5I1AB

Crystal structure of human germline antibody ighv3-23/igkv3-11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO388 LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1aB01
2YOCA 3D5OF 1FFQA 4QCIB 2R2BB 4UU9A 1H3GA 3QIUD 2WIIB 5CKGA 1A2YB 1I1YA 1MRCL 3WSQH 1MLCA 1OAUH 5FGCB 4OUOA 3UTQB 2XV6B 2NY2C 2PETA 5KVGH 5FYLL 3HS0B 4JQXA 4H20L 1MVUA 3B9AA 4D8PB 5I8CB 5F96H 3QT2A 1M7DB 3V5DB 4ELMB 2C4FT 4HIJB 3ARZA 4LSQH 4GW1B 4P5MB 4M93C 5D7SH 1TJIL 3E1F1 1JRHL 5AZEL 5E03A 4PRAA 5DYOB 4ZUUA 2VDLH 3CMOH 1RK1B 1ZTXH 1QRNE 1S5IH 4H26B 5DJXA 5E6YA 2ADIA 1FDLH 3LPFA 3HE6A 3TYGH 4RZCA 4HIXL 1T0MB 1VFBB 2FIRT 1SM3H 2HRPL 5BMFH 5DMIL 2KPNA 3U4AA 5MENB 1MCPH 4XPBH 1SJXA 4NC1E 4OLWL 4AM0A 3VFSB 1HHHA 3WUWB 2BSSB 5H94B 3S5LG 3PGCA 4Z76A 5GS0C 1RJZB 1A6ZA 3TH3T 3D69A 1PW3A 3T0WA 2BVYA 3L7FB 5IFAL 1NGQH 4MAYD 1B6UA 1QQDA 4KV5E 1IMHC 1WTLA 2DLFL 1EFXA 3I2CH 4GW5B 3CX5K 3T2NL 2XTJC 3FB6A 2VLRA 2V7HB 1PX3A 3B9DA 5JDJA 3KPOA 2AJZA 3HFML 1T1WB 5J4MA 3LKQA 3P4LA 3GI9L 4JFFD 5ITBL 1WEJL 5TDOA 3H3PH 1TTFA 3T2PA 4C56D 4YNYA 2BRQA 3EBAA 1JPFA 4QF1B 3IGAA 4TQEL 1T89A 2H6PB 4CMHC 2RFXA 2J1KA 3TM6A 3LD8B 3HI1B 1WVZA 4YHML 4XVSH 3MRFA 4RISH 1W8OA 5EU6D 4JM4H 4LVHC 3S88L 1LEGA 5C6PB 4O2EA 2YRLA 1AKJD 5F72S 4OSUH 3VRLF 4R0LB 1CFQA 4U1LA 2EIZB 2FX8L 3ES6A 4XTRD 5I1JH 3MJ7B 3G6DH 3RVUC 4LQ1A 4RMUA 5GSVB 3OPZH 1AO7A 1BZ9A 3P11H 4OB5H 2QHLA 4WW1A 1RJYA 1QUNA 2GJ6A 3IKKA 5EO0B 1MJUL 2PR4L 3UYRH 4UIKL 3L3JA 5LCVH 4GAGL 5DRNA 3GMRB 4Y4FA 2CKBA 4O02L 1KB5B 3GRWL 3MRCB 2HYMA 5IROC 1Q9KA 5EZLA 5FGBC 4BFIA 4GKNB 4F80A 3HE7D 2XG5A 1MHCB 4D9LL 1FL5B 5B22A 3TYFA 2HT4C 4QYOB 4U0RB 1KXQE 5BRZD 4PLOB 43C9A 2FR4A 5GIRA 5JNYA 4APQC 4XBGA 3HI5H 3MLVL 2AEPL 4GAYA 1F3DJ 4L3ED 4DTGL 1MREL 5F70A 1AXTL 4AT6B 3O6KL 4ERSL 4UQ2A 2C1OA 5JORB 3KVQA 4CVXA 3IVKA 4V1DD 1G6RA 5I18H 1LO5A 5J89A 3Q1SL 3PHQA 4YAQB 5SX4I 2YEZB 2BNRA 4Z5RB 3ARRA 5BOZG 3LB6D 4Z7VF 3ZDZE 1QFWM 2JKXA 2HJLB 3QEQB 3S36X 2I5YH 4YFDB 4ODBD 1RZJL 2G2RB 1AGFA 1ZLWH 2P5WE 4PJ9A 3QUKB 4X6CF 2ENSA 1T2QH 4O5LL 5JPNA 4FFWD 3FOLA 3KYOB 4HWUA 3SDYL 4NUJA 2X4NA 3K1KC 3AB0C 3CFBA 1HSAA 4M7KH 4ODWA 3PDOB 3MRDA 2ITCA 1B0GB 5C07B 5LWYL 3BPNB 5ERWA 3CSYB 5E5MA 3G04A 2UZIH 4G42A 2ZCHL 3UJTH 3LQMA 4JRYA 3MRHB 4I48B 3GSNB 4M5ZH 3HI6L 4LSRH 4OQTL 5IMOA 5J1AB 4XP9L 2PXYA 1WTGT 1XZ0B 2BFVH 2QKIB 4HZAA 1U8MB 1A5FL 4XP5L 7FABH 1OP9A 1AQKL 1XR9B 3OKDB 3ULUH 1CE6B 5EOCJ 2HKFL 1XF4A 3R06B 5IJVB 2WBJC 2NY0B 2EECA 2Y6SC 1K85A 3JWDH 1MFDH 2J4WH 2PW1B 2OTUA 4G8GB 1ZEAL 2F8OA 5D6DC 4F37K 3O4LD 4I2XE 4WFEE 1WWBX 1YNLL 1EIBA 3ALWA 5ETUB 5TJWK 4QRRD 3CPLA 5I66B 2B2XL 3I6LE 1GZPA 5T1LD 1FAKT 4HHAB 2APWA 1CFTA 4WY7L 3P73A 5D2LF 4WO4C 3MRNA 5DJ6B 5IVXB 3ILPA 4R97C 1TVDA 5ABDE 1JPGB 4CVWA 4P2RA 1S8DA 2YD5A 3OKKB 3AVEA 3RVWD 4FQIH 5FDYA 5EOTB 3QDJD 3SKUD 5D1ZB 3IDYB 1Y6MR 4U1GC 4WEBL 3I84A 2K7QA 4XCNB 3VFPB 5J6HB 2IMMA 5D1QA 1RI8A 3T8XB 1AQDA 3LQZA 1IGTA 1KJMB 4UQ3A 3X14B 5F1KC 2FATH 4NM8H 1RIUH 1NDMB 2ARJQ 1MOEA 3HNVH 4LASL 4P99A 4ZTPL 1D5BB 1DE4A 2QLVB 5H35B 4QGTA 4FS0A 5GGRY 1KPUB 4EOWH 4FQ2L 2VZ1A 3A6BL 3TO4A 1I7ZA 4X4ZA 3C6LB 3R1GH 4UIMA 4Q9RH 2IPUG 3RY5A 3FN9A 4D9QD 3IXAA 5I1LA 5BXFA 1XF5B 1SBBA 4NN5C 4X6EB 5HYJE 2W9DL 2I07A 5C2BH 1KTLA 1VGEH 1F13A 4GUPA 4HFWA 2KBGA 12E8H 4XWOC 5ESQA 3LKPA 5JW4N 1MI5D 1YC7A 1A3LL 1KJ2L 4JFZL 4AEEA 3RTQD 5HY9A 2VLKE 2W1NA 2X1PA 2F15A 1AGBA 3CVHA 5INCB 2HN7B 4I0PA 4U6HA 5DJAB 3EFDH 2YBRB 2VDKL 3MV9B 4X0KA 5T1MB 5T3XL 3OBAA 4GAFB 1FORL 2EXWC 2G60L 2GY5A 2DB8A 1JE6A 4W68A 4MA8L 4M43L 4D0DB 5BS0D 5I6XB 3EGSB 1NMBH 1C16B 1LK3L 2XACC 2ICWA 3CC5A 4JR9H 5BV7C 5ALCL 2BK8A 43CAB 2YWYA 4FZEH 1BJ1J 2FHBA 4FMFA 2IADB 1JWSA 1OB1A 4TNWK 4P9ML 2FGWL 3GBLA 4WHYH 3NIDE 1QRNA 3C6SA 4OFKA 1RIHL 2QADC 3LMJH 4KK6C 2CIIA 5F97E 1JHTA 4OV5A 4PRID 3TT1H 4OGAC 1R5VB 3UAJC 4GMTL 3UEZA 2OK0H 1X7QB 2BVQB 5HJ3B 1ROWA 3FO9A 5HHNB 3DXAB 4J12A 2Y7QB 2VLJE 1NGWB 3EFFB 2J5LB 2AXGB 1E4JA 3BMWA 5D7KE 2CLRB 3LS5L 1FZMB 5F7WC 4GKOA 4E41B 1TFHA 4H0HB 3MNVB 3MA7B 2ESVB 4OCRH 3MUZ1 4UT7L 3IDGB 1CDBA 4KH2A 4N0CC 2ZOKB 3D3VD 3LEXA 4TRPH 1F4YH 1ZGLP 3IDMB 3D9AL 4YIQA 1HHKB 2WZPD 5D5MA 2CO6B 4PLKC 1CDHA 2XT1B 4ZFOA 2X4UB 3BRFA 4YUEL 1FYHB 5J9PB 4L3AA 4P3DA 3G6JA 5A2FA 3QI9B 4JKPH 3BFOA 3N1MC 1S7SA 1KG0B 2VLLA 5CIPB 3TBYB 1SY6L 2DL9A 2Q76A 5JMRA 2H26B 4JLRB 3MRLA 4W81A 1OQXA 3O6FB 4YHKL 4QXTA 4XCEB 5JHLL 1EZVX 4OZ4B 4K8RH 4AJ0A 4JO2L 3S4SB 5FYKH 2FJFA 3BDYH 1JNNL 3EUUA 3RUGE 4C59B 2JJSC 4LMQI 1ZS8A 3G9AB 5LJYH 3WFCH 1OAZL 4QRTB 4YZFF 3KPQB 4PJHB 2P43B 5E8OA 3T65A 1X6NA 4JY5L 1G9NL 1YJDL 1RUPL 2DJ4A 4JGJA 3I6GA 1JYNA 2ICWJ 2I9TA 3DV6A 3IRZA 4WIQA 4P4RA 4RRPA 5ANME 4HLJA 4LSUL 2YUWA 4NBXB 3IETB 3X3FH 3CZFA 1DVFD 1NLBL 1I3RA 3V0VA 3LIZH 1AE6L 2WLZA 2VDPL 3ISWA 5CSZB 2FECI 3TN0C 4PJ8C 1S7VA 2Y5TA 3MRKA 1F4XL 4KRMB 5HVFB 4HZLA 4J4PC 4KI5E 6FABH 3V4PL 1ZHNB 3MACL 4PJIE 3VFTA 3MRBB 4P0DA 1AGCA 1RFDL 1YEKL 1NCDH 1KBGL 2P5WA 2FJGA 4X6DB 2FYYA 1PZ5B 4WWKC 5A2JH 3EYQC 4NC0B 3FQXB 1C5DA 5I75B 5ICZB 3T08A 5KSVA 3EYOA 1A6VL 4LOUC 