5I1DB

Crystal structure of human germline antibody ighv3-23/igkv4-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
210
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 210
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1dB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1dB01
1CDBA 1U42A 5C0IB 1RMFH 4OLVL 4I9WE 3QIUD 4OZGA 5DJ2B 1S7QB 3BPLB 2VDML 3D3VE 5T1KA 4H20L 2DQEH 3P4NB 1JGDB 4PBXA 4R4FH 5H94B 5HI4D 5L8LB 5J1SC 3EO9L 3IAGC 2H2SC 4HC1L 1RIUL 3GSNL 4U1IA 5GRJH 4W4OA 2BVQA 4Y4FC 1OSZA 3RWJA 2VITA 2HJKA 5CD5C 3VXSA 1FL3B 1TPXC 1YN6B 2VXUH 1T7YA 5F7EL 3QBTB 1QYGL 2EH8H 4HUNB 2EXWD 3SDAC 1RIHL 5HYFA 4N90E 5A1AA 1KENL 1KEML 3U9UB 3O9WA 4NWUL 2Y7QA 3KYMA 5DMIH 2F8VA 3CCHB 1F5WA 2QQKL 3FMGL 4XC3L 3KGRA 5EOCL 2YC1A 1BEYH 2OL3L 2VR4A 2OSLB 1EJOL 2VISA 3C8DA 1BWWA 3MRHB 4RGNE 3TO2B 3WUZA 1I1AA 4L8BA 4HGWA 3BEWA 3VGFA 2Q3ZA 5IV2B 1CTNA 1U8KB 3TBSB 1KIPB 1TTGA 1QSED 4XVTL 4APQC 2ADGA 2PO6D 5DD6A 1YY9D 3PWPA 4QRPE 4LQ1A 4NO0D 3D0VA 2EO9A 1EJ6A 4LLQA 3G5YB 2AEQH 2VDQH 2HMIC 5C3TA 1AGBA 3MRFB 4NQDD 4XBEL 1DQTA 1C12B 1JV5A 3HE6C 4UMGA 3RY6A 3VFTA 5DFTA 3WFEL 2BC4A 2CRMA 4GBXD 4XBGA 4Y4KA 5AYQA 2XFXA 4OIIH 2YZ1A 3KYNA 4NNXA 1LO4L 4UQ3B 5LQBH 4FQJH 1JNNL 4JR9H 2X1XR 2Z31D 1CLCA 5E8NA 3NH7H 3HC3L 3REVB 1GGCH 2LTQB 1ADQH 1UKQA 1U8LB 2DQHH 4HK3J 2W60B 3B9AA 1MVFA 5DVLA 2Q6WB 5SWZD 1MCWW 1LO5A 1NFDA 5HXMA 2IG2H 4LSPL 5I17B 4LU5L 5IW6B 3X12A 4TQEH 1KACB 3WE6B 4C4KO 1N64L 2GJJA 4Y16B 3INUH 4RMVA 4KV5E 5CJQL 3T2PA 4S1RL 4TSAL 4RAUA 1AC6A 2WAHA 1FG2A 1ZT4B 4L29A 1F3RB 2P24B 5I8KH 3F6IA 3GZKA 1DUYA 5DJAB 5GGRY 1Q9LA 5JIKA 3TBWB 3L5XL 3DTXB 1Z3GH 3D39B 1UC6A 4I3GA 4PJGB 5E6ID 1FN4A 1KN4H 3L3JB 1PQZB 2OZ4L 1ZA3B 4D9RD 4D94A 3FT2A 1CXIA 1KCVL 5IEKA 2ZJSH 3VRJA 1IKNA 5GS0L 5L2KD 5LGJA 4U7SA 4MJIB 43CAB 5CSBA 1I7UB 3ZDZE 3Q1SL 2FEEI 2QEJA 3B9KB 4G3YH 3DVNA 5C0CD 5TQ0L 1WC7A 4NQED 4K7FB 3G6DH 1CGUA 1ZKAA 2NLJA 3D9AH 4U1KB 3NCMA 3W5NA 1IKFH 5HTSA 3IFPA 4WUKL 4MNHB 4DKEL 1RJZB 3OB0H 4UT9H 3T2OA 3KLHC 4YXKL 3NCEB 4KVNL 2R23A 4DW2L 3RNKB 2R9HD 4YJZL 1FCCA 3D1MC 1UQSA 2V2WA 2EDHA 1UXWB 5DUML 5C0DA 2X1QA 3FO1B 4Z7QF 3ZHKA 5E24E 3KXFB 1E0OB 3D25A 1CXEA 2EXYD 2MQ3A 4XP4H 1G6RL 1JPTH 5FCSH 4Z77B 1IJ9A 3HZMA 1RURH 3RI5K 5BJTA 1OGAB 1TJHH 3DROB 3HE6D 3JWOC 4MLIA 5JW4N 3QDHA 4X8JA 5C0GB 4AIZA 4HF5H 4NN6C 4PJGE 2G60H 4AENA 2VXQH 4OCSL 4DK3A 2HLAA 2Y36L 1U8QB 3WFBL 3VG9B 1C5BH 2CDFB 1C16B 4EN3A 4O02L 4KTDH 3MBEA 4LF3B 4XWGH 1MQ8A 2P8LB 3I2CL 4MJIE 1II4E 4Y2DA 1IGCH 4JPKL 4WW2A 5DD0L 4QXGL 3PV7A 1WAAE 1KJMB 4QY8A 1I7ZB 4QF1B 3QUMB 4YAQB 1B0RA 2E7LA 1MWAA 4WHYH 4XX1E 1CF8L 4B7LA 2P5WB 4I2XA 4JZNB 4LSUH 3DURA 1YNLL 1YEFL 1KEGL 4ODSL 1DQMH 3N1FC 2FX8H 3OKKB 2DDQH 4PRHA 1AR2A 1FO0L 3LAFA 5MEOB 4UOW0 4DZBB 5ESVA 5HJ3A 3D2UA 1BZ7A 3KXFE 4I3RH 2PXYC 2IPKA 3ULUD 3HNVH 2ZCLL 4XCFH 4HWEL 1D5MB 5ENWB 1OGAE 3MC0A 1XGRA 4N0FA 1JWMB 1B0GB 4NRZB 1Z9LA 5K93A 2VL4A 4HBCH 4PJXA 1HHIA 4H0HB 2WIIA 4M02A 2PYFB 4J7RA 4ZUTA 1AO7B 1X7QB 4OGYL 3U9PH 1QPXA 4YQXL 1A7PH 4ELMB 3IAPA 1MELA 1FZKB 4WO4B 2UYLA 3O6FD 4P2OC 4MD5B 2NX5B 4GG6F 4KKAC 4LAQH 4MB3A 3NGBB 2A83A 2YD9A 3RGVA 1LQSR 3AU1A 5C0AB 3ARDA 1MHEB 3QULA 3RWFB 1CZ8H 2XN9A 1JZ7A 1IAIL 2VDRL 5IG7A 4BZYA 4NM4L 1E4KC 4NZRL 2VLMD 4GKNA 2WLZA 2P5WE 3GI9L 5BOPA 2DIAA 4OLXL 3H6JA 4L4TD 5DYOA 5E8EB 1UB5B 1JUFB 5I0ZA 3BUYA 1CL7H 1ROWA 2DLIA 3QIWC 3IXTA 1F45A 4LSSH 5FYKU 3IJSA 3FAXA 5TQ2H 4MAYC 4I0KA 4KXZH 4AIXA 4RGOH 3LS4H 3BH8B 2AEWA 4IM8A 5CEZL 4ONGL 1CD1B 1QLFA 2DKMA 1WT5A 3TBTA 4JDZA 4GLRH 3QFDA 3PIQA 3WLWC 4AY0A 5DQ9A 5E00A 4P3DB 2JCCF 1FFOA 2Y5TB 3MUGB 4I4WB 3NZ8A 2DLGA 5KVDH 5IBUG 1IM3A 3SO3C 3ARVA 3MRQB 2OXHA 4C56A 1NGYB 5IMOB 1JCKA 3WSQH 1EK3A 1MFAL 3BYYA 3KPRB 1AO7E 3OKNB 1EAJA 1JYXA 1XZ0A 4WHYG 4OT1L 5DA4A 5E94A 5MI0C 1UYWH 1WBYA 