1Y6NR 3HZVB 2BNRB 1KBGH 5GGUA 4P2YA 1MUJB 1MIEL 3VRIA 4LPCA 3DRTA 5SWZD 2J2ZA 2GW5A 5BW7C 4PJ9A 4ZSOB 5IB2A 3ARFA 1EUUA 4DZBB 4NNXB 4KK8D 2EE6A 2HJKA 4MXVE 4TSAL 2J5LC 4A6YL 3GIVA 1EAJA 1QHOA 3UROR 3EKCA 1UWGL 4PLKD 2NTSP 5ERWA 3THML 4IHOA 2ZG2A 2O5XH 2FSEA 2IANB 5GZOD 1IAKB 2J8UF 5T1KB 2EDEA 3LB6C 2KL6A 4HUVA 3T0ED 2R1YB 1CQYA 3QCTL 3SDXE 5LWYL 4P46D 3T65B 1U2HA 1YEFL 1O7VA 1W2KT 3VFVB 2Q6WB 3MRMB 5A2IH 4KHTL 5B8CB 3X13A 1EHLL 1CXLA 1D5IH 1F11A 3K7UA 5DGRA 3P4NB 3CXDL 4FFZH 1BFVH 2HFFA 1BQLL 3SDDD 3TVMB 1DZBA 4U6XA 4R9HA 4PJDA 4KVCH 5CSZB 3MJGX 3D3VE 3QG7H 4WU5A 1OTSD 4DQOL 3WFBH 4JDVA 4WFGD 1HXYB 1NMAH 2Z35B 4CVXA 5E1HB 3S34L 3MLYH 1CGTA 1C1EH 4UINL 3LD8C 4NCDA 3CXHK 3MZTA 2ZKHL 4HK3N 4K3EL 4LAQL 4WV1B 3KAAA 3CLFL 2WWKT 4RQQB 5T1LB 4OIBA 2AJSL 1ED3A 4RGMB 3GJFK 4CUCA 5F71A 2FYYA 3QH3B 4ODUA 5HVWA 5DC0A 2NXYD 5LVEA 5IHUL 3ABZA 1DSFL 4PRPD 3JUZA 1DL7L 3MNZB 1F6FB 1OF2B 2IWGA 5D7JC 1LILA 3VFPB 4HK0A 2WW8A 3LPFA 4ELMF 3O81A 4B5EA 5IF0B 3RVWC 1JWSA 2XN9D 4CDHA 4NZTL 5CP3A 5E99H 3QUML 4G9FB 5C0RL 1AO7B 3BP4A 5KS9F 3MLWH 4PJDE 1N4XL 5DD1L 2GJ6B 4MNHA 2F19H 5TGBA 1D6VH 3ZHDA 3QIWD 2OI9B 4HIHA 4P23B 2EH7H 1DUZB 4RFOH 3QEGL 3ULVL 1I3GL 4WW1B 1ZSDA 4HGWB 4PS4L 1E4JA 1NAMB 2L7UA 1VPOL 1C12B 4RWHA 1AQDB 2ESVA 3ILQC 3MOAH 4IOIB 4L5FL 1J8KA 35C8L 1RJZB 2H9GB 2YRLA 5F9JB 2OZ4L 3R0MA 5D1ZC 3MXVH 4NKMB 3RVTC 4FZ8H 3BH8A 4XMLH 1KEMH 2MHAB 1ZHLB 3U1SL 3C8KA 4OFPA 3KNBA 5TPWH 1M4KA 3WHXA 5E2WL 5E6IB 2AERT 1MCPL 3BKML 4OLWL 3HUJF 2J4WH 1XIWD 2V7HB 2DI9A 4FXKA 3OKEB 3BFOA 3N1FC 4YDIL 1CLYL 3HC0B 2Z8VC 4GRWH 2W0FA 5GGQL 2DQTH 5ICZA 5IMMA 1FZMB 3A6BL 1CFSA 4H1LH 2EDBA 1RV6X 1MLCA 4YDJB 3D2UD 3DUSB 3ARVA 4LLVB 4XPGH 2ILLA 3H6JA 3RZCB 5B38A 5HVHC 4JM4L 1EEYB 1ZS8B 2AGJH 4XX1G 4TVPH 1PY4A 3PWUA 1UZ8A 3MV8D 4CN4A 3RPKA 4GRWF 4K94C 4XNZC 4G6FB 3TBWB 5DRWB 3L5XL 1EO7A 2VAJA 4OZ4B 3P2TA 2P7TB 2BVQA 4NO2A 4NJAL 4P46A 2QEJA 5ECJE 3LEYL 2V9TA 2A6IB 5L9DL 5T3ZH 2F54D 2EDNA 1A0QH 4EZMA 5DURD 2NCMA 4GG8B 4XBEL 2N7AA 4HPOL 2AXFA 4JHAL 4LCCC 3SDDA 5T3XD 3V5DA 5IOPB 2AXGB 1I1AB 5JORB 3SPVB 3S36L 5E5RB 4YFEA 2AV7B 3B9DA 5JO5A 5C0FA 4OQTA 1CGXA 1JF1B 4QWWD 3B9AA 1DCLA 4PD4K 4DGVH 4HH9B 1JWUA 3C2SA 5F88B 3PV7A 2MKLC 5DQDL 1F8TH 4LGRB 3CH1A 1W72B 3HA0A 1VGKA 1SMOA 1N5AA 1NL0H 3BKJL 4LPUA 4DN3H 2QQLL 3BRGC 5MP6H 5EZOH 3T0EE 2B1HH 3BUTA 1TNMA 4KI1A 1LNUB 1WAAE 2C3HA 1BVKA 2DKMA 4J23A 2DF3A 3L3IA 2IBBA 3MRGB 1CGSH 1A7OH 4YDVA 3D69A 4A2MA 3QCVL 4HMEA 1L7IH 2XN9A 3PWVB 2HAZA 5CUSL 1I7ZB 4Y5VC 3TT3H 3GUTB 2EDFA 1GHFH 2IAMA 3RBSA 4FQLL 1RAMA 4WFGE 2VLKA 3PWJA 1MRDL 1CGWA 2FH6A 5TF1L 1VERA 3FHAA 3KPNA 3GEWB 1T1WB 4G6JL 5I8EA 1RUML 1DBBL 2FZ3B 4Z7UB 4EBQL 3AROA 1RIVH 2ATKA 3EJZD 3LKQA 1A6WL 4B50A 3NACL 3LZFL 3BWAA 4R4FH 2IALB 3C9NA 1MEXL 5EU7C 4MCYA 2GJZA 5KVFL 4KROB 2WSKA 4LEOA 5C3TA 1R24A 3UPRA 1DDHA 1PVHA 1CLCA 4KH2A 4QRQB 2X4QB 3BGFC 1MCOL 3UXFA 3U36B 1V3MA 5I1DA 3LRHA 2CH8A 1QZ1A 4F3FB 4ZPTB 1RVFH 2XN9E 4E42A 1U3HD 3VW3H 1BM3L 1XIWA 4L8SB 2NZIA 3MRRB 3VXMB 3PGFL 2VLKE 1IJ9A 3T2NH 1EJ6A 1NUFA 4F57H 3QI9D 5IR1A 3MRKA 1G0DA 4F9LA 2XY2A 2RR3A 3ZTNH 5JA8B 5CINL 4PJBB 3MV11 4TTDC 2BMKB 4G5ZH 4X9FA 3IAGC 2GTZA 4OZGA 2HTLC 4AK1A 3VXPA 4PRAA 2P8PA 4LOUD 3D0VB 2XZQL 1OSPL 2P43B 4K3JL 5C1MB 4RBPK 3KPOB 2DQIH 1FBIL 4MA8L 1NGZB 4ZAKA 4NHUA 3IB4A 1J05B 3C5ZD 1P4LB 1I9RH 3IETB 4KPHH 2I9TA 2R29H 3GJEA 3LKRB 1J1OL 4S0TD 4JRXB 1CDUA 5BMFL 4QCIB 1A5FH 2DMKA 5IMOA 1CU4H 1MFDL 2VABB 3BVNA 1CICB 4NWTH 2HWZH 1QLFA 4P9HH 2WLZA 4IBLT 3X3FL 3U7YH 2NY1D 1P7KB 3MV8E 4XC1L 5LGJB 3QEHB 2DLFH 3HPJA 4CNIB 3T2QA 4PB9H 3QNYA 3I75A 5J6HB 3VA2C 4BZ2H 3B5HA 4MJ4A 4DK6A 2YXFA 4R90H 2DWEB 3F7QA 4JFYA 2JCCB 1JUFB 4HJJH 3E6FA 4M93C 3B2UC 4LLWB 4O51A 5FOJA 1JZ8A 3ARBB 2D7QA 4LPVA 5T3XE 4JVUA 4WEBL 3RWFB 2PW1A 1MSPA 3L5IA 3IDXL 5FYLD 3MPCA 5EC2A 3VJ6B 4N0CC 1BVLA 5EUOA 3PL6B 4KRMB 4P5MA 2NZ9C 2V6HA 4H8WL 4KHXL 1ITCA 4MDIB 5T1MA 3UAJD 2RCSL 1S5IL 1X5GA 5F6HJ 4LARL 1NGPH 5CCKH 2D7OA 1NBZB 1A21A 2EKSB 4YE4L 4QF1B 4I0PB 4ZTPH 5C0CA 1T2XA 3OV6A 1IC4L 3KPMB 1SYSB 1Z5LB 2PYFB 1TNNA 1OQOA 4PJ9C 1T20B 4U31A 5TE6H 4HS6B 1DVFB 1YEGH 3F6IA 3NN8A 1JNJA 1MI5D 1U3HA 2Y06L 2AI0L 4FQXD 1FQ9C 1QFUL 1RZKC 3QIBD 4X5LA 2QQQA 4YHIB 1UACH 5GGVH 4XP1H 2DB8A 1J8HB 1QTYT 3QP3A 5IJVB 4HKZB 1NH6A 5TQ2H 3NZHL 5D7LB 5EUOE 1KLUB 2Q7YB 1ETZA 4DGIL 1SM3H 1CWVA 2CRIA 4PJFB 4NGHL 4NQSA 4LQFH 3PV6A 