4NGHH 4YX2L 5KSAD 2GSIA 5DD5L 5F9JB 5EU4A 1HCVA 2KQNA 4BFGA 1V3LA 2CLZA 4JANB 4LU5H 3OG6B 4Z0XB 5C7XH 2NZ9D 2NR6C 4Y2DB 3P77B 5CEZH 5GRYA 4QOKA 1ULVA 2HT2C 3MZTA 2Y07L 4Z0BL 2IAMC 35C8H 2NY1C 3PJSB 5HGDB 4OZGB 5F9DC 2EKSB 3KLDA 2EIBA 2DQJL 5E24E 3MGOA 4NRZA 5DEFA 1D7FA 4UU9B 3MV01 1JUFA 1G9ML 1KLFA 3MLXH 4P2OD 4WFFD 5BV7L 1I1YB 1DBKL 1BREA 1MLCB 1CS6A 5GS1C 4K3GA 1OGAE 5FKAA 2X6MA 1MVUB 2BY1A 4H0GA 4ONGH 4IOSD 1JNLH 2R4RH 4QRUA 3ZDYE 4NN6B 4YWGH 5H2BA 2VXUH 2X4RA 2YPVH 1AD0A 4LP5A 3LDBC 2DMCA 4I2XA 3CU1A 3LRHA 5IBLC 2P8LA 4KDTC 4NQCD 2PYED 4LCIH 4Y16A 4PRAB 4WI6A 4ZUUB 4NO3A 4URTB 5MP6L 3F65A 3MLYL 3MOQA 4ZS7L 5DJXB 3SN6N 1LDPL 2DQUL 3TLRA 2ADIB 3GGWA 4NKIH 3HE6B 1OL0A 5H8DA 4MDJA 3U79A 4RZCB 1AP2A 2ZUXA 3MO1A 1P84K 4LSSL 5DWUL 3BEWA 5GRVK 3O2DH 5TDPA 1URLA 5DLMH 4H1LA 3NBNA 4RCAA 1C5BL 2F53D 3QIBA 4R4FL 1ZGLA 4AM0B 2VUOA 5J8OA 1HHHB 3PGCB 4Z76B 3L3IA 1A6ZB 3P4OA 3D69B 4L1DA 5TE6H 4FXLA 5J06A 1LWRA 1QQDB 1FZOA 2DJUA 1EFXB 3FB6B 2VLRB 4ZPVA 3KPOB 2AJZB 4OCXH 3LKQB 3CFJA 1D9KD 2FX7H 3RWGA 5AD0A 1IZKA 1GH7A 5TDOB 1UXSA 4MGXA 4I9WE 3NCMA 4YNYB 2HLFC 2C3HA 5ENWA 4F15B 1JPFB 4OZHF 4WUKL 3IGAB 3RWIA 3O0RL 2RFXB 2NY5H 2CGRL 5HYJA 3EOTL 3BW9A 4IOFC 3D2UD 5JUEL 1KEGL 5JTWA 3MRFB 4Z7UF 3ULVF 1LEGB 4FNLL 1YPZF 4O2EB 2QHRH 4PGEA 3J7HA 3GSWA 1CFQB 4U1LB 3UTOA 3ES6B 1IEHA 3GNMH 3CK0L 1QFWH 2R56L 2QQQA 1AO7B 1BZ9B 5IWLA 2D0GA 4WW1B 5HI4C 1RJYB 5F9WC 3NPSC 2VLKA 1YA5A 2GJ6B 2W9EH 3WXWL 3MPCA 3HG1E 2B39A 3L3JB 4N8VG 4X98A 4X7FC 4Y4FB 2CKBB 4C57C 5IESL 4OZFH 1Q9KB 4EUPG 5EZLB 4BFIB 5DUPH 2C7UA 1F6AA 5DD0L 4XCYA 5C0NC 4KJQC 3TYFB 4JCMA 2FEEI 5F1IA 5CGYD 5E7BA 5D70L 4HMCA 3CFEA 4RFOL 2FR4B 5GIRB 3VFGH 4UTAH 5JNYB 3PP4H 2JJTA 1W0WA 3SGEH 5I1KH 1DBBH 3U1SH 1YYML 4XBGB 4GAYB 4ZD3H 2XZCL 5E2JA 5K9OA 2D7TL 1GCFA 4RWYH 1Z9OA 4UQ2B 2C1OB 3IVKB 4CVXB 1G6RB 3WN5A 1LO5B 4L4TD 3PHQB 4RMRA 2EDTA 1CLYH 3TBSA 2BNRB 2OZ4L 3TF7C 2DAVA 1DL7H 1ZGLM 1Q1JL 2DLIA 2XQBH 1X6LA 1U8JA 1BAFL 4AQOA 1AGFB 1ITCA 4PJ9B 4M6OL 1U3JA 4GJTB 3T0EE 3SDCA 1SHMA 5JPNB 3FOLB 1GGIH 1ZMYA 4NUJB 5DD1H 4GAJH 2X4NB 3CFBB 1HSAB 4ODWB 2EXYC 4BM7A 3MRDB 5D96B 5ERWB 4UT9L 1O7SA 5E5MB 2OJEA 3ZHKA 3G04B 3RX5A 1UJ3C 3MYJA 4G42B 3H8NA 3O8XD 4JRYB 3ARDC 2A73A 3VXPA 1R5WA 3ZE0F 1YEGH 4XMKH 2NTFB 3CNKA 3KWWA 5IMOB 5E6IC 2PXYB 2VLJD 1QBML 1U3HA 4RIRA 3KLHC 4YLQT 5D7KD 5GZNC 4EBQH 1G7PA 2P49B 1XF4B 4ZS6C 1TJHH 4AK1A 1BBJA 3K0WA 2WWMD 1EMTL 1T4KA 3VI3F 2OTUB 3PNWA 2NYYD 5B39A 1EERB 3CLFL 3ECBA 2BRRH 3QBTB 4FQJL 1JYVA 1T83C 1Q9LA 1KELL 2ZUSA 2F58L 3CPLB 5J1SC 1GZPB 5FKPA 1T5XA 1CFTB 5DJ2A 1SMOA 3P73B 3H3BC 3MRNB 1ZE3C 3ILPB 3T3MF 1PKOA 2W59A 1LP9E 4PJBE 1UYWH 4P2RB 2OXHA 1GHFL 4KRPD 3BQUC 3ULUD 3EDDA 2OI9B 5J0BA 5HGBA 1WIUA 4TSCL 1KEMH 2F5AL 2O5YH 4OQ1A 4PJEA 5D1QB 5JIIA 1AQDB 3LQZB 1IGTB 2XKUA 3EYUL 4UQ3B 1E6JL 3KHOA 2B5IC 5DI8A 3CLEL 2UZXB 4KAQH 4B41A 5ICYA 2E9JA 3GSXA 1RUKL 4Z6AT 4Z8FL 4TULL 1DE4B 4Y5VC 5C07D 4KU1A 1YECH 1UH3A 2V5YA 2PO6A 3PG2A 4PRDA 3TO4B 1I7ZB 4WI8A 4UIMB 2VL4A 3IXAB 5I1LB 5BXFB 4I3GA 1DN0A 5A1AA 1JZ6A 3NPZB 2I07B 1KTLB 2DQCL 1A6WH 1MHEA 3SGDI 1CZ8L 1PKQE 4GUPB 1WFTA 4MNGE 4HFWB 1NAKL 5I1HH 2M26A 4JPKH 1CK0H 1YMMD 5ESQB 3LKPB 4JGUA 3SGKA 4HXAL 1CCZA 3BGFB 1L0XA 3KPSA 2VL5A 5HY9B 1TTGA 4PLNC 4G8IA 5HSFA 2CUHA 3B83A 2NW3A 2E9BA 1AGBB 2GAZA 3CVHB 4U6HB 4I0PB 2ZG2A 4X0KB 4WGVB 4P2YA 2E6PA 4XMPH 4DVRL 4JHBA 5HVGB 2FLBT 1XGUA 1E28A 1OGAA 3DRQA 5I76A 3VG0H 3HMXL 1A7OL 2ICWB 3CC5B 4AIZA 3ZKMD 5A40E 4UMGA 2R0WL 3HNSL 3EJZD 4OF7A 5DC4B 3M07A 5I1GL 3QIWD 4KPHH 1JWSB 1HCFX 1OB1B 2C3XA 2WUBL 4R4BA 4L1HA 2GSGA 3NOIA 4LHJB 1CFVH 3INUH 1N64H 4KUZH 1QRNB 3C6SB 3U46A 1JCKA 1NBVH 2CIIB 4H8WC 1JHTB 1TPXC 4OV5B 1K8DA 3IKCA 4TVPL 2R29H 1PQZA 1EO8L 3KPLA 4LARH 5DO2D 3V7AG 5I1DA 3FO9B 2E7LA 1N6QL 2O5ZH 1NH6A 4JFOA 4I0KA 3OKMA 3ZE2F 1PD6A 3PQYD 2VXTL 2AI0L 3B2UD 4M9OA 5JOPE 1INEH 1NC2A 3QUMA 3O4OC 1DANU 1G84A 5EB9A 2CK2A 1EXUA 4N5ED 4YIQB 3NFSH 5F71A 1H0DA 5D5MB 3RJDA 4R3SA 4ZFOB 5AYQA 3C9NA 3S36L 3VXRA 4MAYC 4P3DB 5EO1A 3MV7E 3C60A 2KQMA 3G6JB 2IANE 4UOW0 1A3RL 2LU3A 1HSBA 1S7SB 3KG5A 1YQ2A 4MVBC 5FAAA 2COQA 2VLLB 2OL3A 1U93A 2Q76B 2UVFA 5L8LB 4MNQD 2AERT 4Y0GA 3MRLB 2VNCA 3LS4H 4JFDD 4QXTB 4ACPA 3FHAA 4H25B 3WDIA 4JFHE 1VFOA 3EO9H 4CVUA 4JM2D 2VR9A 1NFDA 2FJFB 3Q3GA 4XAWH 4I9WD 1ZS8B 1TNMA 4PJAF 3HG1A 2PTTA 1D6VL 4PRPE 1HIMH 1LILA 1SYVB 1IAOA 4U2ZA 4NP4H 4YDVA 3T65B 5E8OB 4OGXH 2R9HD 1A8JH 1R0AH 4XTRC 1H9VA 3FAXA 1PDKA 3I6GB 5JIPA 5CZKA 1MCNA 2I9TB 3DV6B 2YPLD 4P4RB 4TSBH 3ZL4H 1P4IL 3UX9B 3U0TA 1VEOA 4OUUA 3CZFB 4K8RD 4FQCH 1I3RB 3S98A 3V0VB 4OCYL 1I9JH 2B8OT 1MRFL 1CGWA 1PFCA 4HS6A 5FYKD 1CGYA 3HE7C 4R4ND 5JHDE 1UM5L 4PJFF 3WO4C 2NY7H 2VISA 5GQBA 1S7VB 4E41D 2Y5TB 4GXUN 3MRKB 3O3UN 4XZUA 4KTEH 4HZLB 4JDVB 3VFTB 3MBEA 3MOAH 5KBNC 4XXDA 4ZNCD 3VRJA 2WV3A 4M7ZC 1AGCB 1ZVSA 1IGIL 3DI2B 2EIDA 4RGMB 2J88H 2P5WB 2FJGB 3K46A 5SWSE 2FYYB 5E4EB 1VSCA 3C8DA 2BOCA 4Q6YA 4ZAKA 3WUZA 1C5DB 3SJVA 4F9LC 4NWTH 5KSVB 3FB8A 3EYOB 4XP1H 5ID0A 3JWOC 2GSIB 1UFUA 5EU4B 5F88A 