4ELME 2D4FA 5ALBL 4GRLB 4RFNC 5J56B 43C9B 3QWRA 3BE1H 3PL6A 3MOAL 5CD3B 4JFPB 5D7SH 1PG7X 4AG4H 3BDYL 3U4AA 4CGTA 1MCEA 3B9EA 3KJ4C 2XWTB 1FGNL 4X6DE 5FA3B 4UU9A 5LGHL 3MMEA 4Y0GA 1C5CL 2BRRH 3BZ4B 3BPCA 4Z7UA 1FG9C 3Q5YA 3VH8B 1SY6A 4ODUB 2BXYA 2YPLA 1XR9B 5CCKL 1SBBA 4B5EA 3BZEB 1CLYH 2B1HL 4JG0L 1VCAA 1L6ZA 3VXMD 5DS8B 1IVLA 4PJFB 2YA0A 4Z78B 4HGMA 5KZCD 4FG6C 4CKVX 1EBAA 1OAZL 4RZCB 5GPRA 2EICA 2PW2B 4GKSB 3FQTA 3CFBB 5D1ZD 3QRGL 4PV8A 4ELKA 4Z18A 4HS8L 1NBYB 4FQIH 3MRNB 3TIDB 1QR1A 3E3QE 4ZD3L 1HNGA 3T2NL 2Z93A 4XAKD 1EFXB 2EDFA 1CDUA 3X13A 2DOCA 1IMHC 2VAAA 3KPRE 4KY1L 4E41B 1JIBA 1MLCB 3PE9A 4EBQL 4X5WA 3OHXA 2H32A 1KELL 4ETQA 3IU3A 2D03H 3ZYJA 4HIIA 4NN5B 4MLSA 3RAJL 3GJFA 3VRLF 3CX5K 2PCPA 1F97A 4ZOAA 2YZ8A 4Y5YB 4PRNA 4TNWK 3FQNA 3CSYA 1A7QH 1KPVA 1K4CB 3RVWC 2DQJL 2Q76B 5CWSA 1OCWH 4TTGA 3QIUB 1C1EL 2DJUA 1BBJB 1KIRB 4XXDB 3IKCA 4XVJH 1NEZA 4EOWH 1ETZA 3V4PL 3RA7H 1F3JA 5MERA 1H3PH 1DN0A 2JB5L 4FA8A 2EH7H 4OBRA 1J1PH 1CDIA 5IB1B 3BT2L 1UM5H 1ZT1B 4OFPA 4QO1A 1U8IB 3VI3E 1R0AH 5KW9L 4PJFE 2A9NL 4Y7MA 4TULL 3N1PC 4XP9L 3O4OC 3ZE2E 5CKGA 5DTFB 5HGBA 2P1YA 3MYJB 1MRDL 3VGGA 1KPUA 5CIPB 4HUUA 2CQVA 4YFLF 1Q9WB 1ZVSA 1MRFH 5KSAD 5E5UB 3UZQA 2IADA 2WBKA 4NP4H 5ABDE 3MRMA 4E41E 1NC4A 4NT6B 3T8XB 1ZAGA 2XQYK 3UTSA 1WCBB 1N8ZB 3I6LD 3BW9B 3ARTA 1MAJA 1QSEB 4R4BA 2PO6B 5A3IC 2CLVB 4KROC 4EDWL 3SKMB 4LKXA 2HTLC 1TTFA 4GMSL 4MX7A 3VG0H 1IAOA 4PJ9A 1UCTA 4NO0B 4H0IA 4ODHH 3V8OA 4TOYH 2X4SA 4J2XA 4PTUB 1J12A 3QXTA 4OFYA 2D7QA 4G6KL 4LDOB 2HRPH 1DBBH 3QH3A 3ZMRA 3IFNL 4M5YL 5H35B 3BP5B 5TH2B 2G2RB 5D7IE 4C58B 5CJXA 2F8XC 3UJTH 3AM8A 3VFSB 4FG6D 1RHHA 2C7UA 1MCFA 4S10A 1G7HB 4TSCH 3WUWB 1N6UA 4NQCA 2GSIA 1UACL 3MJ9A 1FVCA 1A3LL 2OTPA 2Z31B 3P4MB 1T6WA 3ILQC 4P3CH 3WFDL 4Y1AD 4N5UA 5IB2A 4M6MH 3IU4H 3U46A 4PJ5D 4JPIA 2Q7YB 5H37H 1DDHA 1WWWX 2CLZB 3GMLA 3MLVH 5GGVY 4L3ED 4A2LA 3V6ZA 1FORL 3QDGD 1UJ3A 4JFED 4PV9A 4Z7NF 3WS3A 2DMKA 4G9DA 4LHUG 2HT4D 4LVOB 4LCWD 3AY4A 4HW6A 1RUKL 1QTYT 3ZDYF 1A4KA 4HIXH 5T3XH 1P2CA 4Q0XH 3N0PB 3RUGE 1QSEE 5BZDA 4Q9RH 1YEJL 1QD0A 2GIYA 4KKLD 4MXQC 2E27L 3DVFA 1U58B 1A1NA 1D6EA 1HXYA 4LPXA 1MH5B 4LCCB 1ZTXL 4J4PD 5E6IB 4NQDE 4YHIB 4JREB 5C92A 4MQSB 2C3HA 1F6FB 2ZSWB 1O7VA 3QNYB 3MPCA 3QEUA 4TUJA 1SJHA 3LKPB 3QG7H 1Q94B 4R90H 1BX2A 5L2KB 2NY1C 4OF5A 4PG2C 3U7WH 2V7HB 1HHGA 2ZG3A 4Q9QH 3O11A 5DZLA 4K8RC 3U48A 4OCYL 2NY2C 3QI9C 5C0CB 4NQEB 3MREA 2VB5A 4JM2A 1VFUA 1UA6H 4OLZH 2BY2A 2A9ML 4PBVC 1JK8A 4CW1A 3BESR 2OR9L 5SWZE 1A6PA 4HWUA 2B5IC 1EEYA 2AK4A 2X7LA 3B43A 4OCXL 5IEHB 2J3SA 4FQ2L 3STZA 3RI5F 1D5BB 3OKMA 1KGCD 3I9GL 3OJDA 1D6VH 3V6OC 1QRKA 1JGVH 5I8CA 4JZJA 5CBAB 3CZFA 4YX2H 5KSVA 5DJ8B 4RX4A 4WHCA 3EYUH 1RHFA 2DS4A 4NNYA 2YMXL 4XNYH 4BQCA 2VE6A 4KK5D 1BMGA 3F58L 1BQHG 3B83A 3OBAA 1YPZE 3FN0L 5B8CB 2E9IA 1T7WA 2QLVB 5CJ8A 1E6JH 5JIPA 4OAWA 2YD5A 3DUUB 6FABH 3FOMA 2DTSA 2H2PD 3CLFL 5E5MB 1XR8B 4D9RE 4DJMA 1PLGH 5K9OA 5F71A 4ZPVB 5H37G 4K3JH 5L2KE 4G7YL 4ZAKA 5FO8B 5HHVH 5C9KA 15C8H 1OT2A 3GSXA 3GSQB 4FFZL 1DL7L 3ZKNC 4I0PD 5FDWA 1OLLA 5C0CE 4NQEE 1MUJB 1R24A 2P48B 4LBEA 2OLDA 1FV1B 5KG9B 4QRQA 4CMMA 4OB5H 1UEYA 3ARBC 4Q9BA 2OR7A 4K7PH 4LSQL 2ZUXA 1MOEA 5D7LA 3WN5B 3WEXA 3U1SL 2IF7A 2QQNL 1I3RA 3DARA 3VFNB 3T1FA 3WNLA 5L88L 2ERJC 1FQ9C 5JQHC 4Q74A 3AXLB 2HH0H 1OM3L 4MXQD 5EH1A 1AC0A 1HOCB 1KB9K 1T5WB 5E2UL 1P4BH 1OLZA 3L7FA 1P7HL 2Z9TA 3X3GH 4Y19D 4A2MA 3FO2A 1P1ZA 5A2FA 1EDQA 4HUVB 2CSPA 2H26B 1BLNA 3QIBB 5K59F 4S2SB 4OIBA 5JW4Q 3TJEH 1LE5B 2F5AH 3H9ZA 5DVOA 4WW1A 4YGVA 4Z7UF 3BGFB 2NXZC 3QJHA 5I1EH 1D5IH 1U36A 4YK4B 2C3VB 2Q8AH 4PLJC 5FGCB 1PY9A 1NMBL 2QR0B 1CFTB 3O6FB 4YDVB 4W6XB 2IQAA 2VZOA 1QFUL 5E1AB 3VFPB 5L9DL 4HIJB 1ZHKB 2V2XA 4FHBD 3GSVA 3JV6B 2EZ0D 2HAZA 4F33B 4CVXA 3PHOA 1NCTA 2X5PA 4WY7H 4JRYD 1MCPL 