3UYOD 1VADA 4UB0L 5E8PB 3EYFB 4XNQB 2IGFH 1YEJH 2NX5B 2Q86A 3ZKND 5C0CE 1DBML 2C7UA 3ZLQC 4QRPA 4LIQH 1PSKL 2P42B 4HV8A 1QD0A 3FAXA 3IDGB 3WFCH 5EU6B 4KVNH 1JPTL 5FHBL 1IAIM 3C5ZA 1IE5A 3CFJB 3TFKC 5TDNA 1S7VB 2KBGA 3LS4H 3CU7A 2Z4QB 3OKDA 3S4SB 1RD6A 3G9VA 1UEMA 4LSUL 4KK6D 4CMHB 2X42A 5IESL 5GS3A 1MY7A 3H0TB 5F7EH 3RUGB 1ACYL 4WWKA 3DYMA 4Y4FA 4U6TA 1XGRB 2Y5TA 5AZ2L 1FAKT 2YUVA 4PP2B 1OY3B 5F70A 1E4XH 5CIPB 1BEYL 3DX7B 1A6UL 1QKZH 3NIFE 2A6DB 1JNHB 2JIXD 2XWBB 3EBAA 1MRCH 4MQXC 3DUHA 5HY9B 4AQOA 4KTDL 3QJHA 2HA1A 2BSRB 4ODWA 3OKNB 3D18A 4PJEB 2NY6D 1R5VB 3QISA 5J7CC 3SE8L 2IJ0C 1Z0MA 1U8JB 4FFWD 5FKPB 3U4EA 2BXZA 3BP7B 2NR6D 1A3LH 1F3RB 3CSBA 5EO9A 4KV5F 3Q0HA 5ACMA 3KHOA 4KKLC 3S6CA 3TZVD 2YEZB 4EQ3A 2P8LB 1BGXL 4GOSA 4Y4KD 4JFOA 2EC8A 2ZCLL 3PWNB 1ULVA 5FA4A 4ISVA 2F5AH 1N6QL 4KMQA 3VGEA 3EOBB 3V7MA 4Z7VF 3ZYIA 2QADD 1YJDC 3TJEH 1MAML 1KN2L 2J6EA 4Y0GA 2HYMA 3PNWA 1HNGA 1N26A 2HG5A 4YJZL 1CR9H 3GRWH 2CLZB 1OAQL 3S96B 3TBYB 5GZND 1B0RB 2YMXL 4PJAF 4F58H 4JAMA 3RNKB 4XPFH 3P4OA 3AXLB 1MI5A 4OQ1A 3X17A 1JGEA 4KK8C 1IC7L 2J3SA 4RMSA 4FQXA 4Z7NF 1J1PH 1F6AB 1CGUA 4NSKA 3QIBA 3O4LD 5ANMA 1RZJL 4X7TB 5FYLE 7CGTA 5B38G 2R69L 4BK5A 1G9NL 4PJCA 5GZOC 5AD0A 1XF5A 5IFJB 3T0EC 4Q2ZA 4EKXA 4AH2B 2DL2A 1C08B 4P46C 5D7SH 2ADIB 1JYWA 2R4SH 3IJHA 4L8BB 4MJIB 4Y5XC 4L8CB 3JTTA 4IEFB 5EUKA 5TE7L 3TBVB 1WVZA 3FO9A 2ADFH 3MNVB 3SDDC 4JCMA 1TCRA 1WCBB 5CMAB 2DQUL 4L3CA 5ELIA 2UV3A 4KDWA 1OTSC 4HSQA 1FYTB 3FTGA 4G3YH 1S7RA 4YHMH 1YECH 1G7LA 3CD4A 1MI5E 4HUWB 3L7FB 2J5LB 1BP3B 2HKFH 4ONGH 1U8OB 4P5TD 2GCYB 4QHNA 3HR6A 3GSNB 2H32B 5ANME 3UJIH 4GXVL 3ZE1E 4M7ZB 3R4DA 4PJCE 5EC1A 4N9GB 3QHFL 5JW5A 2WBJD 2NXYC 4KI5D 1MVUB 3NFPA 5HJ3A 3IXTA 3T1WA 4WHCA 5FGCE 3MRIA 3DLQR 3AS2A 3VFGH 4D9LH 1R3JA 1U8MB 2FRGP 3T3MF 4JN2A 4NQEB 5IMKB 4F15C 1UZ6E 1NCWH 1HIMH 2BY2A 2H6PB 5DWUL 3O3BA 4HAGA 3MLSH 5B3JF 5I19L 3MA7A 4LLQA 4OTXH 5IP4A 1Y0LB 3EO0B 1LE9A 3G5ZA 3L5WB 5EORL 3U0WH 2A6JB 1CD8A 3QIWC 4HJGB 1KIUA 4BH7B 4F7EB 1F4WL 2BVPB 1AGCB 3KPPA 4JG1L 3TZVA 3MREB 4QT5B 4HKXB 3QDHA 1IAIH 3CK0H 3HZMB 1NCCH 2CUHA 4KTEL 2W9DL 1JGVL 4PJGB 3DRQB 4M8QA 2X2YA 5I1JH 3QA3B 1QA9A 5J1TC 4FQCH 4P99A 4HWZB 1NBYB 5IHBA 1J5OL 4HGMA 2YHGA 3RWJB 1S8DA 4RGND 3VH8A 1A4KB 4ELKB 5K9OA 3VD9A 1XIWC 1GZPB 3HMWH 4JREB 4Q9BA 1GGCH 3RNQA 1MIML 1NCAH 4ZD3L 5I1KL 5I16A 1V7NL 4D3CH 5ICXA 4E0RA 1NEZB 3LPWA 3BIKA 4F9LC 4YNYB 5MI0C 1XR8B 2X41A 3ARRA 4L4TD 2YD4A 3O4LA 4JHWH 2XG5A 1GYAA 5JOPE 4L9LA 4ETQB 4OB5H 2MSPA 5DJAA 3NTCL 1G9MH 2ZSWB 5D1ZB 1QBMH 2X4SA 3MOQA 3BI9X 2V17H 3L3OA 3IU3B 4H88L 5H37H 1BECA 5IT2H 3QUYA 2NW2B 4G8EA 1WEJL 4QRRD 4TNWK 5D8JL 5JW4M 2OX5A 3S5LA 4PGCA 4JY6A 2BK8A 3G5VB 5F1IA 4PRHB 4GW1B 3NFNA 2Y36H 2DL9A 1IM9D 1CE1L 1GGYA 1ZT1A 4ZDHA 5DD6B 1RK1B 4QWWC 5KOMC 4ZUWB 2OCFD 2P46B 1KUMA 1NAML 4FFYH 4Z9KB 2P5EB 5HVHB 1IMHC 4P5TA 1AXSA 5DRNA 4U1HB 1S7SA 3EYVA 3IKCB 3O4LE 3VG0H 5K9KB 1I7RA 3UYRL 4O2CA 3EGSB 5J9PB 5DJ2A 4M5ZH 2FJGA 5DUPL 5EOTB 1AP2B 1NEUA 1YEDA 2WBJA 3MJ8B 4X7SL 4NM4H 5E94A 1B90A 3D85D 4A2LA 4YDLC 1UWGH 3F5WA 5EN2A 5GSRA 5ADOL 3JUYA 4LSSH 1LGVA 1ZAGA 5IVXF 3GGWA 3MV9A 4AL8L 4XHQA 2H3NA 2VDPL 4S1QL 1MFCL 1MCDA 2CDGA 1WFOA 2P1YA 3MFFA 5SX5K 3UO1L 2F58L 3P0YL 3OZ9L 3EJZC 2CJUH 3RIAF 2H2SD 5E8DL 3SGDI 3U9UB 4OCNC 5EZIH 4K7PY 1DEEA 3HRPA 3S98A 4YHLL 1DLHA 4UT9L 1FJ1A 5E2VH 1KXTB 5GQBA 3ALPA 1I8LA 1QP1A 4KI5E 2EXWD 3WIHL 4GAGL 4U3CA 4I3RL 5HHNA 5FUOH 3V6FA 5CJQL 2DQDH 4HT1L 1U3HC 3OXSB 3R1GL 1CF8H 1CFBA 1H15A 5FKAA 4MAUH 1EGJL 4R0LA 5T5NG 3L3DB 3QI9C 1LO3H 1R3HB 5HYJB 3TESA 2UWEA 4Q9QH 3VFMB 5ID0B 2VQUA 5C9JA 4YXHH 1B4JH 4LSDA 3LQZA 4V2BA 4L29A 4O2FB 2I25N 3B3IB 3EYSH 4LOUC 5HHVL 5IB1A 1CI5A 3BKYL 5DHVB 5GRJH 5JHDB 3Q1SH 3N85H 4ESKA 4NJ9H 1OARH 3AS0A 8FABB 3LQAL 2CK2A 4YHZL 2FIKA 1A4JA 2DIJA 4NRXB 1CFNB 4QRRA 1P4IH 1D5BA 1H3GA 1P7QA 4QRUB 3BGMA 4Y8DC 2DBLH 3C5ZC 4Z18A 3BMWA 4RGNE 1T1ZB 3SKJL 3ULVF 3RY6C 4G43B 4JCLA 4P3CL 3VRJA 1KTKE 3FAWA 4CW1B 3GMNB 1B2WH 3O3AB 4HKBA 5I1LB 3OKLB 2JK5A 1TZHA 1HHHB 4JY4A 4KMTH 4FN0A 4GKSB 1F90L 3KPRD 4OZFG 2J88L 3U4AA 1KB5A 2UWEE 3OJDB 4OLWH 2AQ1A 1LK3H 4IRJD 4XPAL 3JWNC 4L4TE 4MSWB 5HGBB 2NY1C 3SGJA 1MCWW 4K7FB 2UZIH 4FFVD 1TMCB 4BZYA 3SO3C 1QFHA 2VSCA 3D85A 1V3LA 1I75A 4CRPA 1U2CA 4M6AA 4HFUL 5E8OB 5EO0B 3E6HB 3P9LA 3VI3E 3DHJA 1ZLVH 3PWLA 4NO0B 3G5XA 1E28A 4CMMA 5A2KH 4QRRE 4MMZC 3WFEL 1A14H 