2EICA 2R69L 4OLXL 2CLZB 4HG4K 3L7EA 4NNYA 5L88L 3AGVA 4QOKB 1QPPA 1ZT4A 1RZFL 4FFWC 3IDXL 4GRLA 2HMIC 2ZSVA 3MGOB 3PL6C 5CJQL 2Y06H 2JJUA 4NRZB 4Y8AA 5DEFB 2VRAA 5CJ5A 1JUFB 4I18A 2JB5H 1HKFA 5CP3A 2AGJL 1UM4L 4LVNB 1KXTB 2XKNA 5T33L 1W2KT 4U1SA 4RSVA 5FKAB 4Y4HA 1FPTL 3WNKA 1R3IH 5IQ7L 1WIPA 4QRUB 2AK1L 4PREA 5H2BB 2X4RB 3VXOA 3Q2CA 2JELH 2BC4A 4P5TA 4EDWH 1AD0B 4I2XB 5IB1A 1MCKA 4G3YL 4IRJD 3QXWA 2P8LB 5F7UA 4Y16B 3Q0HA 4NO3B 3ZT6A 5CEZD 1NUFA 1FIEA 4NJAH 4OFVA 1MCRA 2E7HA 3GGWB 4RGOL 4MDJB 3U83A 1AP2B 3MO1B 2APVA 2DS4A 1EVTC 5TDPB 3BEWB 2BHZA 1NUNB 4UOW1 4I77H 4CADA 2RHEA 4H1LB 4EJ1C 2CMRL 3QIBB 1ZGLB 4M02A 4U7MA 3O2DA 3PGFH 4GW4A 1HHIA 4X4YA 3L3IB 3P4OB 4HG4J 5ILTL 4UINH 1N3NA 1U91A 5FYJH 1FZOB 3SDXE 3V6OC 1QOKA 4HT1L 2QSCH 4ZPVB 3VI4E 3O6ML 4Y8DC 1YEJH 4HBCH 1CDJA 3CFJB 4LCWA 4PJGE 3RWGB 3MX0A 3MRPA 1ZA6A 3W11D 5AD0B 5ISZD 4MQSB 4DZBB 1ODAA 5I74C 1AR2A 1UXSB 1WBYA 4K3EL 4N5UA 4HIIA 2Z0BA 4ZOBA 4YGAB 5ENWB 1PSKL 3RWIB 4P46D 5CJOL 4JKKA 1JIBA 2Q86A 5HYJB 3FQWA 3ME0A 1NFIA 3BW9B 1A7RL 1MJ8H 2IALA 3QDAA 1VHPA 5CEXA 1ACYL 4MNGA 1KCVH 5CMAA 3MNZA 4PGEB 4YDLB 3GSWB 5MHSE 2V17L 1DBAH 1HH6A 1LE5A 1YQVH 1JTPA 5KZCD 1NGYA 2VLKB 4R90L 3V4VH 4LGPB 2I60L 4ALAL 1QYGL 5B4MD 3HLAA 3KYAA 4X98B 1F3RB 2E9WA 3RA7L 1UJTA 2C7UB 1F6AB 2N56A 2W0PA 5E2UH 4XCYB 1KCUH 2DQIL 5KVFL 2VWEE 5C0RL 5F1IB 1JGUL 3G9VA 3CFEB 3PIQA 3QXAA 3RTQC 3GSVA 5I73C 1D3CA 1W0WB 3TO2A 5SX4H 2WUCH 1NAML 5I15L 5K9OB 2YXFA 5IT2H 1FSKB 2IWGA 2SEBA 3O9WA 4D3CL 1CLOH 1S9XA 1S7QA 5K33A 3KPMA 3DO7A 3WN5B 1YEIL 1UZ8A 1GAFH 4GMSL 4NNPL 3TCLA 3TBSB 4OF3A 4OF6A 4U05A 4R8WH 1EFXD 1JI1A 4YHLH 2AV7A 4X4MA 1U8JB 4ETQA 3E8UL 3SDCB 4BJLA 4HK0A 4BUGA 4GQ9H 5C09A 2R0KL 1INDH 1YEDA 3BPLB 1JHKL 4NQXA 4LKCA 1X5IA 5GPRA 4S0SD 1Q0XH 4JFYA 5MEPA 3VE0A 2OJEB 2XZAH 4NHUA 1LDSA 3TCXA 3MYJB 3ETBF 4W6YB 4PFEA 2A73B 1UZ6E 3VXPB 1R5WB 3JVGA 3KWWB 3QRFM 5D9SA 5IHZA 1X9QA 2EYSA 3DVIA 1U3HB 5EZOL 2VZTA 4RIRB 5FO7A 4FQXD 2AP2A 2IANA 3PDGA 2L7UA 1S9WA 1G7PB 1Z6JT 4M61A 5F7YC 3DLQR 2HLAB 5JOPD 1QKZH 4A2MA 1L4IA 3NMEA 1BBJB 3W9EA 2A77H 2YS4A 4X5XA 2VDRL 1T4KB 2D7QA 2VKWA 3PNWB 1JHLH 3I3BA 3ECBB 1YEFL 4GRWF 1NCCL 1Q9LB 1H5BC 3DOSA 3DPBA 3WUWG 1RMFL 2Y36H 3U30B 3DO3A 3UJJL 3O2VH 4EEEA 1XGRA 3MV7D 2P47B 1EGJL 5FKPB 1T5XB 1QSVA 4Y5YA 5DJ2B 3PWJA 4LNVA 5EZIH 2R2CA 3QFDA 5T1KD 1D6EA 2FBJH 4Q74A 5C0EA 4GKZA 3KPRE 5D1XA 4CBPA 3U9UA 4YDKL 2P24A 5HGBB 2HKHL 4OD3H 3BESR 1OY3B 2YUZA 5E94A 4PJEB 4PBXA 1MWAL 5CEYA 3GM8A 2V5MA 1PGRB 5HHPA 2WANA 5JHDA 3VW3L 5DI8B 5JA9A 3H6JA 5DVLA 4ELMF 3UPAA 4JG0H 5ICYB 3SQOH 3H9SD 3HC0A 3GI8L 3GSXB 5B21A 3QXUA 4AL8H 4KMQA 4XC3H 3TJEH 1T7ZA 2PO6B 1DVFC 1HNFA 1MH5A 3VGEA 3BSZL 4PRDB 3ULSA 3F5WA 1OAYL 4RA0C 5SWSA 1QSFE 1NCWH 1DN0B 5FUCE 5ALBL 1J12A 4Z78A 1MHEB 4M6AA 1N6VA 1H3UA 2D31A 2YA2A 4PV8A 3BKCL 1ZXQA 4LSTL 2EE2A 5HYEA 3VGFA 3VXSA 3KPSB 2VL5B 4YXHL 1WFOA 1PLGL 4G8IB 4HH9A 2VIRA 2NW3B 2GAZB 3FFCD 4YHYB 1OTSC 1MAMH 1UACH 3UTSA 2DBLH 3BIBX 3QDME 2HRLA 5KSAC 5D71H 1BQLL 2Q3ZA 1NDGA 1X5ZA 4U1MA 4XAKD 2PUQT 2Z31A 3B2VH 25C8L 1XGUB 5GJTL 1E28B 5CWSA 1OGAB 4KKAD 3C87A 5KAQG 2NZ9C 3DRQB 3QUZD 5I76B 1PJ9A 2M8XA 1RUAH 4AIZB 4O4YH 3DSNA 4ZXBA 2IPUK 1CXEA 2FCBA 2DDQH 2HJFA 4G9FE 1LO4L 4LFHG 1T2XA 4R4BB 2P42B 2GSGB 5JXED 3D48R 5FA3A 8CGTA 1BD2D 4CUCA 2XWJA 2ORBH 5C9KA 3SEPA 1K8DB 3MJGX 1V7MH 3IFNH 1PQZB 3KPLB 5JQHC 3QDGA 1RJLA 5I1DB 3OJMB 2FEDC 1W72L 5JW4M 3GO1H 2AXHA 2ADFH 4DGYH 4JFOB 2AJUL 3OKMB 5L8JB 4JQVC 3P0VL 4G6FD 1XGYH 4G7YL 3CXHK 5F8RC 2AEQH 2IBZX 3V8CA 1KIUA 1NC2B 2F8XC 3OKOA 1DDHA 3QUMB 4XCCH 2GJZA 4QTIL 1EXUB 3AM8C 4PJGA 5GS0H 1H0DB 2HJKA 4PJ7E 5CINL 3KXFA 4R3SB 4IMKA 3QUXD 2L4OA 1CBVH 2LV4A 1NGZA 1Q8MA 4AQ1B 3C9NB 3P9MA 3VXRB 4AIOA 2DQHL 5EO1B 3RGVD 3C60B 4K2UH 5C2UB 2NNAA 3DHMA 4JJ5A 3TVMA 3REVA 1HSBB 2NZIA 3NFNA 4OLYL 5EIIA 4I0PD 2OL3B 4DW2L 1HYRC 1MFNA 1U93B 3GM0A 4FTVA 5IV2A 4OIIH 1D9KC 3S3SA 2LQRA 1PG7W 5F1NA 3SE9L 5GHWL 1NFDB 3Q3GB 4YE4H 4KMTH 1A21A 5L8KB 3MXVL 1OTTD 3OXSB 1KCRH 2GHWB 4N1EA 4DK6A 3HG1B 4J3XA 5J7CC 1EHLH 2PTTB 1QNZL 1FO0H 1CQYA 2D2OA 1IAOB 4JFQA 3MRQA 3D85D 4YDVB 4PPTA 5HHMD 1DQDL 4U1HA 2VSDA 1NBYA 4N90D 2CH8A 3KJ6H 5CBAA 1RIVL 3H7LA 2VDNL 1EZVY 1U8PA 1N5YL 3U0TB 4M7LL 4QRPA 4OUUB 1OD9A 1F02I 4Y4KD 5DJDA 2G5RA 5FUZL 1TVHA 4KKCC 4HS6B 4JZJA 1GPOH 3MV11 2VISB 1N0LA 4P4KA 3MMEA 1J1XL 3D39E 5I19L 5CGYC 4JPWH 4XZUB 1I8IA 3ZSSA 5E8DL 2CR3A 4Z7QF 4LPTA 5DQDL 3MBEB 4M5YL 4C83B 1A1NB 3OZ9H 4XXDB 5FDWA 2ARJA 3VRJB 4DGVL 1ZVSB 4OT1H 1QLEH 4ZSOA 3LKSA 4L4VE 1K6QH 5CJBA 1HQRA 3GBML 4KK8C 5IB5A 2BOCB 4PLJD 4P49A 1JZ4A 4ZAKB 2NTSP 3SJVB 5IKCB 3EO0A 3PE9A 2PN5A 3FB8B 5IVXF 5ID0B 3U7WH 5F88B 2GW5A 4HWZA 3BH8A 3L7EB 1U8OA 4NNYB 5FECA 2LFGA 2NY6D 5E70A 1PYWA 1TJGH 3MCG1 4H5SA 4HEPG 4YQXH 4YDIL 3K1DA 2CLVA 4HWNA 1EEQA 1ZT4B 3DGCR 2CPCA 4HC1A 3BWAA 5D7JD 4GRLB 2ZSVB 2YPKA 4ZFZA 5I17A 4LPUA 4I18B 4P23D 4XVTL 3RWCA 1I1RA 2HG5A 2IPKA 2XKNB 1Z9SA 3M8OL 4U1SB 1F58H 1RUQL 4Y4HB 3ZE1E 5IB3A 4PYHA 1E0OB 2GJJA 5TH2A 4PREB 4OLUH 3VXOB 2VITA 2BC4B 3WKNA 