5JNYB 1B2WH 4L4TB 4FNLL 5D6CB 3MCG1 4G9FD 3O3DA 1XGYL 3BMWA 5E1HB 3AAZB 1RZJL 3F7VB 3O6MH 1R5VA 4O51B 4LHUD 4U1JA 5IK3B 3QJFB 2LV4A 1N4XL 2HVJA 4Z76B 1WTLA 2AAVA 3MO1A 3UTQA 3I02B 3GIZH 3OF6A 4NJ9L 3ULUE 2P4AB 2VABA 3FFDB 1JWUB 4RWYL 1YN7A 2OJEB 4G80B 3VFRB 1PKQB 3QDJA 5C86A 2FDBP 3G08A 2JJVA 3T04D 5DRXB 3DSFL 1CBVH 1T1WB 3LEXB 2CDEB 4DN3H 2XTLA 3WJJA 3CC5A 5D1XA 4BKLA 4NFCA 4AH2B 2EYTA 3PXHA 5DK2A 4YHOL 1U6AH 4OZIF 5FGCE 4KDWA 1ZEAH 4EKXA 1ACYH 3T3MF 3EDDA 3RTQA 5JO5B 5I75B 4OLWH 1CE6A 5IW3A 3WIIL 5B3JE 5I1DB 2CR6A 2QQLH 1A2YB 4S1QL 3RKDD 5DD5H 4F37F 2D9CA 1IGJA 2ZZUT 5AAMA 4NCDA 5ID0A 2XKSA 4ZO9A 5D72H 1WVZA 2VLME 1ZLSL 1R5IA 2DBJA 4FZEL 4L4TE 2YPVH 3HAEA 2EDDA 4LIQL 4FQXB 1MHHA 5BQ7B 1KTKE 4KRNA 3SDDC 4R7DA 2H3NB 1DVFD 3CFJA 5FA4A 3NIGF 3MRDA 4GW4B 4NZJA 4PJ7F 5GGSY 2KZ1B 1UM4H 5KZCB 1E27B 4YNYB 1H5BC 2P5EA 1YJDH 5D1ZB 2ZOKA 3I3DA 4DKFL 1PKQE 5B4MC 3RWHB 4YHZL 1CVRA 4GAJH 1WZ1L 3CUPB 2E6QA 4OZHA 2H1PH 5CZVL 3P9MA 3U0WH 1EVTC 1I9JL 4G7VH 4TNWF 1CFSB 3Q6FA 3SJVA 3SDYL 1A6WL 2ZUSA 2YUZA 1Q72L 4XCYA 5GRUL 5IJKC 1U3HB 2L4OA 1GGIL 3T3PE 1VEOA 5BS0A 1A0QL 4B50A 4QT5A 4NZTH 4NYLB 3TP4A 4FQQB 4L4VA 5IGXH 5IKCA 1AD9A 4R26H 2I5YL 4NO5B 3H3PL 5C0FB 3S5LB 4GG8A 1P5UA 5T3XD 5I2IB 5FHAH 4YR6B 5EIIB 3DBXB 2QSQA 5DK0A 4PJHB 5EZLA 5CINL 3QA3A 3HKFA 4CDGC 1XF3B 3NCBB 4DUVA 1MNUL 2DM7A 4U6TA 1MIMH 3VXME 3M17A 1WK0A 3TIEA 2RB8A 1T20B 1J0IA 2DWDA 2YRLA 5DC0A 5EUOA 3QQ3A 5HVHC 5GRYA 5DQJA 4JHAH 4OZFA 3LOWA 4DTGL 3DECA 3C60D 3X11B 3LKSB 1YNTB 3IXAB 5GZND 4UDUA 5BCAA 3Q0HA 2X1OA 5T1MB 4OIAA 4CVWA 1HILA 4Z7WF 12E8L 5J11B 4JFDD 5KSAB 1RUML 1X3DA 4XAKE 2QBWA 4POZC 3VW3L 3GBNH 5CSZB 3T2QA 1CS6A 3QCVH 2VLRD 1M7IB 2AJZB 4R97B 4JO2L 1J1OH 3H42H 1MCQA 4NRXB 3MXWL 3OXSA 5F7DA 3B9VA 4I18A 5EOTB 5C0ND 1BD2A 3PUCA 3QB7C 1WEJH 4F58L 1FFNB 4HXAH 1MJJA 5D70H 1RY7B 4KJQC 1KNOB 3MODH 2Y6SD 1KXTB 5BOZG 1NLDL 1ZHBB 2RR3A 4LQFH 2X4PA 3FQRA 3EO1B 1XIWA 1UENA 5J89A 1Y6KR 4PJHE 1VKXB 3M45A 3LN4A 4ODTL 1JNLH 1RMFL 2C26A 4HIHA 2H9GA 2R2HA 1VB9A 5F21B 4JFZL 3N1MC 1WFUA 1SYVB 4R4FL 2V2TB 4UIKH 3JWOL 2GJ6A 3HR6A 3O9WC 1MHCA 2VXTL 2ATKA 4LP5A 5CP3A 4HS6B 1CWVA 4R96A 4HWBH 5FYKE 5IHLB 2ED9A 4HH9A 1RJLB 3KNBB 2VXUL 3MCKA 1MWAH 4PJ5B 5J9PA 5JORA 1I1AC 4L3EB 2Q87A 1LP9B 4A6YL 5CGYC 4Z5RB 1ZK9A 3KDMA 1FP5A 3GMQB 2W07A 4P5TA 4Q2ZA 5AZ2H 5DMIL 4YO0A 3OAYK 4NFBA 3I6LE 3KJ6L 2BSED 3F12B 3GHBH 1BEYL 4UOJA 1ZSDA 3FCTB 4CMHC 5CEXA 4TNVK 4OGAC 1MRCL 2F8OA 3PP3K 3SDXF 3HFMH 2DBLL 1AFVH 4X0KB 3RY6C 5AWNH 4HXBH 3IVKA 2JKXA 2QHLA 4Y4KC 5IB4B 4XNXH 2R4SH 4PTTA 5B38A 4HUXB 3V5KA 5I16B 4U3CA 2OK0L 3O3AB 4NRYA 3RZCA 3HG1D 3H9SD 1U93A 5E2VH 2MWCA 1NAMH 3WFHA 3VCLB 4XRCA 4HMDA 5BVPH 1FNAA 2GW5A 4MGXA 4UIMA 4F7CB 1P7KA 4QNPF 3Q3GA 4FQHB 5IVZA 1BGXH 4D0DA 2FIRT 2UWEB 4Z0XB 3HI6H 3CFKB 3T1WA 1DE4B 2OJZL 1A3RH 3VXNB 4HZAA 2VO5A 3VA2C 3CXHJ 4Y1AE 3O41A 4FQJL 1HNFA 4PJ5E 4JR9L 1E4XI 1XFPA 3NH7L 1RIVL 3LKNB 4L3EE 1LP9E 5I6XC 1V3KA 5I1GL 1GGCL 1N3NB 3QDGE 4JFEE 1A1OA 3RVXC 1ADQL 3VXTB 4M6OH 3HI1A 4PRDA 3IDXL 1MF2L 4EI6A 4LCWE 4ZUWB 3D3VA 4XPAH 4OI8A 4R6UA 1OAQL 3ARED 1XH3B 5T1KD 4NHCH 5C0EB 3G5ZA 4ODWA 5DJ6A 3V0WH 4TQEL 2XA8H 4NSKA 1A1MA 4JN1H 1WIOA 4GMTL 4KHTH 3FT3B 3INUL 1U8HA 3RX8A 5IJVA 2IH3A 1IGIH 2FHCA 4WDIA 1GH7A 2VUOA 5MP6H 1IKNC 3ARYA 3F62A 4OGXH 4OQTA 4F8QA 1SEQH 2Q86B 4TVPH 4WFHD 4RQQA 4QRRD 3O9WD 5A2KH 1KN4L 4MHHI 3ULVC 1W0WA 1HE7A 4MDJA 4OD1L 3LRGA 1G9MC 3FB8A 4XVSH 2AJSL 3TESA 4H26B 1BFOA 3HB3D 5IBTL 2UWEE 3SPVB 1N2RB 3LQZA 4WV1A 3F6LA 3EFFB 1H15B 3WDJA 3G6JB 3TM6A 1X9QA 1H0DB 1L7TL 2AXHA 3QISA 2NMSA 4L9LB 4M8QB 1SY6H 1T21B 3DXAD 3JV4B 4X5XA 5C0IA 4K3GA 4KUZH 5I0DA 3D9AL 4IOFC 3S3JA 1IKFL 5DJ2A 1UFUA 1KGCE 1S7QA 1FBIH 5LJYH 3P4NA 5DZNA 1JGDA 2NZ9C 3OGOE 4KKNA 2WWMD 4NKOB 5H94A 3UTPD 2RHEA 1WUNT 1NFIB 4Y19B 