3OBAA 2QHRH 2VR4A 1XCQB 2CIKA 1KN4H 1FGVL 4NBXB 4NJAH 1TCMA 1RULL 4N8VA 5D7IB 4BH8A 4JKPH 3IU4H 1IC5L 3OAYK 4PRBA 2D7PA 5HYQA 4WGVB 5AG9A 1PX4A 2JB6B 3LKSA 1IAOB 3I6GB 1YNKL 4JR9L 4K3DL 2WK2A 2EE2A 2DJ4A 3Q3GA 1H3UA 1T66D 5FAAA 4EOWH 5I1GH 3UAJC 3O41A 1JF6A 3QXWA 5KSUA 3AY4A 1DQQB 4NWUH 3DO7B 1CG9B 4X8JB 2X7LA 5CD3A 4CJ0A 3MBED 2D03L 2R4RH 2HP4A 2W07A 5D4QA 3BP5B 5HYSG 2R1XB 4N9OB 1MCLA 1XF1A 2DQJH 2ZOLB 1RIUH 4L9DA 4M93B 1LEGB 4RISL 3P30H 1J11A 1G7PB 3RX7A 4FQXC 3B5GA 3HB3C 3TNMB 5GGTH 3QIBC 2EEBA 1FFOA 3FT4B 4U2ZA 2XNAA 1TLKA 5F3HB 1AY1L 2W92A 5DA4A 3T0AA 1G0XA 3FCTA 4HKJA 2R0WH 1QNZL 1FSKC 4B41A 5I75B 5DJCA 3D6GA 4NQDD 4DWHA 1E4WL 4XVSL 1NDMA 1AIFB 4JFED 4MD5B 4APQD 4MA7H 4A6YA 5HHME 3EHBD 5EBMB 3QULA 3ZKNC 5D7KE 1QSFD 1RUMH 3O9WA 3D3VB 1ZA6B 5JDJA 4MYWB 3FQWA 3TP4A 4Y88A 2VN7A 2VZTA 1U0QA 1DQDH 4ZXBD 4P2OA 4N1EA 3TPUA 1ODAA 4KXZH 3GIVB 1AGFA 1PGRB 3SOBH 2OR9L 4KK6C 3IFOA 4Z7QF 1INDL 4LBEA 4Z0BL 3STBA 4IS6A 3MRPA 4C56B 1G1YA 3GJFH 3KPRA 3F8UB 4PUBL 3HFMH 3V4PH 4GFTB 4OCSL 3MXWL 4IRJA 1KJ3H 4JO1L 1KCKA 3QCUL 1UJ3A 5JZ7D 4S1SH 4QHUA 5E00A 1A8JH 5CFHA 5IBLD 2DLEA 2ZZUT 2QQKH 4G6MH 5FEBA 4QOKD 4U6XB 4JFQB 4Z0XB 1K6QL 1UADC 2A9NL 2NY6C 4JDVB 3P0GB 1JRHL 4KAQL 4FFWC 2IH1A 5DD5L 3DSFH 1JZ4A 4JQIL 2NR6C 3E2HC 3MACL 3QUKB 2B20A 4QTHA 4MQ7A 3TT1H 1U8PB 3H3PL 4XZUB 4OGAD 4UIKL 1T21A 1DBJH 2NY3D 1ED3B 3TZVC 1KENL 4B53A 4X6EB 1NC4A 3QUMA 1G7JA 3KPRE 2HT4D 1A22B 2E27L 1KJ2H 1SJEB 3DX8A 1L6XA 1NUDA 5DF0A 2QADC 1TDQA 1MRFH 5IQ7L 2Y5EA 1JWSB 5C0EB 3MBEA 3IFLH 2H26A 1CT8A 4QHLB 1A6ZB 1TJIL 1FIGL 3G08A 2M26A 3ZHLA 5ENWA 3TBTA 3OF6D 4OUOA 4L4VD 4JANA 5GZNC 3VH8G 5HGAA 1CBVH 4P0DA 2OZ4A 1Q9WA 1OAXL 2FB4H 3SDAA 3VD3A 5I8CB 5F3BB 2XKUA 3O0RL 1ZSDB 1MQ8A 3GBMH 3SKNA 4IM8A 1H8NA 4WENB 1A7NL 2Z92B 4U2YA 1NSNL 1A1OB 3NCMA 3RWEA 3X12B 2E9WA 2GFBA 3HI5H 4YO0B 4YPJA 2Z31A 2XTJB 4KJQD 4ONFL 2FCBA 3GI9H 3MLTB 1A2YA 2GUOA 1X5AA 4MB3A 3KLDA 4MDJB 3QR2A 4IRZL 5DEZA 3BN9D 5DK2A 1BLNA 2V2XB 5CSGA 3EZ8A 4J3UA 4PRID 1QSFA 1IQDB 2ZUWA 5F72S 5SWZB 3S5LG 5ITFB 4X9GA 1QBLL 2K7PA 4HIJA 4KRNA 3HR5B 2RCSH 3I3DA 5ICZB 4D0CA 3B6SA 5IMMB 4ZXBA 5B39G 3D25A 1MLCB 2BFVL 1T7XA 4DAGL 4NKIH 4P5TC 1HH6A 2YKLL 3B5TA 5DJXB 3HPLB 1VACA 2EH8H 2J12B 3AVEA 1KPRA 2GIYA 2C3WA 2X4UA 3T0EB 5F9WC 4HDIA 3KYOB 5AZEL 2WBJC 1G6RH 3K8KA 3PF2A 4KI5C 4NO2B 5B22A 1PG7L 4UNVA 1PG7W 1VFBB 1TJGL 1YNLL 1URLA 4FQHA 4Y5XB 4YBLC 4OAWB 1PQZA 1CVSC 4JFEE 4MXWL 4F33B 2AEIT 3WD5L 3ULUL 1T0MA 1QLRA 3VXSD 2E5EA 1UB5B 1L0YA 3TCLA 1FNAA 1QSFE 1EHXA 1MFBL 1IKNA 1CFQA 2EECA 3UPAA 3BH9A 3MO1A 5IEHB 2JJTA 1CE6A 5I1CL 3MYJB 5I18H 3IT8D 3JVGC 3MRJB 1RZFL 4R7DB 1JWUB 1WK0A 2VDLL 3HN3A 4PLJD 3TH3T 3U7WL 4J12A 2DDQL 4WHDA 4HWBL 2DS4A 3F58H 1PKQB 1MHPH 5CLWA 5I1HH 1JHTB 4CKVX 5FECA 3UJJH 1N5AB 4JM2D 1T7WA 1IGCL 1WBYA 2NXYB 1I8LC 4PRPB 5C07B 2NXZB 1ZEAH 2VITA 1F5WA 4B7IA 1RJYB 3L3IB 5CWSB 5DMYA 3G6JF 1AQKH 4YDVB 4Y5YA 3D69B 5IESH 4F15B 1KELL 1XF4A 4NC0B 1W8NA 4RGNC 1M71A 4Z76A 1YUHB 3FQRA 3OF6A 4KQ3L 2FJFB 3GSVB 2ARJA 3P0VL 3RVXD 3QSKB 1KXVC 4R0LC 3CSYA 4NQXA 3GKWH 3QIWB 1JMZA 4OZIF 3GSNL 5F93C 2ATKB 3HI1B 4DKEH 4EI5D 2VNCA 3LKQB 1L7TL 1S7QA 3BWAB 3VXTB 4GXUM 3SE8H 3OG6B 3QXAA 4F7TA 2APWA 2EDXA 2AJZB 4XH2A 4MCYB 4LEOB 1HHKA 1R24B 1MCKA 1FRGH 1DDHB 3FB8B 5F97E 1HH9A 4ZFOB 1IVLA 3F7RA 4KKBD 3BE1H 3L7EB 3N06B 4RBPH 4ODXA 3KDMA 5DFTA 4X99A 2ZUTA 1CD1A 2AK1L 2FX8H 1UXWB 2E7HA 5H8DA 2B2XL 3NIDF 3ZTJH 4ODTH 4U4BA 4U6YB 4O58L 1X5XA 4HIIA 3HNSH 1CTNA 4NP4L 4RSVA 2EDLA 5K59F 3T0WA 1EEZB 4WEMB 3SDCD 5MI0B 5T3ZD 1J0ZA 3D2UB 1U8NB 4Z78B 3EOTL 1KCRH 3VGBA 1TENA 1XF3A 4U1IB 3SGJC 1YY8B 4OCXH 1P2CA 3M07A 5DMGD 3MV8B 2VUOA 4P5KB 1VESA 3BOVA 3W9DA 1D9KD 4PRAB 2WWMD 4XPHL 3VI4E 1I9IL 5JPMA 1AI1L 1VFMA 5JXED 1SVCP 4G42A 3PGCA 4B0MM 2F54B 4R97B 4UT6L 3K4AA 1VFAA 4GAYA 3WLBA 3LKOB 1IT9L 3IRPX 4LLDB 3TO4B 1RU9H 4EVNB 3IDIB 4ODSL 4ZTOL 3VXSA 4H25B 4PRIE 4YHOH 2X9YA 5ALBH 3PHOA 1P6AB 3GZKA 1R3KA 4O02L 5GGSY 3BVNB 3KLHD 3NH7H 3RY5A 1Q0XL 3RX8A 5DJDA 4ZUVA 5L2JA 5DMJB 2H2SC 2XXMB 3GSOA 5D1QD 1QFWM 1OLLA 2A38A 5GRWA 2ICEB 3AY4C 4JM2A 4QRTA 4F7MA 1GAFH 5DLML 2CDEA 4F8TA 5T33L 1KB9J 4I77L 7FABL 4AEFA 5D2LB 3QNYB 3I75B 5I76B 4URTB 5BV7C 4ODHL 5HDQL 2EXWC 4YDLB 15C8L 2OSLB 3FN3A 4EUPA 1FGNH 4XVTL 1D5MA 1KFAH 1KTLA 3E6FB 1IILE 3QPXL 4M7LL 4X80H 4M4PA 3QHFH 5FDYA 3VXSE 2YD1A 5I74B 2MPAL 4PY7B 2VRAA 1H3PH 