4P5TB 3PUCA 5IB1B 4O9HH 4TSAL 2WNGA 1MIML 3OKNA 3BXNA 4KKLD 2GI7A 3DX7A 4HUUA 3NCBB 5D7IF 1XGPA 1T03L 2DYPA 1J1OH 1FLRH 1WZKA 3A6CH 1NCBL 2B0SL 2WWMC 4AIXA 2QQLH 4CADB 3CDCA 4JN1H 3MV8E 2NYYC 3BAEH 4GW4B 3RQ3A 5K59F 1HHIB 3WSQL 1WFUA 4X4YB 4JDTH 4XP4H 1OAUL 1Y18A 5GRJH 4HJGA 5EC1A 1F11A 3IRPX 1N3NB 1S78D 1U91B 4RFNB 5I30H 5KVGL 3QH3A 3WIHA 3QQ9D 5HHOA 5F96L 1A14H 3HZYA 3QQ4A 2D3VA 4XVUD 4EN3A 4LSQL 2FH8A 5EPMA 4ESKA 5D7SL 4LCWB 3VH8A 3MRPB 1ZA6B 3EJYC 2J12B 2ZPKH 4MCYA 3ULUC 2MSPA 1Z2KA 1WBYB 3C5ZA 1KACB 1QSZA 4HIIB 1BVZA 4IEFB 2VDLL 5C0CD 3CMOL 3PWLA 4KDVA 1ZTXL 1S5IL 3S4SG 2QQNH 3HC3H 3JWDC 1FDLL 3TYGL 3DX6A 1G9EA 1QG3A 2Q86B 1OAKL 3IFLH 3FQWB 4XI5D 1NFIB 3GSQA 2XTJE 5BMFL 3P3YA 1FZJA 2BY0A 2IALB 5CEXB 5I71B 1MCPL 4XPBL 4MNGB 5E00A 5CMAB 3MNZB 2DKSA 5FYJD 1HH6B 1LE5B 4PTTA 2WBKA 5AAMA 3KR3L 1NGQL 1NGYB 4BK4A 4HUWA 1OTUD 2X09A 4HGKC 4FFZH 3I2CL 2NX5D 4ISVA 3HLAB 4OGYH 3WLWD 2AQ1A 2EDJA 3TA3A 1KIQA 3QDMA 3QEHA 4Q0XL 4BQ9A 2V9TA 1B4RA 5C0BA 1GGUA 5IM7A 2P5EE 5GGRA 4PG9A 3WIIH 3TJHD 3H3PL 3MJ8A 1OSPH 3ARFD 5DFVC 4DAGH 2VOTA 3PIQB 3QXAB 2ED7A 5DVOA 3GSVB 1C08A 3BUYA 5MI0C 3ARBA 4NQDD 3TO2B 1QBLL 2YRPA 3QUYD 3QRGL 2VZVA 2Z8RA 1KGCD 1BQUA 1YMHA 1J7VR 4XVSL 5D7LE 4HAFA 4RISL 2WP3O 3DWTA 2VZ3A 4JM4L 5TGBA 2SEBB 3O9WB 4G9FA 1S7QB 1S9XB 4OSUL 3KPMB 4L9LA 5I1JL 3DO7B 1UZ8B 2BJMH 5HYIA 3EO1A 3HMWH 3MRGB 1X5HA 3G6DL 3TCLB 4HPOH 5KVDH 3KJ4B 3HAEA 3OPZL 3P11L 4OB5L 5DQJA 2YD8A 3TZVA 4WUUE 2AV7B 1ZANH 3IDUA 3ZKMC 5J12C 1QSEE 5JLZA 5KN5A 5LCVL 1CICD 5F21B 4ETQB 3KYKH 5INDB 1HZHH 2J8UF 1MCOH 5I1CH 5IFHH 4HK0B 3IDYC 5C09B 4HPYH 3D87B 1YEDB 4NQXB 4LKCB 4MJIE 1I9IH 1PG7H 1T66D 3HI5L 4JFYB 5MEPB 5DO2C 5CLWA 3VE0B 4NHUB 4F9PA 1KCKA 2DQTH 5FB8A 5F1OB 4HH8A 3LKRA 3SKMA 3WD5H 3HZKA 5I18L 1E4XI 1AIFA 5D9SB 3WJLC 4P2QD 5IHZB 2EYSB 3V79C 5FO7B 5T5NG 5HDBF 2IANB 4OI7A 4CJ0A 3G5VA 1S9WB 1MQKH 4M61B 3SPVA 2I5YL 2UWEE 4N5EC 1QP1A 3OB8A 1WV7T 3DIFA 4QY8A 3W9EB 1CT8A 1T2QL 1VCAA 4X6DF 3WFHB 4X5XB 5EUKA 3G5YA 1WJ3A 3QFJA 4M7KL 3NVQA 4EIZC 1XGRB 1K4CA 1X5GA 4Y5YB 1CWVA 3PWJB 3UJTL 2RJMA 3QFDB 1D6EB 4M5ZL 4LSRL 4JM2C 4GG6F 5C0EB 3UPRA 4OZGF 4GKZB 4LLYB 4M9PA 2I9LA 2BFVL 5B8CA 5I6XC 5JW3H 5D1XB 3U9UB 2P24B 7FABL 3DHJA 4DN4H 1I1AA 1KTKE 5E94B 3SO3B 2A74A 2GCYA 3ULUL 5CEYB 1JNHA 4LDEB 2ZCKH 1KV3A 2R9HC 5HHPB 3S8WA 5JHDB 5DR5H 1NMCC 1G0XA 4ZFFA 3BPOC 3JWDL 3D39A 2XRAH 2X05A 2AK4A 2J4WL 3O3BA 2OX5A 3IDNA 3O41A 3HC0B 1N0XH 5T5NF 5ESVA 2NY3D 3GRWA 1EEYA 1KUMA 1MH5B 4K8RC 1MJ7H 3ULSB 3F5WB 1UKTA 4L4VA 5C92A 3EOBA 5SWSB 5I8OH 5KTEH 1AC0A 3UP1A 4JREB 1Q9WA 2CSPA 4OZIE 1IKNA 4Z78B 4MJ6A 2HT3D 4M00A 4FQIL 2D31B 4JRXE 4OLVH 4PV8B 3N9GH 5HHQA 1EUUA 3DRTA 3TBVA 3WS6A 1T1ZA 1JZ3A 2XN9A 3VXSB 4PB9H 4HH9B 2VIRB 4HBQA 2FATL 4NM8L 3UTSB 3VWJA 2OR9H 3HNVL 2IJ0C 4WV1A 3BD4A 1NDGB 4U1MB 5E8EA 1FC1A 1E4KA 1CXFA 2Z31B 4EOWL 1OVZA 2MCG1 1QFOA 1BMGA 3R1GL 4Q9RL 4JFPA 1T22A 3STLB 4LPCA 1TQCC 5CUSH 2KZ1B 4ZXBB 5C2BL 1VGEL 2HJFB 4D0CA 1OLZA 2ICCA 4U6YA 4D94A 5C0JA 4OJFH 5DRZA 1G0YR 12E8L 1WAAE 5FA3B 2PW2B 3JBG7 4PG2A 3RZWA 4PTUA 2XWJB 5L0QB 4OQTA 4MNHA 4XPFH 3QDGB 3PXHA 1RJLB 5EOQH 3EFDL 4K71C 4IRJC 4GOSA 1G7JA 1SJVA 1VPOH 2IEPA 4UTBH 5E9DE 4QGYA 5HGAA 3OF6D 5DQ9A 5CZXD 4K9EH 1NMBL 4JR9L 1INQA 3OKOB 1DDHB 4FZEL 4NN7C 4PJGB 1RZ7H 3O2WH 2HJKB 5FIEA 1BOYA 1NGZB 3MV8D 4CGTA 5FGRA 4BA8A 3QWRD 3P9MB 3VXME 4U49A 3LMJL 2NNAB 4JJ5B 3REVB 3NFNB 3TT1L 2W60A 5EIIB 4DQOH 3I75A 4FTVB 5I75C 3IS1X 5GGQH 4PP1D 5IV2B 2OK0L 3I9GH 3W11C 2L0DA 2NXZB 3QNZA 1FRGH 5F1NB 5I1AA 1BBDH 3C09B 2XXMB 3QUML 2NY4B 4Y2DC 3NABH 2LTQC 1NBZA 4ZUWA 3ZT5A 4P46C 2GK0A 4OCRL 1EHXA 1SMAA 3P2TA 5GS0D 1UADC 2AW2A 4RAHA 5DZLA 4EXKA 3FHQA 4TRPL 4FXKA 1F4YL 3FN3A 3B9KD 2V2XA 3MRQB 4JFQB 4JFXA 1BEYH 4U1HB 2P5EA 2XTJD 3VXUE 5KJRH 4Q9BA 4HLZG 4IIQA 2R15A 1NBYB 3NIFE 4PIRF 4OD1H 1OHQA 5CBAB 1Z9MA 5JIHA 4RAVA 4NWUH 1U8PB 5E95B 4JKPL 4QRPB 3IFPA 1L6XA 2FGZA 5DJDB 4Z7NE 1TVHB 2VDOH 5E56A 4JZJB 5IROA 2VMFA 1X44A 1KJ2A 2A6IA 2GIYA 1D5XA 4P4KB 3MMEB 4XB8A 5DT1H 1LVEA 3BDYL 3OGCA 1I8IB 4ODXA 5K9QI 5KVEH 5FDWB 2ARJB 3RVUD 4APQA 1QSEA 4HW6A 3WFCL 3QHFH 4ZSOB 4F7CA 3LKSB 1HQRB 5IB5B 4LP4A 2BVOA 3SE4C 4ZNEA 3N0PB 3EO0B 4YBHA 4LEXH 2WSKA 3C60D 2LAAA 4MJIA 1N7MH 5TE4H 2EDQA 3F8UB 4HWZB 2LVEA 3BH8B 1U8OB 3X3FL 5C08E 5FECB 1PYWB 4H5SB 5E1HB 2CLVB 3LIZL 3LVEA 1SEQH 1DSFH 3BWAB 4Y19E 2DIBA 2B20A 2YPKB 3KS0J 3WJJA 3CCHA 4ZFZB 3QQNA 3V0WH 1OF2A 1T89C 4NFBA 5I17B 3RWCB 6FABL 2HG5B 2BSTA 5C3TA 4OAWA 1BGXL 2IPKB 2RR3A 4XNMA 3BPCA 2UWEA 5GRXG 1A7NH 1F90H 2VC2H 1NCDL 1HHGA 5TQ2H 2IFFH 2F19H 3O11A 1BLNA 5IB3B 2A38A 5TH2B 1P5UA 2VITB 1S7TA 4NGHL 4FQXC 1FCCA 3OKNB 1UH2A 3BXNB 3DX7B 4EVNA 4HUUB 2ZKHH 1ZVYA 1XGPB 3ROLA 4LU5L 1QA9B 3L1OH 5C7XL 1ONQA 5ESAA 2DYPB 5CEZL 3P0YH 5E7FA 1I9EA 5LXGL 5ADOH 2WBJA 1MCQA 35C8L 2VDQH 1DQQA 3N85H 4ODVH 5DURB 3VDBA 1NBQA 1P7QA 2FHCA 5D6DA 1SY6A 1SJHA 1WBXA 2RCSH 1T7VA 4KUCF 3MLXL 1EBPA 3IU4H 1Y18B 1F00I 4HJGB 5EC1B 1F11B 3GIZH 2DKMA 4KTYA 3QH3B 2ZUUA 4ONGL 5HHOB 1JNLL 2R4RL 3QQ4B 4MS8D 4WO4A 