2BY0A 5GZOC 1I9RL 4YXLH 1QBAA 3BAEL 1FL3A 3PHQB 1YN6A 3ARWA 2WNGA 4ZS7H 2IAND 4XP4L 2VDLH 1JPTL 3MV01 1PGRB 1J88A 3MBEC 3THML 1TJHL 2GSGB 2FX7H 3U9UA 3BRFA 1H8SA 4Y2DC 4WW2C 1AE6H 2AXFB 1KG0B 2G60L 3CCHA 4YWGH 2VXQL 2AERT 2E7LC 2OSLA 4HEME 4JO1H 2R56L 4PJDE 2E7BA 3GJFH 5E6YA 4KTDL 5FOBB 3JWNC 3TPKA 3MRHA 3TO2A 4YHYC 4BUGA 3B2UD 1QFWH 5IV2A 3G6JE 1UJTA 1U8KA 4KJPC 3TBSA 1KIPA 4JFFD 3T4YB 5E99H 5ESAB 1A22B 1C08B 5JW3L 2J88H 2HT3D 3CZJA 1FIGH 3GNMH 3G5YA 5CLWA 3N85L 5CJOH 3LCYA 3MRFA 3KYKH 4ORZC 1C12A 5TJWK 5J4MA 3C8HA 2HYMA 1EAPB 4AEIL 1M05B 3ISWA 2F58L 2DDQL 4Y19E 2K1MA 5GXBB 4JQVC 2VERN 4UQ3A 4PRID 1DBAL 3CMGA 1Q9OB 5DSCB 4U05A 3ZKXB 4XCFL 3IDYC 1U9KA 2QJDA 1KC5L 1NANH 3REVA 4U6XB 1T0PB 1YEKH 3JBG7 4MA1C 1U8LA 2MCPL 3OX8B 2W60A 2Q6WA 2AGJH 1Z9OA 3WJLA 4XNQB 4X6FB 3RGVC 3LQMA 1AGFB 3ESUF 3ARDC 3V95A 4XVUC 3U9PL 5GISL 5I17A 4E0RB 5IW6A 4DAGH 3HNTH 3WE6A 4Z9KB 4Y16A 4LAQL 4JFOB 7CGTA 4G6FD 4P9HH 4JRYE 4WCYH 5E9DD 4LCYB 1ZT4A 2P24A 1CZ8L 1CDGA 4G9FE 1WT5C 5DJAA 3TBWA 3DTXA 4EVNB 1FRGL 3D39A 4PJGA 3RVUC 3L3JA 1PQZA 5I66B 5GZOD 2LU3A 4P2CG 5EC2B 1ZA3A 4U0QB 5HPMB 1MHPL 5TQ2L 1BQHB 4RGOL 3QG6B 1Q1JH 1UG9A 4EN3D 4MQ7B 2ADFH 4XPHH 3MQIA 4MJIA 1S5HB 43CAA 2DF3A 2VLLB 2GAZB 1I7UA 1WAAA 1KLUB 3B9KA 5J3HC 3MZTA 2NXYB 5KVDL 2BNUB 2FYYB 4K7FA 4KI5F 3VGAC 3OAUL 1LD9B 4U1KA 3C2AH 1A5FL 4PJAF 4JPWH 3PL6C 1T0NB 3RVVD 1P4IH 5J6HB 1AD0B 4M6NH 4DVBB 1R3KB 1TQBB 4MNHA 1X5KA 1N59B 1RJZA 1AQKL 5I30H 1OTSC 4YUEL 2CUMA 3CXHK 3QUYB 3RNKA 3A0OA 3WV0A 4S11A 4JE4B 1UXWA 1UYWL 5HDOA 2VMFA 5L8KB 3H3KA 2DQCL 2H41A 5IVXF 4WI7A 3NBNA 3FO1A 3BE1L 3CFDB 3MCLH 3M8OL 4WJ5B 3KXFA 1BJ1J 2YD2A 5D7SL 3VRIB 5JUEH 1QQDB 1GL4B 4LNVA 1NBVH 1S7SB 4Z77A 3PJSB 1OGAA 3DROA 4OCMC 1P53A 5EZJB 3WFZA 5C0GA 5JQ6H 4X5LA 3E6FB 4UT7H 1FLTX 4BK5A 4D0CB 4JRXD 2N4IA 5HSFA 1U8QA 5HYQB 4K71C 1C16A 4KK6D 5F70A 4LF3A 4UINH 3RPIB 2P8LA 4CN6A 1F2QA 2XY1A 1UZ8B 3C60B 1K4DB 1V8HA 1KJMA 3TYFB 4P4KD 4JFDB 4MNGB 4BQ6A 4QF1A 1EO7A 3QUMA 4YAQA 3O2DA 4X9GA 4FQIL 1T7ZA 5HD8D 4XVUD 5T1LD 4K8RL 2P5WA 3A6BL 1R3LB 1B88A 3O4LD 4JZNA 1LWRA 5EU3B 5EDXA 4F9PA 3EJYD 1HYSD 4JCLA 3EFDH 3DRQB 3OKKA 3UTZB 2D03L 4HUWB 4DZBA 3IDIB 1GC1H 5T3XE 2YRZA 2JELH 4PPTA 4XP6H 1RJYB 3TYGL 5ENWA 1D5MA 3LSOB 2WUCL 1ZWIB 4XHJC 5AYUL 5I71B 1OCWL 1JWMA 1B0GA 1J0ZA 4R8WH 4XCCH 4ONFL 4NRZA 1UT9A 4X7DC 2CLRB 2VLJB 4EOWL 4MXWH 4OM0H 3MV8D 2PYFA 3RA7L 2Y72A 3AVEA 1AO7A 1MCCA 1QEWB 1DFBH 1X7QA 2DM3A 2EDWA 2VZUA 1S7XB 3TT1L 1FNLA 4ELMA 1PBYA 1IC7H 2MQCA 1FZKA 4JGMA 4WO4A 4Z7QE 1X5YA 1R0AL 4MD5A 2NX5A 2KH2B 5DGQA 1OTTC 1BVZA 3LQAH 2B1AH 3NCYS 2AJVH 3TZVD 4TNVF 4JFDE 2A1WH 4MMZC 5C0AA 1YMMD 1MHEA 3RWFA 2ZP0T 5C7XH 4YBQC 2VLRE 3W0WD 2JJUA 2R29H 1MRFL 3MR9B 4ETYA 1ERNA 5JZ7C 1B6DA 1UKTA 3V7AG 5E8EA 1UB5A 3B5TA 2NR6C 1JUFA 4PJ9C 3QZWG 1K2DB 4NP4L 4P2RD 1A47A 2A2QT 1K8DB 4P9HC 3IT8D 4OF3A 3WHE1 1JI2A 3BH8A 1PEWA 4CU6A 1CD1A 1JN6B 5IBLC 1ZMYA 3RDTD 5CJXC 5GGTA 3AM8C 3LKQB 3IFLL 4P3DA 3VD5A 2Y5TA 3KPOB 3MUGA 4I4WA 5AG8A 4TOYL 4B0MM 3PNWB 3MRQA 5I74C 1QBMH 1MCWM 1OP3H 4JO3H 2CO7B 3H9SB 3BRGC 3QCTL 1NGYA 5IMOA 4LPWA 1K6QH 2HRPL 1DBBL 5JXEA 3KPRA 3OKNA 1RUAH 2AV7B 2M26A 4QEGA 3UJTL 3GJEB 5ICXB 4KVCH 1SEBB 3BKMH 4GRLA 4BK4A 2Z4QB 1DUZB 5HDQH 43C9A 1UJ3C 5CD3A 4JFPA 2JCCB 2FEEL 4M1CD 1YYMH 4LPCA 4NQSB 1MVUB 2XWTA 1MAMH 2L0DA 5FA3A 1HYRC 5KOVC 3BZ4A 2APXA 4HCRA 5EBGA 3VH8A 3STLB 3AREB 4ODUA 1CU4L 1XR9A 4K3DH 3C6SB 4QRSB 3LB6C 2YR3A 3BZEA 5IHUH 1UXSB 5T33H 4E5XB 4EUPB 5EZIL 2EDEA 4HIXL 3DYMA 4GG6E 4KQ3H 4Q0XL 4PJFA 4Z78A 4IRSD 5LCVL 2C4FU 4HWZB 2NYYC 4RZCA 5EN2B 4NZUL 5KBNC 5FFLA 2PW2A 4GKSA 1GGTA 4N1HB 3TLRA 3CFBA 5D2NB 3HG1E 1FC2D 4JY4B 4OI7A 1NBYA 3H9SE 3MRNA 1QFHA 4ONHB 3TIDA 4ZNCD 4QRRB 5I15L 3DMMD 4WVRA 1MY7A 2HWZH 1H3VA 1KULA 2XQBL 1EFXA 8FABB 1FAIL 2FIKB 