2PW1B 3RWDA 1T6WA 1I4FA 1MWAA 1OTTD 4NBZB 1VFOA 2VC2L 4KC3B 2I24N 5EUOB 3UJTL 4M7JL 5B4MD 4RNRB 5DDHA 5ETUA 3DX9A 3FFDB 4EI5A 1JFQL 2P4AB 4X4ME 3X11A 4RFEA 4XCYA 1IAMA 5T1MB 3A6OA 3HI6H 4OCRL 3C6SA 2OTUB 4GSDL 2HMID 1IEAB 4M1DH 2YUXA 1KPVA 5E9DD 3C08H 1QUNA 1KCVH 5EU4B 2W38A 4DW2L 4JDTL 3GB7A 4QXWA 3MRBA 3SDYL 3BYTA 3V79C 4HUXB 3IS0X 3MRLB 3ZE0F 4OM1H 4P2OC 4CDGC 1U3HB 2H8PA 1YQ2A 4K71B 4MZ3A 2I9LB 3BQUB 3RL2A 2HJLA 4QY8A 3UPCA 2IBZX 5H35B 1X9QA 1CXIA 1Y18B 3QI9B 3SDCA 2DYPB 3OX8A 4JO4L 4MA1C 3KPSA 4ODVL 5D6DA 4IRJC 4XCFL 4EDWH 2YPLB 1JGLH 3MNWA 2CSPA 3PV6B 1UJ3C 1ES0B 2RHEA 2VDOL 3DURA 1ACZA 5F7DA 4FFVC 1A7BA 3EOAA 1D9KA 2G60H 1MCFA 3BDYH 3EFFA 3B2VH 3CXHJ 5DFWH 4G9DA 5SWQB 1CZ8L 3P9MA 1XFPA 3BESR 3K1KC 3LH2L 4MCZA 5JXEA 4UQ3A 1IZJA 2Q76B 4GO6B 5E8EB 3ARZA 4ACPA 3D87B 4OZHF 3Q6GL 1UCBH 3RVUD 3FQUA 3IJYB 1SJVA 3V0VB 1RZIB 1YA5A 4QO1A 3STLA 1OT2A 4UUJB 3RJDA 2BNRD 5MEPA 4JB9H 2WUCH 4OZFB 2FNBA 5DJ6A 4X5XB 3S37X 4XNXL 1VGEL 2PTTB 1JV5B 4XNUH 1AGBA 4N0YH 2ZSVB 2DTML 3KPSE 3FB7B 1T66C 4JPWH 5FUCE 4FABL 4Q9RL 5AAWA 3Q6FA 1KJVA 2G2RB 3BZ4A 3CVHH 3SO3B 1OTUC 3MBEC 2NPLX 1EO8H 3MR9B 4Z7OE 1RIHH 3ZDYE 3FT2B 3GMLA 5FDWA 3TA3D 5FO9A 5I1AA 4U1NA 2VXTH 4WUKL 2BRRL 3MRNA 4ZYKA 2AQ3A 1FZJA 5T1DH 3W39A 4TUOB 3HE7B 4DCQB 1IEBB 2C1PA 5EO9B 2AEPH 4NZUL 1SYVA 1ZHKB 5J0BA 1II4E 2O61A 1KEGH 2W0PA 1M6OA 1MPAL 4J2XA 3L3KB 2NTFB 5HGDB 4WHTA 2GYSA 3RWGA 1HK6A 3J7HA 3QFJD 5FA3A 4CVUA 2BHUA 2Q3AA 4O9HL 2EIBA 1CQKA 2L7JA 3FZUC 1RUQH 2XZCH 2LU7A 1NBVL 3WDJA 5KSAA 4ORGB 5DVOA 3GSUA 4NQTA 4PGEA 4HS3A 5EH1A 2VE6A 1ZT7A 4OD2A 4APQC 4HC1L 5HYSB 3SKOA 5E9DA 3EHBC 2HG5B 5ILTL 1RZGB 1KNOA 3CFEA 5E8DH 1MFAL 1QFWH 3E3QE 2FH8A 1FG2A 3G04A 3LKPA 5J6GB 4JO2L 4I1NB 4LRNH 4O2EB 4QXTA 4JAMB 2JB5H 5H94A 4ZXBC 3SQOH 4JLRA 1CDBA 1CDGA 1JGEB 3X3GL 4G8IB 1IGJA 3K80A 3TWCH 5C08B 2BNQD 4FQXB 4UTBH 3GM0A 3WS6A 3MCKA 3QIBB 5ANMB 3W2DH 4MZ2A 4OT1H 1NJ9B 5AD0B 1FLTX 2FHFA 4X7CC 4M1GH 3PDDA 1FSKB 5D5MA 1MFEH 3QFDB 5FUZH 2VKWA 3DVFA 4PD4J 4AENA 4CVZB 5I17B 1BOYA 3QWRD 2VDRL 3IJHB 4MNQD 3HC4H 1EGJH 4KY1L 1ZLSH 1FLRL 3PE9A 3L95A 5EUKB 4OLXH 5IBLC 1NCTA 5E9DE 2FGWL 4M48L 1K8IB 1JHLL 4MAYA 3CFKA 5E4EB 1TCRB 1UC6A 1W72H 2R0LL 1SY6A 3CX5J 3QJFA 2PR4L 1IKNC 3LS5L 3RQ3A 5ITBL 4P48A 5IUSA 1I8IB 4WDIA 3EDFA 2JJTC 2DD8H 4PGBA 1OAUH 2YA1A 4JKKA 3LDBB 4NYLA 2M1KA 1M7DA 5HHVH 2BVOB 4Q0XL 1TETH 2E7MA 5E6ID 5MERB 3HZVA 1C5CL 2BNRA 3GK8H 4OGAC 1MUJA 1WBZA 2E3VA 5C7XH 1VSCA 2LU3A 5JOFB 2NY3C 3V9FA 5DTFB 5HI5D 5FM4A 4ZSOA 5FCUH 4DZBA 2CLRB 4NNXA 2HT4C 1A6TB 5D5ME 3BSZL 1I3RB 3NFPB 5F8QC 3KS0H 5AG8A 3V95A 1WWWX 1EVTC 3RZCD 5KAQG 3LEXB 3ZDZE 4QXUL 1RUKL 4Y5YC 3MYZA 4JN2B 1N6VA 2JIXB 3W82A 4JQXA 2HJFB 3QQNA 3DETD 4NIKB 3VA6A 5IFAL 2R1YA 2NY6B 4WFHE 4HGKC 1AFVH 3ZT6A 4XPAH 3TA3A 1C5DA 3T65A 1LE9B 3H9HB 3O6LH 4OCYH 4LSPL 2Y07H 3VFVA 2Q6WA 3MRMA 5DK3A 4AMKH 5B8CA 2NLJB 3EFDL 1MCIA 3P4NA 2OK0H 2YRZA 1HZHL 4P49A 2BNRE 12E8H 3NABL 3WFDH 3TVMA 2MMXA 1S7WB 5CSZA 4PJXF 2DTSA 4X98B 3KPTA 2CDFB 4Y4KB 5E6YA 2HTKD 2X4TB 3MRQB 2APBA 4L3ED 4ZSOE 5HD8D 1HXYA 1XR9B 2Z35A 5BXFB 1YEHH 4KJQC 3SCMD 1RHHB 2ZCHL 5DZOA 5CILL 2QADB 2F5BL 1QA9B 5C86A 3BT2L 3BN9C 4RQQA 3L6FB 3KR3H 2DKUA 2FX9L 4WV1A 1R5WA 2X1XR 5T1LA 1RUAL 1EXUB 1D5ZB 2PN5A 5GHWL 4S11A 4BQ9A 1U8QB 3QH3A 4JR9H 2AEWA 1ZANL 2OJEB 4G6AD 3RWIA 5FV2A 1ZTXH 3UCRA 1CDHA 4JPIA 1A7PL 4OF0A 3MNZA 4Z7WA 1CFVL 4WVRA 3SEPA 1OF2A 5ICXB 3VFPA 5HXMA 2DRUA 1S78D 4TNWF 5IF0A 1A47A 5DI8B 4XNYH 3N1GC 3OWEA 4TULL 4OJFH 5IVZA 4G9FA 1AO7A 1J12A 2AABL 2YC1B 4NM8L 4J3VA 2GJ6A 1HEZB 4LFHD 2I26N 2DIAA 5DJAB 4IMLA 5D71H 3M45A 2R8SL 2X4SB 2K3TA 5F1NA 5L88H 3QFJE 5SX4H 25C8H 4LSRL 1KCUL 4DKFH 1DUZA 1QYGL 1EAPB 4J3SA 1Q9LB 4C83B 4NN7B 4WW1A 1FVEB 1MHEA 1NAMA 1FORH 2YK1H 1C12A 4H5SB 4HAFA 8CGTA 2C1OB 4P3WA 1AQDA 2CRMA 4PGCB 1AJ7L 1XGPA 2H9GA 4KDTA 5F9JA 1GC1H 2GAZB 4KROD 2GHWB 1NGQH 2DQEL 5B39B 4XTRD 3GMMB 2MHAA 3I2CL 1WLHA 4Z7WE 3MLPA 1ZHLA 2BVUA 4F7CB 3OKOB 3H2WA 1DLFL 4PLJC 3HCVB 1KTRL 2Z0BA 1WV7T 5E08H 5SX5H 5E6IA 1F3DJ 4ZFFB 2NY4B 5DRNB 3UEZA 3EYVB 1MAKA 3QEUB 1F2QA 1JN6A 2H1PL 2V7HA 3KLAB 3VFWB 3OKEA 1DQLH 2GJ6E 3I50L 2B1AH 1ZGLB 3OPZL 4JM2C 3HC0A 1LP9B 3OAUL 2IPKB 1LO0H 1WFUA 3DVIA 5BOZG 1DBKH 1NC2D 1MJUL 4YDJA 3DUSA 4NT6B 2JF1A 4YBLB 3RZCA 4MNQE 1EEYA 3WL9B 1INDH 1ZS8A 3TEUA 5I66B 3V0WL 3FMGH 3O2WL 2V2WA 1UYWL 1T3FB 4EUPG 4R8WL 1X3DA 