4EI5A 3OAZH 4YWGL 4EN3B 4MJ5A 2A1WL 5EPMB 1HILA 1IZJA 2VXUL 1U58A 3DYMA 2YPVL 3PWPE 3TV3H 1CE1H 3IB4A 4HWBA 3VH8B 4MCYB 1ITBB 2EDRA 2K3TA 1G0DA 3C5ZB 4LCIL 3WE6A 4OCSH 2V5SA 3FRUA 3PWLB 4BSVA 4PJ9C 4NKIL 4J23A 3DX6B 2A6DA 2PNDA 1FYTD 5JDSA 3S7GA 1QRKA 3GSQB 3O2DL 2DICA 4PJ5E 4OZIA 5DLML 1FZJB 1CGVA 4JQIH 1HYSD 1AJ7H 1X5LA 4LHUA 5E00B 4JRXA 3U0WH 1AHWC 2VLME 4E0RB 4PTTB 1UEYA 4PJCE 3FZUC 3LQAH 5TE6L 3BGMA 4RRPG 1RULH 4KV5F 4ISVB 5C71A 5SWQA 5IMMA 5HHVL 1EVUA 3DROA 3TA3B 3QEUB 2X40A 1KIQB 3QDMB 3QEHB 3AS1A 4OCXL 3JTSA 4D0BA 2ICES 5IM7B 4D9RE 4WTZA 5GGRB 2PCPA 4PG9B 3SCMD 2GEEA 3PGDA 3MJ8B 1OOAA 3MJ9H 3MSPA 3ARYA 2EDXA 3ARWA 1C08B 3BUYB 4NQSA 1IGMH 3ARBB 2X9XA 3NCJH 1U8HA 4TTGA 2NY5L 1YMHB 5ACZA 5TGBB 4X8JA 4G9FB 3TESA 2N7BA 1J8HA 4L9LB 1WAAA 1UC6A 3EO1B 3GNML 4JAMA 2AQ2A 1QFWL 2CRIA 3W39A 3HAEB 1QLFA 3P9LA 4KKAC 5DQJB 3RVVD 3QUZC 2W9EL 3F12A 4XWOD 3TZVB 5JLZB 5KN5B 1BIHA 3VFOA 4W4OC 2AKRA 3UTTD 4EKXA 1UWGH 4G9DA 5DUPL 2DM3A 1OAQH 1F42A 2FRGP 5JXEC 4L8BA 3WO3B 2BMKA 2F54E 3MUJA 5E9DA 3VFGL 4UTAL 3PP4L 5D7IE 2A6JA 3SDAB 1DBBL 3U1SL 5I1KL 3WKMH 1UGNA 1BF8A 4ZD3L 1IQWH 2I25N 5FB8B 3H0TA 4RWYL 4EUPH 2DF3A 3IDJA 4OCMC 3LKRB 2R8SH 3SKMB 1RJCA 3BWUC 4L29A 1QEWA 3I6KA 5L2KD 3HZKB 2RAMA 1AIFB 4JPIA 4NCC1 3VXMA 1CLYL 4QCIA 2DBJA 3KPNA 1I85A 4P9HH 3S34H 3G5VB 5AZ2H 1DL7L 4MQTB 1KT2A 1PY4A 3X13A 3SPVB 2BERA 2XQBL 3ZDZF 2QQKH 4K55A 3DIFB 2OS7A 3MUY1 3QUXC 1CT8B 4OGAD 4LIQH 5EUKB 1GGIL 3G5YB 3BGFC 5DD1L 4GAJL 4ODHH 1ACZA 4H1LG 1LEIA 3RGVC 3QFJB 2BY3A 3DYPA 4I0PC 4MD0A 1J0YA 1K4CB 4OKDA 4NKQB 3DUUA 5IF0A 4YXLH 4U0QB 4MJ2A 4BFBD 1BF2A 5AZEH 4IJ3C 2QL1A 3VXUA 3RWFA 1YEGL 4R2GB 4XMKL 3LZFH 1Y0LA 3WS3A 3UPRB 2I9LB 2QTEA 5B8CB 3DSFH 3LH2H 3PDDA 2JJSA 4EBQL 1I1AB 3ARPA 2A74B 2GCYB 5DZNA 2HVJA 1JNHB 1TJHL 1QVOA 4WTXA 2OQJA 5GSRA 4RMSA 4ZFFB 4XC1H 5DJCA 5C09D 5GZOC 3D39B 4HK3N 2BVTA 2AK4B 3O3BB 3IDNB 3O41B 1RHHA 3RVXC 4KROB 2FD6H 2BRRL 3STBA 5ESVB 1EEYB 4FQHA 4WU5A 4FFYH 4ZUVA 2ADJA 4Y4KC 4LDLB 4L4VB 3EOBB 1MIEH 2ZCLH 3J8F7 3P30L 2AV1A 3RY6C 4A6YH 3QQ3A 2K9UA 1KIPA 1Q9WB 4MJ6B 3TN0A 4OLEA 1UYWL 4J8RA 4BUHA 4YFLF 1YEHH 4S2SA 5HHQB 3A67H 3FQNA 1KEML 3DRTB 3TBVB 1BZQK 1T1ZB 2XN9B 3HUJE 4R26H 3NN8A 2XY2A 4FZ8H 1H8SA 3FONB 1TTUA 3ARVA 5C70A 3JWOH 4PLJC 5IFJA 4WWKA 2OZ4A 4YEFA 2E7CA 4NT6A 4KAQL 3VWJB 1FL6A 3G5ZA 4WV1B 3C8KA 1MJUH 5E8EB 4CDGC 3WNOA 1YECL 4QYOA 2NY6C 4DJMA 3DVGA 1H3XA 1HH9A 4QEGA 3CXDH 3UCRA 3V2AR 8FABA 5C08D 4WEUD 4JFPB 5DF0A 1T22B 3ZZ1A 4EI6A 4NIKB 3RBGA 2EDFA 2IAMA 1LEKA 3UXFA 4D0CB 4P23C 4UB0H 5C0JB 5I1HL 5DRZB 1H15A 4JPKL 3K4AA 4S0TD 1CK0L 4LOUD 4ZUTA 5HDLA 4PTUB 5IMLA 4MNHB 2NY2B 1AXTH 1CD9B 5MEQA 1L7TH 4GKSA 1S7RA 1MAJA 4TUKH 4M93B 4RBPK 4XMPL 4B50A 1GGBH 1G7JB 1KULA 3OAUH 4HS8H 5HTSA 5DK2A 1ZHBA 3N1GC 5HGAB 3VG0L 5DQ9B 2N7AA 4JO3H 1INQB 1TMCB 2W07A 1ETZA 5KS9E 4KPHL 3RGHA 5J1AA 1CFVL 3INUL 2VSCA 5LWYH 5ADPH 4KUZL 4RGMC 5KG9A 5CKAA 3NIDF 1LO3L 5IBLD 5F7KC 1NBVL 5E4EC 3QQ9C 2R29L 3OXRA 2W60B 2W9LA 4LARL 2D7MA 3I75B 4EQ3A 4XVUC 4PJ5A 3UTSD 3VFMA 2MMXA 1BP3B 2IBZY 1RUML 1U8NA 2ZP0T 5LG1A 1FE8H 3B9VA 2O5ZL 3QNZB 4I3RH 1UT9A 2YC1A 5I1AB 2JK5A 3OQ3B 1TQBB 4PRHD 4RWHA 4WFHD 3MCKA 5J11C 5KOVC 1FNFA 2P44B 3DETC 1CDCA 1NBZB 4ZUWB 2GK0B 1CL7H 1INEL 4IM8A 4CMHB 4ZXBD 2WQ8A 4XPHH 1LO2H 4FXKB 4ONHA 1CR9H 2V2XB 3NFSL 5FEBA 2LABA 4JFXB 4HULB 2P5EB 4ODTH 3V0AC 3DVNA 4LVNC 1B6DA 1JPGA 2B2XH 5HI5D 4LNRA 2J2ZA 3GHBH 1R3KA 4RAVB 1X5FA 4ZO8A 5FK9A 3WLWC 3IFPB 1U42A 1F3JA 4XVJH 1FFNA 5GGVH 5D7LB 4TUJA 4DKAA 3IF1A 3LS4L 1NKOA 5BZWA 2JCCE 1KJ2B 3EO9L 4IOFD 3TJHC 3F7PC 2A6IB 1D5XB 3ARFC 2QSVA 3OGCB 4KTDH 4ODXB 4XAWL 4LLDA 3RUGF 4WUUB 1J1PH 3QUYC 1E6OH 1JGVL 1KPUA 4APQB 1QSEB 4ZYKA 2CIKA 4I8DA 1HIML 3UROR 1EAPA 4NP4L 4ZTPH 3KXFD 4YGVA 4OGXL 2BVOB 1N6UA 2CJUH 1R0AL 1CD8A 3GEWB 2GT9A 3HMXA 3IDIA 3QAZB 4OF0A 3F6IA 3WIFA 2NXYD 4MJIB 3CFDA 3TVMD 4KJQD 4TSBL 4NRXA 5D7IA 3ZL4L 5ICXA 2BVEA 3ZYJA 1GRWA 3AC0A 2DN7A 4J1UA 5T5FH 4FQCL 5HD8D 4L3EE 1J0HA 1I9JL 1A1MA 1PG7X 3DGGA 4MMZC 5J1TC 2X89A 3NCFB 4FQLH 3O45A 2NY7L 1IM9D 3L9RA 4V1DE 3CCHB 1LD9A 5D2NC 3F7YA 4JFZH 1OF2B 4KTEL 4F7TA 4O58H 4X7DC 1JL8A 2BSTB 4KI5F 2F54D 3MOAL 4OAWB 4PJIF 4XNMB 3BPCB 5B3JE 2UWEB 3GMQA 4QXGL 1HHGB 2J88L 5T3XH 3V4UH 1L0YA 3BZEA 3O11B 1BLNB 4XH2A 3ZHLA 4KKBC 4NWTL 3QPQD 1S7TB 4XP1L 3KLAA 1UENA 3ORJA 1FHGA 3KGRA 4Q9QH 4EVNB 4IMLA 3ROLB 4L3CA 1ONQB 5ESAB 2EXYD 1JGEA 4P48A 5LAXA 1A02N 3ROOA 2FL5A 2WBJB 4P4KD 1DQQB 2E5EA 2XOTA 2XFXA 4M8VA 1P7QB 1V05A 2Y06L 3LN9A 1SJHB 3ARDD 1WBXB 2JB5L 5I16B 2ZG3A 2AJYH 1EAJA 1T83A 1VERA 1U3YA 1XH3A 2YD1A 4LEOA 4KJPD 1FSKC 2Z8VC 4HXBH 2CO7B 1R3IL 4OF5A 2MKWA 4EI5B 4WO4B 1VFAA 1NANI 4MJ5B 3ZDYF 1HILB 1U58B 2JELL 5FO8A 1J9CT 4EDWL 3D0LA 3T1WA 4LLMA 3O4LE 3C08H 3WE6B 3F58H 3BQUA 5IBUB 1OP3K 4WHTA 1KLUA 1I8KA 4NJ9H 2VZUA 3MLZH 2H3NA 3FRUB 3RP1A 1J18A 4QRRE 4RMQA 1FL3A 4BSVB 4NJAL 4XNYH 2ICWI 3VWKA 3QI9A 2EDKA 2A6DB 5JDSB 3V6OE 3W0WD 3CFCL 4NCDA 1QFPA 2AJSH 3P4NA 4OZIB 3MR9A 4I77L 4S1SH 3BPLC 2CXKA 4LHUB 2GITA 1NJ9A 4JRXB 3PGFL 