5E8OB 4JM2C 3NIDF 3RL1B 3TO4D 1P5VA 4FXLA 4E41A 1MLCA 5GRWA 5TE7L 3BUTA 1NC4D 3GM0A 4GS7C 3KVQA 4Q9QL 1A6VL 4PS4H 2JCCE 5HI3C 1NKOA 4Y5YA 2YD6A 5DEGB 1F4WL 3DXAB 5DMGC 4LSTH 3GGWB 1K4CA 2YWYA 4JZJC 4OLZL 4EDXB 4TPRH 3MFFB 3HAEH 1R3JB 2Q76A 4NC2B 4U1NB 2E3VA 3EHBD 4M7LL 3QIUA 4AEHL 1BOGB 1MCJA 2F5BH 5E2WH 1BBJA 1KIRA 4XXDA 5ADPL 1BIIB 4OZGE 4OFYD 1GC1C 1IARB 3FO9B 4GAGH 3MV9D 4YDLC 1D6VL 5TF1H 1G0XA 5IB1A 1U3YA 1ZT1A 1U8IA 4KZDL 5FUOL 3EYUL 4XNYL 5C9JB 2IANB 3SO5A 3D69B 3BEVB 5DTFA 4M8VA 5D2NE 5FUZH 3MYJA 5IB5B 4ZAKC 4UT6H 2BDNL 2KBGA 4RAVB 2HG5B 5CIPA 4WFHE 3DPBA 2NY0C 1E6JL 4QRRE 5J12B 1Q9WA 4FFVD 2BP3A 3EOTL 3MRGB 3RBGA 3HMWH 4JB9L 4Z7VF 5GRXG 3UJJH 1CXKA 3LQAC 4NT6A 3T8XA 1U0QA 1ZA6B 1WCBA 1JFQL 1N8ZA 1A14H 4M7KH 5ID1B 4EZMA 1VDGA 4M1GH 1G84A 3BW9A 5HHVL 3VDCA 1QSEA 1UKSA 4JFFB 4PGEB 3CLEH 2PO6A 4HJJH 2CLVA 1AI1H 1IT9H 2BVPB 3SKMA 4NFDA 2NY6D 1UWGL 3DXAE 4NO0A 5AZEL 3BRDA 1WTGT 3VXPB 4PTUA 1OT1A 1XGPB 3CNKA 5HHOD 2VC2L 2C4FT 3UTPE 3MLRL 5H35A 3BP5A 5TH2A 2G2RA 4N0CD 5GRVK 2I26N 3VGHA 3VFSA 3ARPA 1KJ2H 2NYYD 1AY1H 4AQOA 3SCMD 1KXQE 2HH0L 4OZFH 1G7HA 2CKBH 2R0ZH 3WUWA 4DGYH 3RVTD 3HRZB 3VRLE 1IC5L 1P4BL 2ICEB 4PRIB 4BM7A 1NCDH 2IANE 4NO3B 1FYTD 2Z31A 3P4MA 1VGEL 5FAAA 5C2BH 5FB8B 1RVFL 1SVZA 5EOCJ 3LH2H 1DJSA 2Q7YA 3TJEL 2F5AL 2CLZA 5SWSB 5T3ZH 1AHWB 5F1IB 1C7SA 3MGTA 1T80A 5HHXH 3HZYB 4UNTA 1D5IL 3CU1A 1HSBB 3HAEG 3SGEI 2Q8AL 3IGAB 3IJHB 3DJ9A 1XF2B 5E7FA 5HI3D 1IGTB 3MNZB 3DUSB 4MCZB 4OCRH 1D9KD 3UAJD 4N9GB 1JGEB 4JFFE 4JKWA 2R8SH 5LXGH 3LRSB 5E9DB 3QEHB 5D96C 1G1YA 1U58A 5HGHB 1N0LA 5EB9A 1MH5A 2UUDK 4LCCA 4K9EH 5E6IA 4YHIA 2W0PA 5MEPB 3OG4B 3EW3B 4UAOC 4BSJA 4LVNB 2ZSWA 4P23D 3QNYA 1UZ6F 3CK0L 4Y5XB 3O6ML 3LKPA 1R3IH 1WCQA 1Q94A 1IZJA 5L2KA 2EKJA 5DR5H 3WJJC 3GB7B 3N06B 2IBZX 5D1XC 2V7HA 2ZKHH 3P0VH 4PRIE 3GIZL 3QUXD 2NY0D 5C0CA 4NQEA 5D7JD 3RTQC 2VR9A 3AS2A 1BFVL 4YHLH 1URLA 1FDLL 1CBVL 5F1NB 4HSQA 4DN3L 5EBLB 4YC2C 3SE3A 2RAMA 4IBLT 5HYJD 4HKXB 1RZIB 3QO1B 4NDMB 5IEHA 5D7LD 4MYWB 1D5BA 2HJLB 1U6AL 1ZEAL 5E8DH 4LLMB 1UH2A 5JDJA 3WO3B 4OLWL 5CBAA 3P0YH 4G8FB 3S3SA 5DJ8A 2NZIA 4N68A 4GH7B 3G6AB 5C6TH 5DD5L 5EBMB 5E9DE 4KMTL 5B8CA 5K9JH 1TZGH 5EORL 3BFOA 5JPNB 1Y6NR 4OZFG 3TF7C 2PUQT 4M43L 1Q9KB 5SX5K 4ZUUB 5D72L 4CVUA 2IFFL 3O2WH 3DUUA 4Z7NE 2AJYH 1V7NH 4JRXB 2H6PB 5E5MA 1XR8A 1EHLL 1PX4A 5HGDB 3ZDYE 2DI9A 4ZPVA 1NAMB 4L9DA 4NUGH 3BSZH 1UM4L 3GSQA 4WI3A 1FAKT 4P4KB 4NKQB 4LVHB 2NQCA 5FYLL 1HN1A 2D7TH 3MRLB 1MUJA 4Y89A 1FV1A 5KG9A 5ICYB 1JGUL 5T1LB 2H1PL 4NN6B 3WN5A 3U0WL 3O4LB 4G7VL 4JLRB 2F54B 2JLLA 1J86A 4E42B 3VFNA 1Y6MR 4JQIH 2J5LC 3OAYH 4ZOEA 5D2LF 2LVCA 3AXLA 4E9LA 3A6CL 1HOCA 4JFHD 5CILH 1T5WA 4NZTL 4PB9H 5EZOL 3PP3H 4PYHA 1X4YA 3Q5OA 1XGUB 2WK2A 1TENA 3L3DB 3OF6D 2ZNXA 4HUVA 4OQTH 4BSVB 4PR5B 2H26A 5FHAL 3QIBA 4G6AD 4S2SA 5L0QB 5IQ7L 2MTPA 1LE5A 4JDTL 1EUTA 1OAUH 3BN9D 2W9LA 4ZYKB 2C3XA 3MV8B 4JRXE 5DURD 5D1XD 2C3VA 5CHNB 4N5EC 1MCIA 1NQBA 1MIML 1F02I 3UBXB 2N7AA 2QR0A 5JOFB 1CFTA 3GEWB 3O6FA 4YDVA 4KMQA 5DT1L 3RL2B 3AS0A 1QUNA 5E1AA 1G7MB 3VFPA 1NDMB 2J1KA 3TZVB 4HIJA 3ULVL 1ZHKA 3RQ3A 4D9QD 2HTKD 3T0DA 4HJ0C 1IRAY 1YMMB 4ZPTB 1L0XA 2X1PA 3JV6A 1G9ML 4NWTL 4FABH 2Y23A 4CADB 5C70A 3W0WB 5CLTA 4F33A 1LE9B 4WEBH 2F53D 4UI2A 4NNPH 5JNYA 5B38G 4LARH 4L4TA 3O4LE 5D6CA 2XYCA 4KKBC 2CK2A 2EE2A 4KRMB 3MRCB 3AAZA 4P2RB 1MFDH 4DGVL 3F7VA 4O51A 3CDCA 3P77B 5ACLA 1BZQK 2QHRH 5IK3A 1XIWC 2GTZB 3HLAB 3QJFA 4S1DD 3O6KL 1FLRH 1L9MA 5FKAB 4K3HA 4QXTB 4Z76A 1KCUH 3I02A 1HINL 3RDTB 2CKNA 3BXNB 3E2HB 4K9EC 5F6IB 3OPZH 3FFDA 1JWUA 2BNQD 2DJSA 4AEFA 3O3BB 2OJEA 2E5EA 2R1WB 3MODL 1MI5D 4G80A 3VFRA 3MGOB 4O58H 5E2TH 1PKQA 3QRFM 4G6JH 1RZ7L 5DRXA 1T1WA 3LEXA 1IE5A 1NJ9B 2CDEA 1MCOL 3ZHLA 3BZFB 3MV8E 4HS3B 4C59B 3ZE0F 1NL0L 4JO4L 5ACZB 4P46D 1J5OH 4AH2A 