4H8WC 5DRWA 3BHBB 3RVXC 2OL3B 1FNHA 3ARYA 3LEVH 4OV5B 4GS7C 3P4MB 1TVDA 2BY1A 3RL1B 3MLUL 4KJWD 4GG8A 3CDYA 4PJIB 4EI5C 2FD6H 2VERN 5GRUL 5IOPA 2AXGA 1I1AA 3LN4B 2VDML 3RAJH 2AV7A 4JRXD 5C71A 3EAKA 1TZIB 1DLHB 3GI8H 1JF1A 4JQIH 4N0RA 3EYQD 1AHWB 1UA6H 4HXBL 5KOVC 4WI6A 1NUNB 4FNLH 3MRCB 4NOFA 3K1DA 4KKBC 2B0SL 5F88A 3V6FB 2HLAB 4ZFGL 3B4NA 1FN4B 4H1LG 1IKFL 3AGVA 3CAFA 5L7XL 2XG4A 4RGNB 4FQIH 1QG3A 3EYUH 2E27H 1OPGL 2D7TL 2XI9A 1LNUA 1GSMA 5K9JH 2ORBH 5SV4A 4ZUSA 1DANU 3MRGA 4Y1AD 4PJFF 5D70H 3SDCC 5FHAH 5FYJL 2UWEB 3PWVA 5D6DC 4L4TB 5FUCC 5C70A 4I9WD 4M6NL 5DMGC 5BVPH 1CIDA 5D1XB 2Q87A 1D9KC 3VXUB 4LP4A 5KSBB 4FZEL 2WWMC 2PNDA 4LHJB 4I3SL 2YPVL 3CFBB 4JJ5B 1WGOA 1YPZF 4PB0L 1R3IH 2B39A 5IBTL 1I1RA 1T1WA 5JXEC 4Z7UA 2FZ3A 5IK3B 1A4JB 3S9DB 2YSSB 4QRRB 3BGMB 2IALA 3STZA 2B4CL 1WZLA 2OP4H 2ENSA 1WICA 5MEQB 4PJHB 1KG0B 5HI3D 2FLBT 4I0PD 2VDKH 3VRJB 1IM9B 1RFDL 4WY7L 1FO0B 5LXGL 2OJZL 2CKBB 1ZWIB 1T2QL 4QRQA 5KVGL 2X4QA 4H26B 2YN5A 3OAYH 3P11H 3U36A 1TZHB 1UM6H 3KLHC 3L1OL 5GISH 1OGTB 3DUUB 4F3FA 1KB5B 2FDBP 3B8YA 1T83A 2ICCA 3O6MH 3RDTB 1T03L 1KIRA 1FVCB 5D1QC 3V4VL 2O5YH 4Y19D 3CC5B 3MRRA 3VXMA 1Q0YL 1EDQA 1T5WA 4R4BA 1NFDA 1ERNA 2R0ZL 3MROA 1J8HD 4LLUA 2I60L 4ZFOL 4K7PX 1VEMA 1L0XA 5EOCH 3BZEB 5HGHB 4R2GB 1Z9SA 5FYKH 4Z7UE 1OD7A 3O11A 4JQVA 3UTOA 3QRGH 4PJBA 1E28B 1LVEA 1Q1JL 1FCCA 4YHYC 3BKCH 4BJLA 1V7ML 1V8HA 4YIQB 3S88L 1JZ2A 3GBLA 1A6VL 3DYOA 5AYUL 3D0VA 3BEWB 5T5FL 4TUKL 1NANI 3VGHA 1L9MA 2XTLA 4I0KA 4PRBB 3KPOA 4N68A 1N0XH 5ESAB 1NGZA 3LKSB 5EU6D 4Y89A 5B4MC 1XT5A 1P4LA 3DGGA 3GBNH 3IETA 4LLYB 4YDKL 5FM5O 1GPOH 3WDHA 4ZUUB 2B7DT 3LKRA 4JRXA 4ONHB 3VXME 2MCPL 5KSUB 5HDBE 2HMIC 3TNNA 1GOFA 3K2UH 3L3JB 4DTGH 1NFDE 3OTTA 4QCIA 4LDOB 4M62H 2NY2D 1CICA 3VGFA 1GGIL 2ARJQ 1UB6B 1G9NC 1NCBL 4NN6C 1CCZA 1A7QL 4XC3H 1MHCB 4IIQB 1VFUA 4PJBE 3V0AC 3BRDA 1P7KA 4UTAL 5DRXA 3BEVA 5LGJA 4BQCA 1EBAA 1RK0B 2XY1A 3KG5A 4X9IA 3WS6C 4CNIA 4JFHD 5J6HA 2KKQA 3FKUS 2BDNL 2DWEA 5IQ9B 4OLZL 2JCCA 3OKMB 1JUFA 4JDZA 5FO8B 3QBTB 4LLWA 4AEEA 3ARBA 4K9EH 1INEL 3SGKA 1J18A 3AAZA 3O3DA 2D4FA 4IDJL 5JIHA 3FO0L 4C4KT 1WF5A 4JRXE 4D0BB 3T3PF 1AXTL 5IKCA 3VJ6A 5DJ0B 3QULB 4J8RB 2FWOB 4HFWB 3ZT5A 1UM5L 4XCEB 4Q6IC 3PL6A 4HULB 4HBCH 1WUNT 4JZOB 4P9HC 1N64H 3KJ4C 4ZOEA 3RPIB 3RVUC 2VOTA 3WN5B 1NBZA 2HT2D 1AGFB 2EKSA 4I0PA 3EYOB 3IFOB 4GG6F 3KPMA 2V2TA 1SYSA 2PYFA 5EWIH 3ULUD 1TJHL 3PXHA 1DBAH 4IS6B 4PGJA 3MRPB 1R3LA 2DQCL 2JCCE 4Y1AE 2MQ0A 3RY4A 5C2BH 4LCWD 2W9EL 4MA1B 3T4AB 5CEZL 3VMPA 2JJSC 5I8OL 2EZ0D 4I9WE 4Y19A 1UJ3B 1ZT4A 3VWJD 4G7YL 2YD2A 5E5UB 4YHIA 1NLBL 4JQXC 1J8HA 4PR5B 5IJVA 1Z3GL 1GOGA 2RFXB 2Y9RT 5D7LA 1KLUA 2Q7YA 1I1FB 3TA3C 1T2JA 5DVNA 2ENYA 5KW9L 3VWKD 1IBGL 2AJ3B 5B8CC 4S10A 5DYOB 5DEFA 4D94A 4QTHB 5E8PA 3EYFA 4XNQA 4HS8L 1AGDB 3QHZH 3HAEH 2E9BA 1ZV5A 3TVMC 2D2OA 1VA9A 4PBVC 3NCYS 3IFPB 3H7LA 5EU6A 4N5ED 4GT7A 1K85A 5FK9A 4BM7A 1P53A 2YD7A 3CFJA 5LBSH 1A7RH 2I5YH 5AWNH 1QPPA 1CGYA 1VENA 1E4XI 4Y19E 5CP7B 3S4SA 5B3NA 4WV1C 1JGUL 2BVEA 4RGMC 4P9MH 4PGDB 1J8HE 3QUZD 4LRIA 1Q94B 3MOBL 3H0TA 3A6CH 5J12B 3RUGA 2AXHA 5D7LE 1KLGB 3KXFD 3CCHA 4Z8FL 3KPQB 4DKAA 3HG1D 1XGRA 2YS4A 4XB8A 5HGAB 4JFZL 1BX2B 1EERB 1F4XH 4XXCA 4H0IA 5CIPA 3DX7A 1V3KA 3JWOH 3M1BB 5T33H 3W11D 1JNHA 4NQED 2XWBA 3HNVL 2OMNA 3MX0A 5HY9A 3EJJX 15C8H 2BSRA 3OKNA 4PJEA 5FXCH 4P2CG 2YZ1A 1R5VA 4CU6A 4ZS7L 1U8JA 5EU6E 5FKPA 4Y7MA 2OI9C 3BP7A 3TIEB 4NQDB 1LDSA 3DVGB 3KWWB 4MJ5B 3DMMD 3MLVH 5HHQB 3PABB 1OP9A 3LRSB 4JFEB 1A6PA 4APQB 4LCYB 4GW4B 2YEZA 2DQGH 3U4BH 2P8LA 5KTEL 1DANT 1QSFB 3PWNA 2O5ZL 3RUGE 4K94H 5DC9B 5FGBA 3DROB 3EOBA 4AG4L 3M17A 4XVUD 2AJYH 1RY7B 1WZ1L 1F3JB 1WQVT 2LTQB 5E6IC 2PYEB 4XPTH 3P3YA 1YN6B 2VXUL 4PJEE 1VACB 3SGEI 4JPKH 5HI5C 3TBYA 1N5YH 1GIGH 5GS1B 5DJZB 4LCWA 1A1NB 3AXLA 3AS3A 1C5BL 5BOPA 3INUH 3QEQD 3NCJH 1NCDH 1B9ZA 3RZCC 4FQHB 5JQ6L 2DAVA 1F6AA 1PQZB 2VISB 4HBQA 3HZKB 1X5LA 3V4UL 1F4YH 4I18B 4M02A 4X7TA 3I85A 4HWBA 1E6OL 1T0MB 5JW4R 4QOKB 3DETC 3RKDD 4OCWH 5IFJA 3FRPA 3S36X 2CPCA 2A73B 4AH2A 1HKLH 2ADIA 3E8UH 1K8DB 3VWKA 3MV7D 4L8BA 1FPTL 1I8MB 2Y6SD 4L8CA 5LQBL 3TBVA 3V2AR 3MNVA 3ZL4L 3ARGD 4LL9A 4PRHD 1WCBA 5CMAA 1I1AC 5ADPH 3NFSL 2NY3B 3QDGD 3ULUE 4NHCH 4G8GB 2NY7L 1FYTA 2OBGA 5LGHL 4UIMB 2HTKC 4PPTA 2V5SA 4JJHA 1H0DB 3G6DL 5HD8C 1Q72H 1U95B 4LCWE 1MJ7H 4HUWA 3L7FA 2P5ED 5TDPB 1U8OA 2GCYA 3QWOB 2X9XA 4LU5L 