2EDEA 4Y5VA 4RGND 5D8JL 4S11A 2IG2H 5IOPA 3HUJA 1NGPH 4UINL 5GRVL 5J6GA 5FYJL 3BGMB 3V5HB 4ZODA 5JHLH 3DNKA 5SWQB 4HCRH 5IMMB 4OM0H 2QSCL 4NN5B 2J8UA 1YEJL 4HBCL 2HT3C 3N06B 2L7JA 3SE3A 3S9DB 3JTSB 4D0BB 5SWZD 5TPWH 1HXMA 2PCPB 3HPLA 3W82A 3CFKA 3PGDB 2E27H 2EH7H 4UT6H 3MQIA 3FMGL 4QO1A 5I1EH 4NQSB 4Z77A 1U8HB 2EEBA 3UBXA 3ULVD 1OP5H 4XWGH 5ACZB 1H3PH 1MJ8L 1EX0A 4YC2C 2BZDA 3S3PA 2B4CC 4X8JB 4QNPE 2YD2A 1KCVL 5JO5A 4J3SA 1J8HB 1KNOA 1DBAL 4JAMB 5FA4A 1YQVL 3VA2C 4XXCA 3W39B 1QLFB 3P9LB 4ETYA 3W5MA 5EZJA 2XA8H 1MI5E 5L6YH 5DHVH 1CFBA 3OR7A 1IRAY 1HNGA 1U95A 2VDPH 3F12B 3V4VL 4BH8A 2EDLA 3VFOB 1QBAA 3GKWH 5BV7B 1S9VA 9CGTA 2AKRB 4G9DB 2W91A 3T09A 4BZ2H 1IL1A 5E2UL 3QIUA 3NAAH 1KCUL 4L8BB 2BMKB 5E9DB 1IGCH 1E4XH 2A6JB 5BS0E 4BELD 2WUCL 3WNLA 1G7LA 3HC4H 1RHFA 2VZOA 5IT2L 3H0TB 3IDJB 1I3VA 4GG6A 2GTWA 4L29B 1CLOL 1QEWB 3I6KB 3KPTA 4NM4H 3ARUA 1IEAA 2AEIT 2Y5EA 4JPIB 1H3TA 3VXMB 4F7MA 4WW2C 3KPNB 3B5GA 4J3TA 4R8WL 5CZXC 4YHLL 1KT2B 3X13B 4PRIE 1IKFH 2VE6A 4BK5A 3REWA 5C0BD 2E6JA 1T04A 4AH2A 4ZTOH 4LL9A 5BW7C 5DUBA 3SGKC 1IC5L 1Q94A 4QHUA 4GQ9L 3HPJA 2HH0H 1INDL 1P2CB 1LEIB 1RSFA 4GRWH 4PGBA 1TZGH 5DD3H 5HYQA 4MD0B 4PRNA 1Q0XL 4PP1C 3DUUB 5IF0B 2XZAL 3VXQA 1HEZB 3D3VE 4I4WA 2YUXA 3VXUB 3RWFB 4JFFA 3T3PE 1IFHH 1Y0LB 3WS3B 1GOGA 1XMWA 2KUTA 4C56A 3IAPA 4AYFA 2YSSA 1UWEH 1Q38A 2OSLA 5F6IB 5FM5M 1KYOJ 2DOCA 2HVJB 2WWKO 2VAAA 3B9KC 1QKZL 4R4FH 5EU6A 2QR0B 1QVOB 5GSRB 1EK3A 2OQJB 4MVBD 2DI7A 2JCCA 2A77L 1AKJA 2IF7A 2AJ3A 5DJCB 3DMMD 1L7IH 4YH6A 1MCWW 1JHLL 1J87A 1RHHB 2AJVH 4MXVE 1F4WH 3CH8A 1YNKH 3BZDA 4FQHB 1U2HA 4WU5B 2Y36L 4ZUVB 2ADJB 1TXKA 4JHWH 4U7KA 1A7PH 1IC1A 2H1PL 3RIFK 1Q72H 2X9WA 5EZIL 2AV1B 3IS0X 2YR3A 3QQ3B 3UJIH 3HE7A 2FBJL 1KIPB 3GJFH 4L8SC 3TN0B 4ZOEA 1YY8A 3LCYA 4F7PB 5BRZA 1LP9F 1NAMA 4PJBF 4J8RB 5FO9A 1MFCH 4S2SB 3MLWH 3FQNB 3U2SB 5F9OH 1U8QA 4OD3L 4L3EA 4GS7C 3NN8B 2HTKD 4XP6H 4ONFH 4UAOC 1FVDA 5D93C 1DP0A 1SVZA 4OFYD 5IFJB 3QWQB 4Y19B 4M1CD 4WWKB 5AYUH 3VFUB 4YFLI 3U4BH 1B3JA 4NO2A 1M4KA 4NT6B 4JG0L 1IC7H 4UNTA 3C60C 3QFJD 3SQOL 1FL6B 5F7EH 3G5ZB 2A9MH 4AL8L 3C8KB 4O00A 5GRWA 4XC3L 3TJEL 2PTVA 3DVGB 4NQVA 5BQ7B 2C3GA 1HH9B 1V7NL 4UBDC 3QCUH 8FABB 1KCSH 1UWXK 4K07A 1NCWL 3LSOA 4EI6B 3HNTH 2IAMB 4N0RA 3OKYA 1LEKB 2NY1B 1OPGH 4EQ2A 5IW6A 5CZVH 1QD0A 1H15B 4KC3B 5I9QC 1MCLA 4FRWA 1JP5A 4ZUTB 5IMLB 1RU9H 2QV2A 4Z7OE 4S1RH 3FO1A 4MXQD 3UYPA 5MEQB 2BNQD 4LVOC 4LRNH 3UMTA 4GBXD 4M4PA 5IMKA 5CLTA 1HI6A 4GKSB 1MAML 1S7RB 1UACL 1QPXA 5DJZA 3SHSA 4KROD 2DBLL 2YRZA 1EFQA 1KB5H 5D71L 4K3JH 3LDBB 4MJ4A 1DLFH 1RQ5A 4WFFE 2HMID 2OP4H 4LVEA 5F8QC 3PL6D 3SO5A 4DWHA 1XCTA 5DK2B 4DUXA 1ZHBB 3NH7H 3WBDA 5GGTH 4NQEE 4CN6A 3O6LH 1RUAL 4O4YL 1A6TA 2DDQL 3LV3A 1A22B 1ETZB 1A47A 3LOWA 3O4LA 4EDXA 1EGJA 2NTFA 4NQCE 2PYEE 3QHTC 3MXWH 2E7MA 3BYYA 1FVCA 5KG9B 4KKNA 4QRRA 3T0XA 2JF1A 3L3DA 5T1LA 2ORBL 1A6AA 1AD9A 1S5HA 3V6OA 3OXRB 1W0YT 3BKMH 4MS8C 1V7ML 3IFNL 4OBRA 3WL9A 4N1CA 2FIKA 4PJ5B 4RMWA 3VFMB 4Y5XA 1FGVH 5EORH 1N8ZA 1U8NB 2F53E 2YC1B 2ADFL 2JK5B 3EYSH 1JPST 4DGYL 5IHBA 1MWAA 1T7WA 1X5KA 3MCKB 3LHPH 3QDJA 5KSUA 5CAYB 5BVPH 1XGYL 4PJCB 4OI9A 2EC9U 5BZDA 2AEQL 1KB9J 1G7MA 5JMOC 2YK1H 3FN0H 3CGTA 4ONHB 4XCCL 4MA1B 5IVNA 3CLFH 1HYSC 4HIHA 2ZJSH 5GS0L 4Y1AD 1CBVL 3DVNB 1CVSC 3GSNH 4LNRB 5IGXH 4LRIC 1R3KB 5IB2A 4K2UL 1YY9D 3ARGD 5E5RB 5F9WB 3NPSB 1IVLA 5FK9B 3BE1H 3GSUA 3QWOA 1F3JB 1FFNB 2YA1A 4P5TC 4TUJB 2BOBA 3V8OA 3IF1B 4QHKJ 4NZTH 2BCKA 3B43A 5BZWB 3T77A 3RI5F 3SCMC 2C3WA 2F5AH 2MKLC 4LPYA 4YE4L 5EA0H 4KMTL 3ZKQD 1MI5A 4LLDB 3RTQA 4NO0D 3ARTA 4ZYKB 1FO0L 5HGGS 1A4JA 1AGDA 2CIKB 3TT3H 4XT1C 1EAPB 1P4BH 1BZ7A 1BVKA 4YGVB 4TULH 3JTTA 1PX4A 4NZUH 5IW3A 1NC4D 4BQCA 1YZZA 3OTTA 1CXKA 2GT9B 3IDIB 3FRPA 3KJ6L 3RVVC 2YWZA 3WIFB 1QHOA 1UM6H 3CFDB 4F37F 5D7IB 3MC0A 4NRXB 5ICXB 5BS0A 2UY6A 4J1UB 2GFBA 1MHPH 1A1MB 3DGGB 1GPOL 4JY4A 3O45B 3L9RB 4L4TE 1LD9B 3F7YB 2DM2A 4JPWL 1T5WA 4KFZC 4XNUH 4F7TB 2K7PA 2R1WA 1WBZA 3OZ9L 1XGQA 2P48B 3DYOA 1W72A 4XBPA 3GMQB 5I71C 4OT1L 1QLEL 4LLUA 4NDMA 3SKJH 1K6QL 3A0OA 1EJOH 3BZEB 1BFVH 1XGTA 4HUNB 1PAMA 5C0AD 4XH2B 1J88A 2DM4A 4MWFA 5DA0B 4KQ3H 3BP4A 4PJDE 3KLAB 4NC2B 3U7WL 2ERJC 2C9AA 3NCYS 3TIEA 4U33A 4IMLB 4RQQA 1TJGL 3GDBA 4L3CB 4CL7A 3JSSA 4YQXL 3QCVH 1JGEB 5LAXB 2AABH 5DK0A 3ROOB 2FL5B 3I85A 1I8LA 1BPVA 4ZDHA 2PTUA 2ZOLA 2XFXB 2C1PA 4N1HB 1CTNA 3E2HB 3ZKXC 5T3XD 4AENA 1H5BA 5GS2H 1XH3B 3LEVH 1G6VK 4LEOB 1ADQH 4TN9A 4ZFGH 3C8HA 1F58L 3O9WC 2P1YA 3DX8A 1FNEA 1MEXL 4PJXE 3WFBH 3K80A 1VFAB 1CLZH 1FGNH 3T0VA 4OLUL 5FO8B 3V6FA 4DKFH 3WFZA 2YHGA 3D0LB 5FCSH 4LLMB 4O9HL 3MRMA 3MUHL 3PHOA 2JIXD 3BQUB 4WHTB 1KLUB 4DN3H 1I8KB 3GK8L 4U6TA 2H3NB 4OI8A 3SE8H 1FL3B 1KN2H 4OCNC 2X4TA 3VWKB 1V8HA 1J1OL 3MTRA 1V3MA 1SBSH 1UA6H 5FYKU 3P4NB 5L7XH 2QQLL 3MR9B 4PR5A 1E4WH 1JI2A 1OP3H 2B5IB 2D0FA 4JN1L 2UZYB 2C4FU 1K8IA 3BAEL 2GITB 4H25A 1NJ9B 1WC7A 1NL0H 5C6TH 3OJ2C 3ULUE 4Y5VB 4JDTL 1QFUH 3CSPA 3TP4A 5IOPB 5GRJL 3HUJB 1DVFA 3STZA 5J6GB 2ITDA 5I30L 3JVGC 4HWBL 3SDXF 1SQ2N 4I3SL 1A14L 