2BVOB 2GQHA 1ZLWK 3RY4A 4ERSL 3SJVD 4LLUB 2EC9U 5JO5A 5DVKA 2Z0BA 4P5TC 5I1DA 5DJXB 4HFUL 4Q6IC 1A2YA 1A6TB 5BVJB 4BFBD 1YMME 5K59E 1EUUA 4J6RH 1HK6A 1MWAL 3PHSA 3W0WE 4ACPA 1NMCB 2D0HA 1TZHB 5T5NG 3BKJL 3FT4B 5HI5D 4Z7UE 1OAYL 4M03A 3D48R 3VFUB 4FFYH 5AZ2L 2WW8A 4P2RE 4F7MB 1A7BA 4FQXA 4OZIB 1LEGB 5BQ7A 1GSMA 3OR6B 1FNSH 1L4IA 5BO1L 5I73C 2H3NA 1GYAA 3EAKA 2QSCL 4GW4A 5EBWB 1FGVH 3RZCC 4IRSB 3TBVB 2PETA 1IM9D 1E27A 4YNYA 4OSUL 3HFML 4KTEH 5AWNL 5D1ZA 3IS0X 1VACA 2Y06L 1WBXB 2K9UA 4XNXL 2R4SL 3RWHA 4PB0H 4P57B 2DLHA 4XXCA 3CUPA 3DMMB 1BQSA 2Y1VA 1ZLUH 1TLKA 1BBDL 1CFSA 3TO4B 4NM8H 1UH4A 2ITDB 4JZOB 3WCYA 4PJ7B 5BVPL 3FB6B 1U3HA 2WINB 4HJ0D 3VGEA 2ITCB 3NABH 4FFWD 4NYLA 3HI6L 4FQQA 3G9VA 3O6LH 1A3RL 4ZNEE 4NO5A 4O9HH 5C0FA 3P11H 2DICA 4QXUH 3S5LA 5I2IA 4IHOB 4YR6A 5EIIA 4K7PY 3DBXA 1I75A 1X6NA 4KI5D 4PJHA 3TV3H 2X9XA 3MLXL 2W91A 4EXPX 4TUOB 3CH1B 2D0FA 3UP1A 1AXIB 5IIEB 1XF3A 3MV9B 3QQ9D 4OZIE 4I3SH 4F7EB 4XPAL 4WGWB 4C4KT 3T3ME 1OP9A 3R0MA 1T20A 1R6VA 2A0LD 4NHCL 1E4WL 2X4UB 4AT6B 4K94C 3DO7B 1UGNA 2GJ6D 2XKUA 1YEHL 4XTRC 4JJ5B 5CUSH 3X11A 3LKSA 1YNTA 4H5SB 3IXAA 1KTRL 2I07B 5T1MA 1VGKB 2JJTA 1CGSH 2EC9T 2VWEE 4RGNC 5KSAA 3OG6B 1KB5B 4WV1C 1GGBH 4ZUVB 4BELD 2V5YA 4TVPL 5CSZA 4BH8B 1NH6A 4YXHL 3UYOD 4LSRL 1QFPA 1M7IA 2AJZA 4YHMH 3TBYB 1GOFA 1VPOH 3NIGE 4NRXA 4PJ7E 3KR3L 3MBXL 1MJ8L 35C8H 1JHLH 5EOTA 4W81A 2XG4A 3W82A 1FFNA 3BPLC 2I25N 2NY6B 1KNOA 3DLQR 1ZHBA 4J23A 4Z7WB 3EO1A 1MY5A 5HHOB 1SY6L 2YPKB 1VKXA 4BQ8A 5F9DC 3LD8C 3EJZC 3QZWB 3KLAB 4P5MB 4F8TA 3T65B 3DX8B 3MV9E 4XC1H 2R0LL 3LS5L 1FBIL 1H3GA 4MD4B 2YKLL 4HPYL 3UTTD 1JRHH 3UX9B 4HULB 5L7XH 4WFFD 3SCMB 3O3EB 3HR5B 5FM5O 1O5DT 1SYVA 2IPTH 5ETUB 5DVMA 2V2TA 3WIHH 2ID5A 4HUMB 3LDBB 5LWYL 3SQOH 1A21A 2XTJD 4HS6A 3SKUD 1DQQB 1FYTB 1YEIH 3WYRA 4N0YH 5JPMB 4YXLL 2Y07H 3EJJX 2IAMD 3BIAX 3UC0H 3PF2A 1RJLA 3QUMH 3O2DH 3KNBA 5EFIB 1CT8B 3TCLB 1JTOA 4J1UB 4GFTB 4RAHA 4PJ5A 1EO5A 3DX7B 5DRNB 4OD3L 2W92A 2CPCA 4OCNC 3F8UB 2WBJD 3V52L 5IOPB 4L3EA 3DYOA 1LP9A 5J57B 4Z5RA 3L5HA 3DUHA 3GMQA 1GVIA 1G7LB 1DP0A 1H9VA 2E9JA 4YWGL 1T1YB 3IDGB 3F12A 3GFUA 3FCTA 1D9KB 4JKKA 4NN7B 3Q6GL 4QTIH 3F5WB 4L5FH 1K3IA 3GSWB 2NNAB 4X0KA 1QFWL 1CDHA 4LDEB 2E9BA 5IB4A 1Z9MA 4WI8A 3P9LB 3QXUA 4NGHL 4Z7WE 5DXWA 5E99L 1D7FA 4Z0BH 4J4PA 4KRPD 4HUXA 5I16A 5HHOE 1GGYA 3O3AA 3V7AE 4M7ZB 1FE8H 2D4DA 1SJVA 3GNML 4P23B 5HYEA 1BOYA 1F58H 3EOBB 5CJOL 2O61B 1TJIL 4MNQB 3VCLA 4R3SB 5IESH 1D5XB 5ERWB 4HAGA 1U8OB 3PABB 2R69H 4KZEH 2LTQC 3D18B 4F7CA 3SDXB 4FQHA 3QUXB 1WJ3A 2XT1B 2UWEA 4Z0XA 1FYTE 3CFKA 4IMKA 5SX4I 1DE4A 3VXNA 2RCSH 3TJHC 1S5IL 5D7JB 1IQDB 1YECH 3AC0A 4YE4H 4I5BB 5MEND 3QEGH 4OJFH 4PJBF 4UZGA 3MRIB 2XY2A 4PFEA 3OKEB 4XB8A 2Z91B 5DEZA 1CICD 3LKNA 4AIOA 5HYJB 5SV3A 1ZGLP 1N3NA 1YEKL 4Y16C 3VXTA 2AGJL 3S88L 1OAXH 4ZUWA 1J0HA 4KKCD 2FX9H 4JKPH 1XH3A 5BRZD 5C0EA 2GK0B 3ZHDA 1NCBH 5ITBH 5GGTH 4DAGL 4HEPG 2YK1H 2JTDA 5F3HB 1OSPH 3FT3A 5BV7H 3VJ6B 3ARXA 4S1SH 4P9HL 1QACA 4WCYL 2BZDA 3VDBA 2X40A 2YD1A 2NPLX 2Q86A 4FQ1L 5I9QB 1G1CA 3VFMB 3B9KC 1A8JH 3FB7B 1CK0H 5F6HI 1ED3B 3H0TB 4X98B 5E56A 4LGRB 2GI7A 3UPRB 3SDXE 4H26A 3OTTA 1N7MH 2LAGB 4MA3B 1KIQB 3PG2A 3MJ9L 5FGBA 3SPVA 1N2RA 1JP5A 2R0KL 3DETD 3EFFA 2GK2A 2ADFL 4XPHL 1H15A 4JFQB 3G6JA 3V0AC 4HCRH 4L9LA 4IS6B 1G7IB 4M8QA 1T21A 3JV4A 5HYJE 4X80H 1P84J 2BSRB 3C2AL 3TFKC 4JPWL 2FATL 5D7LE 1WITA 3VWKD 1PSKL 5GS1B 9CGTA 3R0NA 3LZFH 4M6NL 4G6ML 3T0BA 1CQYA 5I30L 4NKOA 4QNPE 3WNOA 1FZOB 1T2XA 5JIHA 3VD4A 3C5ZD 5CGTA 1ZE3C 1NFIA 4Y19A 1A9EB 2R39A 1TNMA 3P4OB 4GRMB 3BIKB 4PRAB 3MJGX 3PHQA 4N8VB 4X6CF 5JUEL 1OQXA 3VG9C 3ARBB 3K2UH 2IALB 1YEEH 1ZLVK 2GSGA 4RRPG 5DURB 3FRUB 5JQ6L 2AXFA 1KG0A 4UTAH 3TT3L 2LE9A 4UT7L 1IFHH 4LMQE 1RZ8B 1IQWL 4YDKL 4J3SA 4FQLH 1F4HA 3OL2A 5FOBA 4XMLH 2LFGA 