2H32A 1SJHB 3GSNA 2VMFA 2HRPH 3QO0A 1EJOL 1T04B 3QUZA 4WJ5B 5KZCB 2QL1A 1HSBB 1D5XA 4N9GA 4WI4A 1IM3B 4Z76B 4XPBL 2FO4A 4G6AC 4L4VB 2IPTH 1MCBA 1MVUA 3GHBL 3QT2A 2HFTA 1OAYL 4TPRH 2AJVH 2XYCA 2VTFA 2N4IA 3C60D 1LQSR 5IWLC 1X7QB 1S78C 4NQEA 4FOMA 5IMKA 2XRAL 1Z0NA 2H6PA 1S7QB 1RZ7H 1Q38A 5JW3L 4BYHA 4Y2DD 1FYTE 1Y0LA 1WBXB 3L5WA 4XH2B 2A6JA 3NCYP 4E5XA 3F65A 4LFHG 5I73C 4HJGA 1S7XB 2J8UB 4M6ML 2H41A 4BH7A 4F7EA 1IGFL 4JRYB 5I15H 1AGCA 3U9PH 5HI4D 3K46A 5IGXL 3MREA 4N8CL 1I9JL 4QT5A 4HKXA 4PRIB 3HZMA 4XCCL 4OFDA 3KXFE 4HIIB 4HCRH 4KROC 4R26H 3HG1E 4PJGA 1F45A 4XTRC 3DRQA 3VFNB 4XP4H 4FQJL 4JY5H 2ERJC 4NQEE 4HWZA 3V7AE 5BVJB 2OMBA 1T83C 2VQ1B 3RWJA 3S3SA 4U1LB 4ELKA 1A4KA 1GZPA 1P2CB 2EDJA 5C09D 5I8KL 4KDVA 4QTIL 3S3PA 4UV4L 2VXSL 3TH4T 4OM0H 3OJ2C 5AYQA 1NEZA 4YNYA 1XR8A 4P4RB 1OM3H 1HXMB 3S97C 3CVIH 1RURL 4GMTL 1VFAB 1YEKL 4GQPH 1U3YA 5GGRB 1FFPB 3MLZH 4JGUA 4ETQA 1XF2A 4ELMB 1YEEH 2XZZA 3U46B 1P4BL 3P9WB 2ZSWA 1NFIB 2E8YA 4AT6B 4PJGE 5KS9B 5DS8B 1KOAA 2AEQH 2XZAH 3IU3A 4Y4HD 1X4ZA 4CADB 2NW2A 4KJWC 4OLVL 3GDBA 4DVRL 3T77B 5I30H 3G5VA 3RX5A 3IGAB 4PRHA 5IROA 4GW1A 1PW3A 1J9CT 3L9RB 3MLRH 4GJTB 3QDGA 4NNPH 1U8IA 2VLRB 4NO3A 1RK1A 3EYQC 3EW3B 2DMCA 4U49A 2FX7H 2WWKO 4KUCF 4FA8A 5ALCL 4NN5C 4O5LL 3W9EA 5C0BB 4OBRA 1CVRA 2NY0D 2P5EA 2D7MA 4Q6YA 3WIFB 4U1HA 1U8LB 5GSVB 3IKCA 5K9KA 3FHQA 4MXVF 4X9BA 5K33A 5JTWA 5AEAA 5J9PA 1H8OA 3UZVB 1HILB 5EOTA 4LPYA 1AP2A 2IQAB 3HNTL 3VDAA 3D5OF 3MJ8A 1G9MC 3HUJB 1AR1D 1I4FB 1MWAB 4QNPE 3SDXF 3C60A 4CBPA 4NO0D 2GQHA 4HZLB 3RWCB 3DX9B 4EI5B 3ARBC 3X11B 3SGKC 3MJ9L 4M3KB 4PRHE 5D72L 5CJ8A 3N9GL 3QDGE 3TLRA 3VFOB 1F2XK 4FQ2H 1RZKH 3O6FD 2VO5A 3WNMA 4GRWB 3OR7B 4M7KH 1DQMH 4G80B 3PL6C 4H1LB 3MRBB 4WI7A 2QQNL 1ORSA 2P5EE 1EPFA 5GJTL 3CNKA 2DQFB 4WI8A 3U9UA 2NQCA 2K9UA 4XBPB 4JFXA 1LEIB 2HFGL 1M05B 2NNAB 3OAZK 1B6UA 5TE4H 2OL3L 5HI3C 1TVBB 3JTSA 4I0PC 3OB0H 2GT9B 3ORJA 2BSTB 1ZLUK 1I9EA 4HXAH 1FAIH 2CGRH 4JPVL 4ONOA 2W65B 5EZJB 1FDLL 1UGNA 4QEGA 4DJMA 5HDOA 1NMBL 1EZVX 1IL1B 1L9NA 1CD0A 5ISZB 1LK2B 5C09A 1JI2A 1OSZB 3FB5B 3HMXL 4PJDF 3P9MB 2EE3A 4FP8H 5CJOH 2WP3T 4ALAL 4UQ3B 3VFMA 4M6OL 5ID0A 1NPUA 1DQTA 2OS7A 2KQMA 1LO4L 1UWEH 2IQ9H 4K8RL 4DFHA 4Y16D 4E9LA 2QSCH 3BAEL 1LMKA 3O2DL 3IFNL 4UILL 5DHVA 3F7VB 3BIAX 5AAMA 3WSQH 5DQ9B 2FHBA 5CP3H 4W4NA 2OTWB 4JO3H 4OFIA 4NRXA 4OD3L 5L6YH 1CFNA 4DN4H 1WITA 3TIDB 3NVQA 2SEBB 3MGAA 2KZWA 4QHMB 1KCSH 3NGBC 2R2CA 1JPSH 5D1QB 5E2UL 3BW9A 1T1ZA 4D9RD 4KWUA 3QG6B 3ZE2E 5TDOB 1KJVB 4G43A 5LCVL 5C09E 4CW1A 4CMHC 3GMNA 4D0DB 5C8JB 3GSWB 3S4SG 3EO9L 4LRIC 5I1LA 3OKLA 4W4OA 4C56D 1HHHA 2NY2C 4KRLB 4M4RA 2LU4A 5FDWB 3OJDA 1NBQA 1WSST 1I3VA 2XQBL 3RI5K 1OP5K 4M5YL 5HGBA 4MSWA 2D4DA 4KKAC 4NKDB 4MWFB 4ZYKB 3ALWA 4K7FA 4D8PB 2CR6A 1FO0L 5I1IH 3HC3L 2BSED 2CKBL 1YJDH 4LHQB 3VDCA 3MRDB 4ZO7A 3MTRA 4RAUA 3ET9F 5JUEL 1WWAX 3O8XD 4HC1A 1IRAY 4YPGA 5E8OA 5D6CB 5EO0A 3O2WH 4NO0A 4WHTB 3RWGB 1HHIB 5DZLA 1XCQA 1HOCB 5JR1L 4YHNB 1J0IA 2BOBB 5FF6B 5J1AA 1MJ8L 1PBYA 3T04D 4HS3B 5D7IA 4OD2B 2PTUA 5E9DB 1G7MB 3ELAT 2VZUA 2VXQL 4GQ9H 1Z2KA 2JB6A 1L6ZA 3O45B 1ZHBA 4IJ3C 5C0ND 1KNOB 3I6GA 1IFHL 3LKPB 5FGBC 4OIIL 4P2RD 4QXTB 5CKGA 4JLRB 1DQQA 1CG9A 4GAJH 4X8JA 2HT2C 3QZWG 3U30B 3QDAA 3HZYB 3GHEH 2YUZA 4YQXL 5F7HA 2EDWA 3SN6N 3VCLB 2R1XA 3ULUC 1FNSL 3GSQB 5IFHH 4F9PC 3CZJA 1QRND 2ZOLA 1WAAF 1LEGA 4U1JB 5E7BA 1E0OB 1C16B 4OQTH 4CL7A 4OLUH 2BSSB 1EMTL 1FYTD 1G7PA 4LCIL 1JZ3A 1OWRM 5JHLL 2EZ0C 1ADQL 3TNMA 1KB9K 3VWJC 5D7IE 1PFCA 3FT4A 3KGRA 5C9KA 5DJYB 5F3HA 1BQSA 5JXAL 4LP5A 2XTJD 4Q6IB 1U6AL 3KYKL 2FJHB 3FRPG 4GW5A 4OD1H 3VWKC 4NYLB 2QSQA 2ZPKH 1AIFA 1X5JA 2D0GA 3O2VL 4MD5A 4C55A 2VXVL 1BBDH 1EHAA 3QYCA 4MQSB 5EBMA 4UT7L 1WBZB 1JZ7A 3D3VA 1ZA6A 2G5BB 1ZK9A 3IF1B 4NZRH 4Q9CA 2DLGA 1FL6B 4JKMA 4N5EC 1KF9B 2ICWB 3AC0A 2R56H 4KJPD 3VXQB 1R0AH 4WW2A 3NA9H 1KPUB 1EHNA 1T1YB 1OB1B 1PLGL 1E6JH 3IJSA 2AJXL 3WV0A 5DUMH 3I9GH 4M43L 1LDPH 4OFKA 5DK0B 4M7ZC 2WAHA 3QUZC 1YYLH 3LPGA 4WUUB 2A1WL 2AP2A 3DNKA 4LSTH 4C56A 2B8OT 5J57B 1OQXA 4RAHA 4OF7A 5EO1B 3TA3B 1C5DB 2P5WD 4YX2H 4NPYB 5CSBA 5A40E 3TV3L 3F7PC 3EJYD 3NAAL 1OAKH 3W11C 1HWHB 4GUPB 5AUMB 3VRLE 2CK0L 3SY0B 1H3WM 4XAWL 1GGBH 4JFQA 4Z0XA 2IG2H 3V7AG 3BPLC 4FXLA 3M8OL 4AEIL 4BZ1L 4F37K 5IMLB 3S88H 3QFJB 4OFYA 4WO4B 1MQKH 3QUKA 1PJ9A 4D9RE 2VUYA 1U8PA 5MEND 1CK0L 2AK4D 4J6RH 4XZUA 2XWJB 4ZUSB 3GKZA 5FYJD 