2EEDA 1SYVA 2J8UB 5DMKA 1IM3A 1VADA 3VI4F 4AG4H 2ZPKL 1HWGB 1HXMB 4PJGF 4XHJD 3HPLB 3CFKB 3L3KA 5C07E 2QQNL 3HC3L 4J2XA 3RL1A 4Z77B 1XFPA 3UBXB 1A7BA 4MX7A 1MCJA 3IFLL 4IRSD 4X80H 5CIPH 2KKQA 1B4JH 3VU2A 5JO5B 5B3NA 2FZ3A 4U7SA 4XB7A 5HBBA 1KNOB 2X7LA 2J6EH 5FA4B 1C8PA 2P4AB 1HN1A 1MCFA 1YMME 4Y5YC 5EZJB 4JDVA 3OR7B 4BH8B 1U95B 5LKNA 4EI5D 4FFZL 1WIOA 1J86A 4YBQD 4OGYL 32C2A 4DFHA 1JF1A 1S9VB 3RPIA 1BOGA 3RDTD 1IL1B 3I50H 3NCEB 3QIUB 3RL2A 2D03H 5CFHA 1OTSD 4P2OA 3WIIL 2UVEA 1OSPL 1TNNA 1JWUA 4DAGL 5IVOA 4FN0A 7CGTA 5CD3A 2EH8H 3MNWA 1G7LB 2GKIA 3U4EA 2Q3AA 1QFHA 5EU5A 2GTWB 4GG6B 1FVEA 4OLXH 2A0LD 3BP5A 4KXZH 2PYEA 2BJML 3RY4A 4DKEH 1IEAB 3HMWL 4F7MB 4HPOL 4JQVA 5KVDL 4YO0A 1WZ1H 4NFDA 3GSOA 4BQ6A 1RZFH 4JG1H 3H9ZA 1II4E 5ACMA 1ZANL 1XIWD 3IYLW 2VE6B 4NQED 3OL2A 1U3ZA 3REWB 3KYKL 3MA9H 1T04B 2F53A 1HZHL 3THMH 4NCC2 4AH2B 1MCOL 5I1CL 2EDDA 1JF6A 5DUBB 1S7UA 5IFHL 4WCYH 1Q94B 4FQ1H 4QHUB 2DMBA 4KK5D 5T33H 3HPJB 2FEDD 4HPYL 2DM7A 4Q6IA 3S37H 4ORZC 3MREA 1QBBA 3PQYE 1FPTH 4KRLB 4PGBB 1I4FA 4G6KL 1M1SA 2Y4SA 1I9IL 5HYQB 1PG7L 4DEPB 4PRNB 4O51A 5ID1A 3RZCD 2DQTL 1FBIH 3VXQB 5LBSH 1ORSB 4X9FA 4I4WB 1X5YA 3SKOA 1C1EL 1D9KA 3VXNA 3MLUH 4JFFB 3WD5L 2Z31C 1UZ6F 4K9EC 4QHLA 3DV4A 1FH5H 1TZIA 3EDJA 3BJ91 1IT9H 3T04D 3GUTA 3CX2A 4OV6F 4AY0A 4C56B 2V7NA 3VH8G 2YSSB 2NLJA 2OSLB 5GJSH 1MQKL 1OT2A 4ZXBC 1GYAA 4M7LT 4CVZA 3QP3A 3D2UA 2CMRH 2VAAB 3MV9E 4MNQE 5EU6B 3ARSA 4JFDE 2JCCB 1AKJB 2AJ3B 4JJHA 3MRJA 3OG4B 5HI5C 2WK2A 1MNUH 4DZBA 3ILQD 3SGJC 5IEKA 4JFED 1F3DH 4ODSH 4QHNA 4K7PH 4WFGE 2Q8BH 1DFBH 4PP2A 3RHWF 4POZC 3HE7B 2DKUA 3WO4B 4TNVF 1YY8B 1P9MC 5BRZB 1JGLH 1NAMB 5FO9B 4NZRH 5JW3L 2YPLE 5CJOH 4JCLA 5F9AC 2MHAA 4JO4H 4U3HA 4DN4L 2R1YB 1U8QB 3UTPD 1O5DT 2FNBA 4G7VH 4L3EB 1FVDB 4IMKC 1JPSH 2ZCKL 5FYKE 4X8XA 2DIAA 5DR5L 1F2XK 5T3ZH 4NO2B 5FOJA 1LQSR 4L4TA 2XRAL 4KKCD 4E41E 2NXYC 1N0XL 2DQEH 3TVMC 1QYGH 5LGHH 4NQVB 4MDIA 5I2IA 1I7UA 1MJ7L 1UB6A 5HD8C 4XNXH 2J7LA 3Q6FA 3HAEG 5I8OL 4HK3J 5KTEL 1NSNH 3FL7A 3LSOB 2H9GA 5KVFH 5MEND 3BVNA 3QXDA 4PJDA 1N26A 3U82B 3VG9C 4KK8D 5IW6B 1IE5A 4DGIH 2DWDA 3H42H 3S35H 5HI3D 4OLVL 3N9GL 4KHXH 1UWXH 4LSDA 5DA4A 5EDXA 5EOCH 4PB9L 5HHXH 3FO1B 3TFKC 1EO5A 4PS4H 3O8XA 5IMKB 2GYSA 2DMKA 1HI6B 3QPQC 5DJZB 2CKBH 2VLJA 4JN2A 4J3UA 1IGJB 1XCTB 3F7RA 4JZJC 3JUZA 4O2CA 2LAGB 1ZLVK 4PJXA 4PJHE 1DCLA 1L0QA 4QXWA 5F44A 3LPGA 4P4KC 1A6TB 2X41A 4GT7A 5CUSL 5EWIH 2I24N 1RY7B 3H2WA 3LV3B 3O4LB 5JW5A 1A7QH 4EDXB 4KJWC 4OJFL 3Q6GH 4KVNH 5CEZE 1FVCB 4QRRB 4KJPC 1G6RH 4Q58C 4WRLA 3L3DB 4J3WA 5T1LB 2AXJA 1A6AB 1AD9B 1S5HB 1VFMA 3EDKA 3WL9B 2FIKB 2HLAA 1Q0YH 4XPFL 1H3WM 2LU4A 4WI4A 4Y5XB 5EOQL 1N8ZB 2X70A 2W92A 1M71A 1MWAB 5I74B 2FH6A 3QDJB 2EDWA 3MGAA 5KSUB 1FNSH 3RUGA 2F8VA 1ZT7A 4UTBL 2ED9A 5BZDB 1IAIL 1G7MB 4RX4D 4YPJA 4K9EL 1CFSA 4WI2A 3V52H 3K74B 4CU6A 1RZ7L 3O2WL 4HIHB 2OMNA 3H7BA 5ISZE 1V5JA 4PJ7F 4KZEH 1NCUA 3SOBL 2IQAA 4RGNC 1WWAX 2BSED 3UDWA 3I3DA 5ANMA 4B7IA 3EJYD 5IB2B 2QJDA 2CRZA 2ILLA 3QEQD 3ZYZA 4DQOL 3VD3A 3GSUB 3QWOB 4QXUL 5GGQL 4LFHD 2BOBB 3I9GL 2BCKB 2R0LH 2X1WL 3T77B 1FRGL 1VACA 1GGCL 1BBDL 1KFAH 1YMMA 2F5BH 5F7DA 1EEZA 1MI5B 4PJIA 1K4DA 1TIUA 3NABL 3RTQB 5I73B 5IHLB 3ULVC 3ZT7A 3ELAT 1A4JB 1AGDB 1BJ1H 2ZWLT 3G08A 1BZ7B 1U41A 2XY1A 1BVKB 5A3ID 3JTTB 3LQAC 5KJRL 1BEYL 3N50A 3CD4A 4U6VH 3NA9H 1JK8A 4OD1L 3MLSH 3RKDC 3BKYH 1X4YA 4NWUL 5BS0B 2C5DC 2FO4A 4DK3A 5DFVD 5ALBH 5TE7H 2GFBB 2VDOL 2NY0D 3C5ZC 5KSBE 1OWRM 3QIWA 4JY4B 4G8GD 4HLZH 5DT1L 1T5WB 3BYTA 5KVEL 2R1WB 1RV6X 1WBZB 1XGQB 1W72B 3QB7C 4XBPB 5FCUH 3C2SA 3QHFL 1TLKA 4HV8A 4UZGA 4LLUB 4NDMB 2CUIA 1XGTB 2EZ0D 4NQUA 4MWFB 1OW0A 2UYLA 3BP4B 3WFDH 4AZ8A 4LEXL 4Z18A 3PQYA 1RPQA 2R23A 2BY2A 5TE4L 3LRSA 5D1ZD 2HFEA 3QA3A 2Y9RT 3TIEB 4LAJH 4RQQB 4F8TA 5DRWA 4AMKH 2B1AL 5IIEA 5DK0B 1NQBA 1SEQL 5E2WH 1DSFL 5DHYA 1MRDH 4XPAL 3CDFA 2IBGA 4ZDHB 2DWEA 5TFSH 1KPRA 1A6UH 2ZOLB 1L9MA 3CVHH 2C1PB 3NA4A 1AO7E 1XT5A 3V0WL 1JN6A 3ARBC 3C2AH 3MODH 1NANH 3OKLA 5EC2A 4AENB 1H5BB 2A6KA 4NSKA 4PYGA 3C6LD 1FNGA 4YR6A 1A7NL 1F90L 3RBSA 2VC2L 3RWEA 3DX8B 1FNEB 4MNQA 5SV4A 3MCLH 4L9LC 4JFDA 5TQ2L 2IFFL 3ZE1F 2F19L 3RX7A 4P9HC 4MXWH 4JM2A 3FQRA 1CF8H 3V6FB 3L6FA 3TZVC 3MRMB 3PHOB 2UUDK 1JMXA 3E6HA 2ZKHL 2MNUA 3Q5OA 3MFGB 4LK4A 3L1OL 3V95A 2CXGA 2X4TB 1AGEA 4C58B 1OCWH 3P0YL 5ADOL 2DD8H 2DLEA 3MV9D 3DMMC 2VDQL 4TVPD 4PR5B 5DJYA 3N85L 4ODVL 1VENA 4R7DA 3VFVA 5GS2D 2BNRE 1K8IB 4X5WA 1WC7B 2YPLA 2RCSL 4N0YH 3VFWA 3IU4L 4F9PC 2O61A 3RWHA 2KDGA 1DVFB 3GIZL 3STZB 1IQDA 3OXSA 2ITDB 5LGKA 4KVCH 4O2FA 4FFVC 2IMNA 4H88H 4LDOB 4WFGD 5DMKB 1IM3B 5DGQA 3TV3L 1VADB 5JQ6H 1CE1L 3H9SE 4Q2ZB 4HMDA 2D4DA 3LN5A 3VJ6A 3L3KB 3K8KA 4OCSL 3VA6A 2Z93A 3LN4A 2HTKC 3AXLB 3DJ9A 5TF1H 2WIMA 3RL1B 4MX7B 4Y89A 3LEYH 1RZ8A 4M1CC 3MZGB 1JZ5A 3DXAD 2ZSWA 4DVBA 4JQIL 1AJ7L 2FZ3B 2VH5H 4HEME 3ZLQC 2X7LB 5FHBH 4HQQH 3RAJH 1B90A 3SY0A 3U0WL 2ESVD 4XCFH 5BO1H 3LQAL 3F6LA 4C83A 1A1NA 4R2GC 4NKOA 2ATPA 3GMPA 32C2B 4M48H 1JF1B 3FFCE 1E27A 2CDEA 5FUOH 5B8CC 2R1XA 3O81A 3P40A 4XGZA 3RPIB 