1YEGL 4UINL 3S35X 5FYJH 1NAKH 3L3IB 4JM4H 2X05A 1CLOH 1EMTH 2KPNA 2CH8A 4F9PC 2A6JB 3T4YA 1IAMA 2F53B 1CFNB 3LKOB 1W72B 1C08A 2BJMH 3QHZH 5ESAA 2IBZY 3CSGA 3U4BH 1MJUH 1WISA 3BDXA 5DQDL 4XI5D 3IJYB 4XP1H 1IGMH 2NY3D 4PJEB 3TA3D 3WXVL 4GQPH 3DVIA 3OJVC 2A77H 3D39D 1MLBB 4G5ZH 4JKLA 2X4RB 4JFHE 1EAPA 1AIFB 1M05A 5IR1B 1NCCH 2YN5A 2CMRH 3EO0B 3B5HA 2BNQB 1ZHNB 1MI5B 2ORBH 2Z8RA 3HA0A 4AYFA 1GC1L 2AABL 3MRBB 4WWID 1VEMA 3VA6A 3S36H 1OWRM 5CIPH 1EHNA 1QBLH 1Q9OA 3PQYD 3LEVH 5DSCA 4S0TD 4WO4C 4F57H 4J3TA 1T3FB 3HI5H 4U6XA 4P46B 4R8WL 4XNUH 3OX8A 3U36B 3LMJH 3NGBC 4XNQA 4X6FA 3L7EB 4PJ8D 1AGFA 5EWIH 3VH8G 4OM0L 2Q20A 2F74B 2YHGA 1NGWB 6CGTA 4OV5B 3LV3B 1IC7L 4E0RA 4D9QE 1JHKL 4RCAA 3KS0H 1NDGB 4KPHL 2W9DH 4JFOA 4LOUD 4Z95L 5TPWH 3LQAL 2DLEA 2B1AL 2AJVL 2F53E 5J06A 1O7SA 1OD7A 4LCYA 1CLZH 2Z8SA 1IC4H 4M5ZH 1NC2D 2DIJA 5KANG 1XCTB 1CR9H 3LIZH 3QA3B 2R29L 4EVNA 4QWWC 1OY3B 1DBKH 4JY6B 4IEFB 5I66A 1ZGLM 1OAKH 5EC2A 5HPMA 1IM9B 5MHSD 3PWNB 3E3QC 1BQHA 4MB4A 5ISZD 3QG6A 2BNQE 2PF6A 3ILPB 1KJ2B 4FQPA 4PP1D 1JZ3A 4MQ7A 1MI5E 5JXEC 2L7JA 1S5HA 2CKBB 2VLLA 2GAZA 3BIBX 1CE1H 3V7MA 4UNUA 1KLUA 3SE8H 5IQ9B 1YA5A 4HKJB 2XWJB 4GRLC 1HZHH 2BNUA 2FYYA 1W8OA 4KUCF 1LD9A 3BQUD 1T0NA 1IL1B 3UPCA 5C1MB 5J6HA 1J8KA 4FTVB 3SJVE 1K6QL 1I7RB 5IFJB 1AD0A 2CGRH 4DVBA 1R3KA 1N59A 1NGQH 2R2EB 3H9YA 1RUAL 2QADD 1JF5A 3QUYA 2BY3A 1F4XL 1HCFX 4ZFGL 5T5FH 4OKVB 2GCYB 3MUHL 5HDQL 2DD8H 5I1CH 3CFDA 2ZPKL 1EGJL 3JTSB 1IEAB 1WICA 3E0GA 5DJDB 5GQBA 4WJ5A 3GKWH 3VRIA 1QQDA 3A67H 4GAYB 1YYML 3U7YH 5T1DH 3MLSL 2R4RL 2EKSB 1S7SA 3KAAA 1MAML 2VJXA 3PJSA 4PJAB 3T0WA 5JA8B 5EZJA 5KJRH 3QDMD 2I60H 2HKFH 3E6FA 5LBSH 4D0CA 4K3DL 1HIMH 25C8L 1YDPB 2A6KB 4M00A 3NCJH 5HYQA 3U82B 5IHZB 5T33L 2DQDH 5IVXB 2MKWA 3S37L 1MHCB 3RPIA 4KQ3L 1EPFA 3WHE0 1UZ8A 3C60A 4WO4D 1NCAL 5FM8A 3WFCH 5I18H 4BFEA 5LAXB 2NX5D 1K4DA 1PG7W 2ZUWA 3MA9H 3TYFA 3G9AB 4OLUL 4JFDA 4MNGA 3CIQA 3SKOB 5K9QG 5B39B 5C0AD 4NN5C 1FNEB 3ALPA 1A7OH 2HWZL 4Y5YC 2DI8A 1R3LA 3SE4A 4ZSOB 3SGDH 2AXJA 5EU3A 3BDBA 3QIUC 3RFZC 3DRQA 3UTZA 4HUWA 1BREA 3IDIA 3NCCB 1IBGH 1P84K 2B0SL 3HC4L 5HI4C 4OFDA 3WUWG 4PS4L 4LCIL 3C08L 1X5IA 2O5XL 1KCLA 4LK4A 3JTTB 1RJYA 4KI5E 7FABH 2GKIA 1F4YH 3LSOA 4PJAE 4TPRL 1ZWIA 4XZUB 4M6AA 2HKHL 5DJYB 3P30H 1Q0YH 4HFWB 3UTTB 4DN4H 2CLRA 2VLJA 1RSFA 3ZKMD 3GBML 3GK8L 4LVEA 1KPRB 3GRWA 2EDXA 1FL6B 1QEWA 5CSGA 3C87A 2XTJB 1S7XA 3VXRB 2GJ6E 3PWUB 2HN7B 5TF1L 2D31B 2X42A 5IVXE 2IAMB 1H3UA 4OTXL 2KQNA 1HHHB 2X4QB 5F6HJ 4TRPL 4MAUH 2WBJB 5FUZL 4UDTB 5BMFL 4UT6L 1A3QA 5KN5B 1I85A 2PO6C 3HZKB 3MR9A 1YY9C 3OKOB 1S7RB 2C3WA 3HMWL 3IAQA 1K2DA 2JB6B 2VZ1A 3CMOH 4ZSOE 2OYPA 3FZUD 5DI8B 5EO0B 1CL7I 1K8DA 3CD4A 5CBEB 2PNDA 4M7KL 4K3EL 1GJIA 4M48L 4M1GL 3W9EB 4POYA 4K23H 1JN6A 1MFNA 5I1KH 5D6DA 4ZO7A 1BM3L 4OD2B 5JR1H 1XF1A 4HJJL 2WANA 4GLRI 3LKQA 2BSSB 4KRPB 2D7OA 3KPOA 4KHXH 3FQUB 3C5SB 5D8JL 2ZNWA 3NFNB 3PNWA 5SX5H 1B4JL 1C7TA 1F3DH 3MRJB 3H9SA 1U91B 1TCRB 3UTTE 2Z31C 4WFFE 3S34L 2AV7A 2PTUA 5F1SA 3PGCB 3GJEA 2XTJE 2J6EH 5ICXA 1SEBA 5FK9B 4OCWH 1EA9C 1A6UL 2EDBA 2Z4QA 3BH9B 2FECI 3ZLQC 4LRIA 1DUZA 3NA4A 1ZGLB 5MENB 2V5TA 2VZSA 2JCCA 4N0UB 3PDDA 4LVOC 5J7CC 3GO1H 4QYOB 2XA3A 1CICB 3S8WA 4NQSA 5B3NA 1MVUA 2Q8BL 3MACH 5FYJD 5F7NC 3EUUA 4UTBH 2YRPA 5DD3H 4X5XB 1FH5H 1MFBL 5T3ZL 3I6KB 3STLA 3AREA 5HHXL 5TFSH 5BRZB 3C6SA 3GM8A 1KBGL 4QRSA 2XICA 3P73B 3TNMB 1UXSA 2XZAH 4LCCC 4U1SB 4E5XA 4PLOB 2XZCL 4EUPA 5E6IC 4JREC 4YPGB 4OCRL 1QKZL 2XV6B 2R8SL 3CDGB 2VXSL 4HWZA 5EN2A 2D7NA 4KRLB 5ICZB 5D2NA 4QGTA 3ZSTA 1VFOA 4JY4A 3V2AR 2NY4D 4O2FB 4O4YH 4K9EL 4ONHA 4BA8A 4QRRA 3HE7D 3IFOB 4DVRH 1EEZB 4MQXD 8FABA 2FIKA 4JHWL 3NN8B 5E8OA 1OTUD 1Q0XH 3RL1A 3MFGB 1DLFH 1OL0A 4FQCL 3WDIA 1VFBB 3SE3C 3S97C 2HFGL 1MFCL 1G0YR 5MENE 2ZKHL 32C2B 2R9HC 5F88B 