1R5WB 1TVHA 4IRSD 4OKVB 3MGOB 5SWSB 4X6EA 1LO2H 3CUPB 2VQTA 4C56E 4ZMAT 5J06A 1JWMB 3RWIB 1JNNL 3FQXB 4JZJB 1CLOL 2NXZD 4JPIB 5C07D 1SJEA 1ZXQA 4Z7WB 4UNTA 4LEXH 1MVFA 2MCPH 4BSJA 4XVUC 3QXDB 4DVBB 5C0EA 2BNQB 2PUQT 3QIUD 2X4PA 3IDNB 2ZUYA 2FLRT 4OZGF 5IVZB 4QHLA 1A6ZA 3LSOB 3ROOB 3AFLA 4JREC 2KUTA 2XOTA 2CMRL 1X5IA 5T3XH 5KVDH 1QRNA 4IMLB 2WUBH 3REVB 5F1NB 3JBG7 5I8CA 1RUPH 5F3BA 1G1CA 1GZQB 2Q8AL 4MNQB 3PP4H 4XMPL 4KU1A 1NEZG 2YA0A 1MHEB 1F58H 2Z92A 5DSCB 1XGPB 2VWEE 4K23H 1A1OA 3X12A 3QXUA 3RKDC 4HQQL 5DR5H 1XGYH 4YO0A 4XVJH 1FCGA 4TSCH 1INEH 4XNMB 5D2NB 3MLTA 1CL7L 4RGOH 4P2RE 3LY6A 2HKHH 5DD3L 4X4ZA 3C87A 1X5HA 1NAKL 2DKSA 4MDJA 2Y6SC 4N90E 4S1DD 1MREH 2A77L 2EEDA 3ULSB 1U3ZA 1T4KB 2N1KA 2V2XA 3QNXB 3HE6B 1BQHB 3O3UN 3ARGC 5IROC 1IQDA 5SWZA 3MODH 1JN6B 4KZDH 5ITFA 2BVYA 3GO1H 3KJ6L 3HR5A 1QRNE 1QLEL 3MLXH 3BWUC 2CKNA 1G7HA 4RRPG 1CDCA 4G6KH 2V2WB 5DJXA 4LK4A 3HPLA 4L4JA 4Z7VB 1DN0A 1FZKA 1YYMH 5BS0D 5FYKU 4R96B 4NUGH 3T0EA 3U2SB 2XTJE 3KYOA 3SO5A 1EVUA 3UTPD 1WAAA 3DV6A 1JNLH 1MNUH 5IHZB 5EUOF 1V5JA 1VFBA 1P6FA 4Y5XA 5DT1H 4PJAB 2EEAA 2HH0L 1FL5B 1S3KH 3C60C 4OAWA 5F7WC 1CLZH 2ID5A 4F33A 3TO4D 3FL7A 1ROWA 3TJHD 1CDYA 1UB5A 1XGQB 5SWZE 5ID1A 1U9KA 2MCG1 5IEHA 3MQIA 1IQWH 5GRVL 4L3EB 3MYJA 1T7ZA 1HYSD 1OCWL 4GRLB 4J3TA 4DGYL 3MRJA 4R7DA 3SCMB 4S1RH 3VXRB 5JMRA 1BQUA 2IPUG 3U0PB 2GSGB 1PKQA 2AK4A 2HFEB 5HI4C 1JHTA 3A67H 3CX5K 4V2CB 4FG6D 2VDNL 3D1MC 4OI7A 2ZNWA 2DQHH 4LSVL 4KUZH 2XWTA 3WKMH 3CFCH 4M8VA 4PRPA 5C07A 2PETA 3BX7C 4RWYL 1KC5H 1RJYA 2VAAB 5CWSA 2P49B 1DFBL 2ED9A 2VDQL 4Z95L 1S7UB 4X0KB 1X4YA 4X83A 3S37H 2FBJL 3SGDH 3NIFF 1TZGH 5E1AB 5TFSL 5IB4B 1YUHA 1YEIH 2ZUQB 2FJFA 3GSVA 4HZAA 4YZFE 4HUUB 5I73B 3QIWA 1A3RL 4HF5L 2NW3B 3LHPL 3HNVH 2BJML 5F96H 2IFFL 3HI1A 4GMSH 1FE8L 1KACB 1PKQE 2AK4E 2X9WA 2RIKA 3ES6A 3VXTA 5FYJE 1IGIL 5FFLA 3STZB 5CEZD 3U82B 4Q58C 4YXKL 4U3XA 4HH8A 3ZT7A 2AJZA 3C5SB 4PRPE 5CBAA 5C07E 2RBLA 3FB8A 2GTWB 4ZFOA 3G5YB 4Y4HC 3SE9H 1KYOJ 3L7EA 4NUJB 4PJ7A 2ERJB 5KSVB 2K1MA 3F62A 4YWGH 3VD4A 2Z93B 1I7TA 4JEGB 1KBGL 4I2XB 1UXWA 2VLJD 1KIRB 3AB0C 3H3BC 3N1QC 4P2QD 5A43C 1J88A 4U6YA 1I1YB 3BQUD 4PYHA 2BOCB 1CD9B 1T5WB 2DICA 4R4BB 1NFDB 3JWDH 1KIPB 4LLUB 3FN0H 3MROB 3RA7H 3UTSD 3WNKA 1EEZA 4M1CD 4W4OC 1NC2B 3WDIA 5FYLH 5IJKA 3ETBF 2DYPD 3D2UA 4Z78A 1U8NA 2NY0C 3O11B 4MVBD 2VXUH 4U1IA 2YPLD 1YY8A 2O5XL 4K3GA 3X14B 3MV8A 2EIZB 5D9SA 4U1SB 4P5KA 1WIPA 4NQVA 5GRXG 2DLIA 2J6EH 2VH5H 5HHXL 3DXAD 1OHQA 1D5IL 3OXRB 1UENA 2F54A 4PJ7E 4FFZL 1BFVL 3LKOA 4LLDA 4LVEA 1Q9OB 3TO4A 3DGGB 2VZSA 4EVNA 3IDIA 4KVCL 2IBZY 3QG7L 4H25A 3WFBL 4Y2OA 1Z9LA 1NMAL 3TNNB 5EA0H 5C6WH 2V5TA 5FIEA 2FATH 3ZTJG 3NOIA 3MLYL 1WFNA 4NN5B 1DQJB 4M03A 1A6AB 1PKOA 5IM7B 5EU5A 3RVVD 5I1EH 2ZJSH 5F7YC 4J1UB 1GCFA 5DRXB 3BEVB 2ZCKH 1HN1A 2ICEA 2AJUL 2DM4A 1BJ1J 1T22B 2GK0A 3T8XB 4DZ8B 3LKNA 4OSUH 1UVQB 3ZE1F 5D2LA 5KVMC 5I76A 4FQ1H 4PJCF 1F13A 3P73B 2OSLA 1GVIA 4XP6H 5JIKA 2F54E 4Y1AB 4UU9A 4JDZB 5E99L 2AVGA 1ZKAA 5GRYA 2C4FU 2VR9A 3ROLA 3MLWL 3HE7D 3AAZB 1WIOA 3O3DB 4OGXH 4PY7A 2F19L 2W1NA 1GXEA 3DV4B 1UZ6F 4K55A 4RAVB 1D6VL 3BN3B 5IKCB 5BO1H 2Z8SA 2EH7L 4RFOL 2X89D 1UCTA 4RNRA 4HJ0D 4GKNB 5I75C 3FFDA 4XHJD 3BUYB 1J0HA 4G7VH 3U0TB 1HDMB 2OTUA 4Y16C 4YBQD 1IEAA 5DMIH 1MWAL 1N6UA 3MXVL 4FZ8L 4XI5D 1INQA 5CJBA 3BYYA 3NIGE 4XMLL 4ENED 1KEML 5D2LE 5EU4A 4PRDA 4AEHH 2V2TB 4P4KD 1ZOXA 3WLWD 5TPWL 5C6TH 3V6OC 4UOW0 3IXAB 1CFTB 4HUXA 1R3LB 2C4XA 5FYKD 3GNMH 3MCLH 3MRLA 1N8ZB 5DQJB 3UTZB 1KLFA 1UH2A 1EFQA 4O4YH 2J4WL 4OLYH 4WW2C 5C08D 2I9LA 4Y19B 4ZNCD 1ZT4B 3BQUA 2DQTL 5LAXB 3H9ZA 4NRZA 4XBGB 4HX1B 1QACA 5H35A 1Y18A 3QI9A 3VXOB 2HVJB 4XPGL 1U58B 2DYPA 1MCNA 1M7IB 2AGJL 4TVPL 4JE4B 2YPLA 2OQJB 5M94B 1ES0A 2OXHA 5CEZE 5DEFB 5JQHC 4NFCA 1YQVH 2ADJB 3PHSA 2YUWA 5SWQA 1AD9A 3FT3B 3PIQB 3SKMB 5T3ZL 3WXVH 3O8XC 5D96C 2YBRB 1AC6A 2E7BA 2Q76A 1A0QL 5C0IA 3SBWA 5E8EA 5FK9B 1K3ZA 4NKOB 3NGBB 1T1XB 3IJYA 3V0VA 4P2QE 1RZIA 2GEEA 3RY6A 3BJ91 3QXVA 4UUJA 4XP5H 5J13C 2ATPB 4J3XA 1BBJB 2DOCA 4OZFA 1RHFA 3TYGH 2VWEC 3DX6B 4DGVL 3UTSE 4OCLC 4X5XA 4XMKH 2NY2B 4F2MB 3CCHB 5C0NC 2PTTA 1JV5A 3IVKB 2J1KA 3LVEA 2E7LA 2ZSVA 3AUVA 1F8TL 3FB7A 2CRYA 2YPLE 3AREB 5KVEH 2NY5H 4HUNB 1NL0L 4HD9A 4DN3L 2Q8BH 1J87A 4NQCB 1QO3B 5EZOL 4LASH 5MP6L 5CHNB 2B1HL 2G2RA 4U1GB 1PD6A 3MR9A 1NLDH 3FB6B 5HDLA 1YC8A 3ARDB 3FT2A 1CGSL 1IGMH 1A7OL 3LV3B 