1BOGB 3T0EA 4WI7A 4KMLB 2FB4H 3RL2B 3K3QA 4P2OB 1I1AC 5DDHA 3ZDXF 4XAKE 1JFQH 5TQ0L 3VFRA 1HQ4B 1JWUB 3MJ9L 4JZNA 3QI9D 2OJZH 4MXQC 4MA7L 1IGML 1TITA 5CD3B 3NCJL 1I8MA 3MNWB 4GBXC 1L6ZA 1MPAH 2MPAH 3U4EB 3O6FD 4LKXA 5L9DL 4NHCH 4KROC 3BP6B 3NCYP 3KDMA 5EU5B 4U4BA 3T1FA 4Q97A 1FVEB 2O5XH 4IRJA 4Z7WE 3BP5B 3V7MA 1KC5H 2PYEB 1MF2H 4HSQA 4I1NB 3O3AA 4YO0B 1BD2E 3GSOB 4Y2OA 1S7XA 1T1YA 1J05A 5DRXA 3BT2L 1TZHA 1IKNC 2HA1A 4ONOA 4ZUSA 5A2KH 5HVWA 4CW1A 1DUYA 1UWGL 2F53B 2D0HA 5EO9A 1OAQL 4J6RH 1S7UB 1GC1H 3WS6C 1MCBA 4H8WL 4Q6IB 1WISA 3MREB 1I4FB 5EBGA 3D18A 1GSMA 3WKML 2VXVH 1X5AA 4R7NA 2KL6A 4O51B 3QO0A 3MROA 4N8PA 5ID1B 1IQWL 3L5WB 1MCSA 2D7OA 3EW3B 1R3JA 3SKOB 4WV1C 2R8SL 1D9KB 3VXNB 5ISZA 1E4KC 4QHLB 1LP9A 3DV4B 1TZIB 4PJBA 2EDHA 5FYJU 1QTYT 5A16A 3GUTB 1T03H 2V7NB 4P9HL 3S34L 3QO1A 2NLJB 5AZ2L 1P1ZA 4P46A 4LLQA 5HDOA 4WENB 4E42A 5IBUG 4CVZB 2XZQH 3D2UB 4ZOAA 3UTZA 2UWEF 2QQKL 3WXVH 2VQTA 5IW1A 3LY6A 4PG2C 4LIQL 1G1YA 3MRJB 5E08H 4HDIA 4P57A 2HVKA 4JHAH 4ODHL 1ZWIA 4JO1H 1YY9C 3ARGC 5IEKB 4LHUG 1R3HA 5AG9A 4DFIA 4QHNB 4Y2DD 4PBVC 4YXLL 4M6NH 1FZKA 4PP2B 1UKSA 5HHME 2H45A 5HPMA 1KIRA 5GISH 4PB0H 3LZFL 4XNQA 5EIVA 2QSQA 3BO8A 3L5XH 2Z92A 4N90E 1PKQA 4BQBA 3NCCB 4H1LH 3DSFL 4CU8A 4P3CH 3LH2L 3GJFB 2WP3T 1KOAA 1OAKH 2MHAB 4WTZG 5GGSY 1F8TH 5JOFA 1WZMA 5EU7C 2OLDA 1BVLA 1CGSH 2XXCB 3FAWA 5F1SA 5JW4Q 5KSBA 4LGSB 1WT5A 2OBGA 3X17A 3SE4A 4KY1H 4XC1L 4L4TB 3KR3H 2D9CA 2FD6L 1MVFA 5CSGA 4LLWA 1AY1H 4CRPA 4OZFA 4FFYL 4MDIB 5I2IB 1I7UB 1UB6B 4MMXC 2Q8AH 3HE6D 4BSJA 3Q6FB 1MIEL 4Q0XH 2I27N 2ZCLL 3MGTA 1TQBC 5D5ME 1Y6NR 4A6YL 1ERNA 4N8CH 2H9GB 3BVNB 1P53A 3AFLA 3QXDB 4PJDB 5EUOE 5B38A 4OZIF 3GB7A 3R0MA 2DWDB 3VD7A 3H3KA 3G6JE 1QBLH 1YEHL 2X1QA 3QRGH 3MRGA 3A67L 4RNRA 1OQOA 3X11A 4R6UA 4X4XA 3BIAX 4R26L 3NACL 5T3ZD 1UKQA 4FZ8L 5H37H 2VLRD 4IIQC 4M62L 3O8XB 4JVUA 3W2DH 3JWOL 5F3BA 2XPGA 3GHEH 1W0VA 2X1OA 2VKXA 3V6ZA 5INDA 5AWNH 2VLJB 4M1GH 4HFUH 4JN2B 4FQXA 1MAKA 2XICA 3RU8H 1YN7A 3ALXA 2EIEA 2DQGH 3WNMA 4O2CB 5LQBH 2IPTH 3CXDL 1HOCA 4PJXB 1FFRA 1ORQA 5IUSA 4IHOA 4RDQG 1JBJA 1CIUA 5J3HD 3QG7H 3F62A 5JW5B 4LCCC 3TPUA 4UB0L 4PV9A 1ZLVH 4AEIH 1AO7D 1XR8A 1WAAF 3CX5J 4OTXH 3AREA 2GJ6D 3MV7A 4OCWH 4OIBA 4MQXD 1L7TL 4Y4FD 1K5NA 5T1KA 3QAZC 2YUVA 3OR6A 4TUKL 1BHGA 5LVEA 4KRPB 3UO1L 2X70B 1GGBL 1M71B 3WFHA 3OAUL 1VA9A 4HS8L 3NZ8A 5E2VH 3OAYK 1PBYA 3RUGB 1ZT7B 1S9KC 4HF5L 3CZJA 3JZ7A 2C3VA 2EKJA 4JO3L 1KENH 1CFSB 3PV6A 4JB9H 4PRPA 3WJJC 3EOYG 3LKNA 3NGBC 4JPVH 3H7BB 3H9SA 1BIIA 4B5EA 4KZDH 2IQAB 4QT5B 2BNRD 1CXHA 5ADPL 4LLYA 5ANMB 1AHWA 5C0CE 2E7BA 1A3QA 5JIKA 3RI5K 4QWWD 2IQ9H 1JRHI 4QOKE 3T4AA 1TVBA 3MLRH 4RDQF 3MBXH 4PJ9D 4PUBH 3D25A 4CMMA 3IJHA 1FE8L 4I3RL 2FHFA 1CD0A 1VACB 4XHJC 1CG9A 2XYCA 5FYJE 4BZ1H 1YMMB 5F7DB 1EEZB 4PJIB 1K4DB 3FT3A 4HWEH 5MI0B 1CL7L 2B4CH 4IRSC 2NX5E 4HKBA 3FFCA 3G08B 3FZUD 4B7LA 4XPHL 1LO2L 4JRYD 4HD9A 2APXA 1CR9L 1IC4H 4J3OC 1NEZA 1HINH 5K9JH 4ODTL 3BJLA 5HDQH 2PXYD 3U36A 1JK8B 4LHQB 3CH1A 4GQPH 3NIFF 5EULV 3VD4A 3GHBL 2X4PA 3QUZA 2ED8A 1BJMA 3VGGA 4EI5C 3MRRA 4PGDA 4XMLH 2FO4B 2IC2A 2VQUA 4NQDE 4YBQC 5HYSB 5J12B 4XVJL 1KGCE 5GGVL 4W4OA 2VR4A 4Z7NF 2R4SL 3RDTC 1DBJL 1FNHA 3QIWB 1T6VN 4Z7WA 2DTMH 1RZKH 1G9NC 1YJDC 5HPOA 5JXEA 4IDJH 1BFOA 1BD2A 4KTDL 1Y6KR 5CJ8A 1RVFH 2XWBA 1KPVA 1J1PL 1E6OL 5DUMH 2H2SC 4HV8B 4YHZH 4WI3A 3QHZH 1WZLA 5K9KA 3STLA 2A0LC 3AMKA 1TCMA 2CJUL 4P2RD 2UYLB 4LPWA 1GGTA 3ZYIA 3U9PH 3WHE0 3PQYB 2R23B 5D2NE 3LRSB 2HFEB 3QA3B 2PW2A 2W0LA 1IBGH 1XIWC 1SYSA 2HP4A 2F74A 3AMLA 5D1QD 2VO5A 3S37X 5T5FL 4NRYA 5DRWB 5IIEB 1MFBH 2OTPA 4FQLL 5DHYB 3QUXA 2OTWA 4G5ZH 2DWEB 1I1CA 4KK5C 1KPRB 5JZ7D 1DBMH 1JN6B 2VJXA 4P2QE 4O58L 3RGVA 3OKLB 3ZSTA 5EC2B 2G75A 3BX7C 2A6KB 3TO4D 4NSKB 4KDWA 1R3LA 1FNGB 3RZCC 3BRDA 4YR6B 1I9RL 5E4IA 3SDXA 3RWEB 4NQTA 4MNQB 1NPUA 3V4UL 4JFDB 4HX1B 1MFEH 4K94H 4YK4B 1EHAA 5K9QG 3K2UH 4JM2B 3FQRB 1GZQA 2CR6A 3SKNA 5CILH 3L6FB 2M2DA 2OR7A 4Q9QL 4L5FH 2ZG1A 5CGMA 1G9MC 3E6HB 5IJKC 5JOEA 2EC8A 5C6WH 4L8DA 1AGEB 4HJJL 5GRUH 3D85A 4R96B 1BM3H 4G6JH 5EIQA 2EYTA 5DJYB 1NMCB 2UUDH 4KUCD 4R7DB 3VFVB 4K7PX 3M1BA 3BPOB 3KNBB 3VGAB 3ILQC 4X5WB 5F7HA 2YPLB 3BP7A 3VFWB 5DHXB 2AJYL 2O61B 1ZLSH 4XNZB 3RWHB 1Q9OA 1TETH 1YYLH 2MTPA 5CJXA 4Y4KA 3WDHA 1AH1A 1IQDB 4X6BA 3CMGA 4HXBL 4EXPX 4PY8I 1BQHA 4O2FB 3RY6A 3FKUS 1I85C 3QUMH 4G8EA 5IR1A 5MEOA 1MCHA 1MJJA 3C08L 3LN5B 3F58L 3VJ6B 5GZOD 1QRND 3OV6A 3ET9F 4X9IA 4NJ9L 2D4FA 3MLZL 2Z93B 3LN4B 3RVXD 4FP8H 3QG6A 4M7JH 4XNYL 4UV4H 4N9OB 5EH1A 2X1XR 1RZ8B 1WGOA 2AJSL 1I1FB 5DTFA 4S1SL 5EUOA 2ZSWB 4U1IA 2OL3H 4FA8A 4DVBB 1DQLH 1J8KA 3WFEH 3K81A 2H32H 3AY4C 1OM3H 3SY0B 1FLTX 1MUJA 2IG2L 3VDAA 4TTDC 1T20A 1NGPL 3QR2A 3S35X 4PJCF 5EBLA 1I7TA 1UCBH 1R5IA 4NKOB 2ATPB 3GMPB 4HCRL 3VRIA 4OGZA 4OM0L 4WDIA 1E27B 2CDEB 5D7JA 1TQCB 3RWJA 2R1XB 4LSVH 4XGZB 3T0EB 4K3DH 4G80A 5C86A 5TPWL 2EE3A 4OM1H 5F6IC 5HI3C 1J0JA 1GOHA 4P23A 5DDHB 5KVMC 2E27L 5F7LB 3FT4A 2EH7L 3VFRB 4UT6L 1ND0A 4JZNB 4N9GA 5IP4A 3EHBD 5I1EL 3WHE1 1XF3A 1I8MB 3U0PB 1JNJA