3MCG1 3ZKXC 5JNYA 1L7IL 3NPSB 2R0KH 4TUOA 3QDMD 3TT3L 1GHFL 1BZQK 1PZ5B 3HE7A 1IEBA 5DD0H 4DCQA 1FFQA 1ZHKA 4KJYB 3H9YA 1Y6MR 3MA9L 3L3KA 2NTFA 5HGDA 2X89A 4HPYL 1RIVL 4IJ3B 2CLVA 1NMCC 1BREA 2XTJC 3CJJA 3H7BA 3BO8A 5GS0H 5E70A 1J10A 4NRYA 4R4FL 1WIUA 3QZWB 4UV7H 3M17B 4ORGA 4D9QD 1XGTB 2QJDA 5E56A 5HYSA 3QAZB 2C3VB 3TYFB 4HWEH 1RZGA 1H8SA 5J6GA 4KI5F 2WMPA 4O2EA 4L8DA 1RVFL 3QPQD 4LCWB 4LNRB 5CGYD 3VW3L 3NCEB 1PG7X 2A9MH 3WXWH 4LAJH 4KJPC 3VFUB 3Q48A 1MJJB 5GS2H 4G8IA 1I85A 5C08A 4ORZC 5D93C 5E4IA 5FO7B 3VWJB 5D7JD 4PLKC 3T2NL 4F57L 5TF0A 3C8HA 1S5HB 4PREB 3DI2B 3RJQB 1NJ9A 4WTZG 1N7MH 4YXLH 4KK5D 4LSQH 3V52H 3ZTNL 3IRZA 5HHPA 5I0DA 4YUEH 4W70A 5F7LB 3QFDA 4G5ZL 5HHOB 3LIZH 2JELH 4CVZA 3UMTA 5I17A 3VWKB 3BDXA 3EJYC 4LDEB 5C0JA 4GBXD 1K8IA 2BP3A 2GY5A 2DQIL 5EOQH 1I8IA 1H3VA 2V7NB 5FCSH 5EULV 1PYWB 5FYKE 4K2UH 1I9RL 3VE0B 2H45A 1GGTA 4KPHL 4CVWA 2R29L 4IOSD 4OGYH 2BVOA 2VZVA 5C08E 5MERA 2NY4D 1SY6L 3WO4C 5JOFA 3ZKQD 4IRSC 2VL5B 3QO0B 1A5FL 5DTFA 3QUZB 1CU4L 4NWTL 4ODBD 4HK3J 5BJTB 1D5XB 2HWZL 4P9HL 2KQNA 3KXFB 2CLRA 1KTDB 2FO4B 4BUGA 1A6TA 3U7YL 1I3RA 3HG1B 1C7TA 2NXZC 3GSRB 5LCVH 2UWEF 3LEXA 2DLFL 2MFNA 3GIZH 1BWWA 1BZ9B 2JIXA 4TOYH 1SEBB 2HJFA 4PB9L 2RJMA 3QIUC 2LAAA 3S35X 5IIEA 3E1F1 1Q8MA 4TRPH 4BZ2L 1AE6H 4ERSH 3OGCB 4R90L 3BPLB 2B4CC 5ESQB 2WIMA 4HJJL 3PHQB 1X5KA 3H9HA 4E5XB 3K4DA 3QQ9D 1P5UA 3QDMA 3VI3F 1MLBB 2NLJA 2P24B 4RMTA 2G75A 2F9BT 4RMQA 3DMMB 3OR6B 4K7PH 4M61B 1LEKB 1KB5H 4GLRI 4MJ2A 1S7WA 5KBNC 4X98A 2CDFA 3VGDA 4KZEH 4Y4KA 2X4TA 3MRQA 2DMBA 1XR9A 5BXFA 2C4FT 3GJFB 1RHHA 4DOHB 3WHE1 1NGPL 5CCKL 4POYA 4S1DC 3LMJH 3L6FA 2CIIB 4ZTPL 1EXUA 1D5ZA 4HIXH 4N1HB 5DHXB 3WFZA 1U8QA 3MMEB 3WS3B 5TE6L 2XA8H 2OJEA 1HE7A 1FL3B 1YEGL 4K8RD 4HLZG 4WCYH 2ZG1A 4QXGH 4BSVB 5SX4I 5IJKC 3QDME 1BAFH 3QEQB 5DI8A 1UACL 4M9OA 5GGVL 4XP1L 2D9CA 2YC1A 1T5XA 4LPXA 1BFTA 1HEZA 2D31B 4LVNB 5D1XD 5TQ2L 5FOBB 1XF2B 3WIIH 3VXUD 4TSBH 1SEQH 1FP5A 2HVKB 1SM3L 3BPCA 3P4LA 5CZVH 1BMGA 4LQFL 3UTTD 2EO1A 1EAPA 1Q9LA 4YFLI 4C83A 2Y25A 1FVEA 5BV7H 3MV7B 6FABH 4D9QE 1KJ2B 5L8JB 4R97C 1RMFH 2IGFL 1YEJL 4H20H 3C2AH 4GBXA 4H5SA 3TO4C 2C1OA 4OGZA 4U6VH 4LIQL 3ARGB 3TJHC 1F6LL 1MF2H 5TQ0H 1T7VA 4TQEH 2GAZA 4P59H 2X05A 1A9EB 1YZZA 3QDGB 5ACZB 4OI9A 1U8IB 3WFCL 5B39A 4KVNL 1TQCC 4NO3B 3GMMA 3ILPB 1HYSC 2WIIB 4F7CA 4EN3D 3ECBA 3OKOA 3W9EB 3LS4L 3ESVF 3HCVA 4HEPG 3WEXB 1EEQA 1MIEH 3RDTD 2X1OA 4ZFFA 4NO5B 3QEUA 4BQBA 3KLAA 1YY9D 3L3GB 3N50A 3VFWA 5F7EL 1ZGLA 2DJUA 5F89B 4FG6C 2YN3A 3MJ9A 2WINB 4JVWA 1LP9A 3OAZH 4XP9L 1FHGA 4WFED 2IPKA 4TSAH 1EEUA 1E4XL 4A6YH 2WLYA 4R2GD 1QKZL 1ZLUH 1ONQB 4NT6A 5C3LD 5ESVB 3WL9A 3C60B 5I66A 1UQSB 3THMH 1MRCL 3AMKA 1T3FA 2KPNA 5M7QA 4DK3A 2UYLB 3AM8C 5MEOB 5F1SA 5I74C 3QCTH 5LWYH 1UH3A 4FXGB 3MUGB 4LKCA 3BHBA 1YEFH 4Y2DB 2OL3A 2AKRB 4KHTH 4HIEB 4OV5A 1A3LL 1EHLH 3P4MA 5F1KC 1L0QA 3JVGA 3RL1A 3CXDH 1KIQB 4PJIA 1BQLH 1ORSB 2WQ8A 1D6EB 4RCAA 4R7NB 2APTA 4JFXB 4DQOH 3LN4A 4Y8AA 1TZIA 1LP9E 3S34H 5E0QA 3IKKA 3JTSB 2M2DA 2F5AL 1AHWA 1FV1B 3GMPB 4UINH 5I2IB 1G6RB 3TJEL 3HMXA 4K3EH 3MRCA 2ZKHH 4HG4K 4LAQH 3CLFH 2AJSH 2HLAA 1FN4A 3EDKA 1CR9L 3GRWL 5CEXA 1TTFA 4ZOAA 1ORQB 4K71C 4X7EC 3PGDB 5CEYB 5IHUH 1DSFH 3WE6B 1DL7H 3BQUC 1ZVSB 5C09B 4F58L 3CH8A 3O2DA 4XPFL 5BZWB 1VCAA 5GGSB 1BZ7B 5LJYH 4NZTH 3DTXB 4JFFB 4PJIE 3QUMH 1J1PL 5C0RH 4MVBC 1YN7A 4KUCD 1N4XH 4LHUD 4L4TA 5DD1H 3WUWB 3O6KL 5BQ7B 2O26U 4U1KB 5D1XA 3G6JB 5IEKB 3ISWA 3VXUA 3K2MC 5KSBA 2FECL 5D7SL 4KRPB 3ULVH 3QEGH 2R4SL 3CFBA 4JJ5A 1I3GH 3UTTA 4PS4H 1N3NB 2XICA 4Y4HB 5IK3A 4WI9A 3SBWC 1VPOH 3RI5F 4XT1C 4KTYA 2YSSA 2ADFL 4L5FH 3DARA 3T0XA 35C8H 2N56A 1GH7A 2OZ4H 3AB0B 4OZIB 5HSFA 1AC0A 3BW9B 4PJHA 5F44A 2GITB 1KG0A 4TVSa 1I8KA 3I6KB 5GXBB 4BSWB 3PUCA 4G3YL 2F53D 4YHML 1YECL 1IM9A 1FO0A 3U1SH 2CKBA 1ZWIA 4H26A 1LO5B 3AMLA 5J11B 2X6MA 5E2WH 2HKFL 2AV1B 3SHSA 5J89A 4ONGL 1OGTA 3DUUA 3KVQA 2NY0B 1MCPH 3BKMH 4DEPC 2E7LC 3RDTA 3RVVC 3UJIL 5HPMA 1FVCA 2FR4B 4YDIH 1CLYH 3ARFD 3QUXB 3CC5A 5GGQH 3A6BH 3VXUE 5KSBE 2DIBA 4RAUB 4JVPA 4DUXA 2OLDA 1NDGB 3UTTE 5HGHA 3BZEA 1R5IB 1E27A 4JM4H 4YPGB 3VFGL 4ZFZB 2WBKA 1NCWL 1HIML 3L5XH 1TFHA 3DOSA 4YIQA 3HE7C 3MLSL 4O00A 4PJHE 4OTXL 5J1AB 3BEWA 3SE3C 3LEYH 4NC2B 3U0WL 2WBWB 5L9DH 2IEPA 4KGJA 4X6CA 3O6FB 1H3TA 4BFIB 4XBEH 5ESAA 5A16B 4GRMB 3T2PA 3V8CA 4HPOH 4JHAH 1ZHBB 3KYMB 5E24E 4HJ0C 3QO1B 1UKTA 5FM8A