4N0UE 4AL8H 5DEGA 1XF5B 2GTWB 3DXAA 2WQ8A 4OM1H 3GGWA 1TJGH 4EDXA 3ROOB 1P69B 3MFFA 2BHZA 3G5VB 4PJIF 1R3JA 3EOAB 4U1NA 4U49A 1BOGA 3D85B 3VWKB 2AXGB 2EXYC 5I19H 1BIIA 4P3WA 5B8CC 4H1LH 1CG9B 2EDTA 5BRZE 3FO9A 5BXFB 4P2QD 3C5ZB 4KQ4L 5E8DL 3C6LD 2IGFL 5F93C 3KPNA 4YDJB 2GFBB 2GT9B 2VDMH 3P0YL 1UCBH 2JJWA 4KGJA 4U1GC 5C9JA 2CD0A 4XMKL 2IANA 3EO9H 1CGYA 4G8EB 4MQTB 3D69A 1ITCA 5K9JL 1TZGL 3BEVA 2EDYA 4HC1H 5IB5A 1RIUH 3GSNH 5F44A 3CVIL 4RAVA 2HG5A 4RDQG 1KOAA 2VNCA 5DEFB 3QXDB 4NQUA 1LILA 3VXOB 2A6DB 3BP4B 3MRGA 5F3BB 1QYGH 2ATPB 5J13B 5E8PB 4FMKA 5CZXC 1J8HB 4FRWA 1KENH 1KTDB 1KEMH 5B21A 1ZA6A 1ZLWH 1YY8B 5EOQH 2W0LA 1HWGB 3WN5C 5ID1A 3K46A 1G7PB 2QQKH 4QHKJ 1KJ3L 4XC3H 4JFFA 5EOCH 2E6PA 4PGEA 1DANU 1S7VB 2BVPA 2RIKA 1CI5A 2DL9A 5JOEA 3UO1H 4OUUB 1AGCB 5EULV 3VXPA 3V79C 2NY3B 3TA3B 1XGPA 2WLYA 2W65B 4XVTH 3ULUC 1AXTL 3L3HB 4AJ0A 4GSDH 3NIDE 4Z7VB 2W59A 1RJCA 1Q8MA 4URTB 1HXMB 1ZS8B 2IMMA 2IH1B 2VOTA 5FYKH 4XBEH 5I1AB 2AQ3A 3HRZA 4CU7A 4LKCB 5CILL 3VFGL 3BGFC 3KPSD 2ICEA 4PRIA 3WFEH 3DV4B 4YK4C 3FJTA 4NO3A 5E08L 1I7TB 3EIFA 3PQYB 4RMQA 4BFGA 1QBBA 2MKLC 5FB8A 3O6FC 4OQTL 2BMKB 3QEQD 4K94L 4N1EA 1OAUL 5SWSA 1AHWA 1INEL 4PG9B 1XGTB 1JNNH 4PJ8B 5F1IA 3HUJF 4AQ1B 3UMTA 1GOHA 3HC3H 3HZYA 1HSBA 1AGEB 3AROA 5GGVL 3IGAA 1FVEB 3IJHA 4ZMAT 4DGIL 3VMPA 1MCLA 4X9BA 3U0PB 1XF2A 3F7RA 3DGCR 1IGTA 3MNZA 3DUSA 4H1LG 4MCZA 2WBWB 3ZT6A 4N9GA 1JGEA 3BP6B 1MCDA 4YPJA 3LRSA 3A6OA 4LSPH 5E9DA 1ACZA 3WHXB 3QEHA 4LU5H 5C0JB 1NC2B 1DBJL 5HGHA 4ODVL 4RIRB 4M61B 4WEBL 1N64H 4MA1B 3QDAA 4NNPL 4B7IA 4S1RH 4TSAH 5MEPA 2FJFB 3WKNA 3D39E 4Z7VE 3EYQC 4QHUB 4Y5XA 1MFDL 2EE3A 2QHRL 2YBRB 4GJTB 3L5XH 3R1GL 5ISZB 1DCLA 2J12B 4X7SL 4R0LC 2GEEA 3GB7A 3IETB 1KCUL 2OZ4H 3QPQC 1S9XB 2PTTB 4U6HB 4DCQB 3CDFA 3PQYE 2SEBB 3ARSA 4HWBA 1KCVH 4KK9D 4F15B 3MUY1 5I75C 5GS0H 5E2TL 3U2SB 2AK1L 3BQUB 1JNHB 4G6JL 4ODXB 3S5LG 5CZXD 3QHFL 5F1NA 2BK8A 5EBLA 4KGLA 4HKXA 1RZIA 3QO1A 4NDMA 3DI3B 1DANT 2E8YA 1RUQL 3C9NB 3KPQB 1J5OL 1OB1B 2QADB 1U3JA 1CDCA 2HJLA 4JVWA 1NGZB 4LLMA 4XPTL 4WUKH 2R0WL 3L5IA 5AAWA 4G8FA 1X5JA 3G6AA 4FQXC 5GGUB 4YXKH 3P9WB 2DN7A 5EBMA 3HRPA 1JBJA 3SHSA 5JPNA 5DUMH 1LDSA 3B5GA 1Q9KA 3ELAT 2K3TA 4WI6A 4ZUUA 4EI5D 3QDMB 3QIBD 3L3GB 4CN4A 1XMWA 2RJMA 1RV6X 5D1ZC 1JGLL 2OXGA 4JRXA 2H6PA 1I9IL 3C2SA 5D93B 5MHSE 5HGDA 3W11D 4OKDA 3DIFB 4XXCC 1NAMA 2MMXA 5ISZE 2R15A 1G9EA 4OCSH 1NUDA 3OKDB 5DJZB 3MXVL 5D9SB 4KTEL 4P4KA 4GW5B 1SJXA 3UYPA 3WFBH 3MRLA 1I8LC 2HRLA 4BZ1L 4PGBB 5ICYA 5T1LA 4JPKH 5DD0H 5DF0A 2GY7B 4MDIB 3O4LA 1UZ6E 2XOTA 4WFGD 4WNQB 4BYHA 4JLRA 4QHMB 2F54A 5DO2D 2PN5A 4E42A 4NM8L 5F9OH 1X5XA 4ZO8A 1CF8H 4DQOL 4JDVB 2VSCA 5DFVD 1YNLH 3MYZA 1YEFH 3O6LL 1KEGH 4ODSH 4JGUA 4O9HL 3P11L 1XGUA 3L3DA 3TWCH 2XZZA 1FO0H 1MCBA 4ZFZB 4BSVA 4PR5A 3LPWA 3EYQD 3C5JB 5BV7B 3QDME 1EIBA 3H7LA 2A6IB 5MEQB 4ZYKA 3KPMB 3MV8A 3MLUL 3CFEB 2Y4SA 3MLWL 5CHNA 2FB4L 5D2LB 5I1IH 1F8TL 3QPQD 3MTRA 2NTSP 1WSST 3UBXA 3CVHB 3OXRB 1VADB 3QUZD 5FHBL 4BSWB 5JOFA 5KSAC 1J1XH 3RL2A 1MSPA 1G7MA 1LO2L 1SYSB 2NX5E 3ARZA 1NDMA 4R97C 3TZVA 3JSSA 2FRGP 1WV7T 4HT1L 5CUSL 1YMMA 4YQXH 4ZPTA 5IHBA 5C0AE 4LEOB 4CADA 3W0WA 1LE9A 1CGSL 1QSZA 2C4XA 5DD1H 3BMVA 3SGJA 5EO9B 3MRCA 4OGZA 4P2RA 2W9EH 2DQTH 1QHPA 3P77A 1WBZB 2VDRH 2VR5A 1VPOL 4F37K 2GTZA 3HLAA 4NM4H 4FQXD 5FKAA 3D0LB 2ILLA 4QXTA 4OLXH 2FD6L 4OCLC 3RDTA 3BXNA 1DBMH 2ZOLB 2YS4A 2ZCKL 3HC0B 1X6LA 3O3BA 2R1WA 1IEBB 1UWEL 3MGOA 1QLRB 5CEZH 1DEEB 4GRWF 4ONGH 1T2QL 5ANMB 3F7YB 3EYSH 1NJ9A 3MNVB 1DEDA 3MGAA 4WI9A 2CR3A 1X44A 1QA9B 3BZFA 4HS3A 1FPTL 5ACZA 4WWKD 5EUKB 5LG1A 4XC1L 5FCUL 1NGPL 2BVOA 4I0CC 5KVMC 1HEZB 3O8XD 5D2LE 1L0YA 1AKJD 4JGJA 2P8PB 4YFEA 4LLUA 1RU9L 4WRLA 4DZ8B 4I48B 4BUHA 3V4VL 1MFAH 1V5JA 5DJXA 1U3HD 3DHJA 1YEIL 1Z2KA 2HT4C 2CDGB 1A6TA 2UZYB 2VUYA 5BVJA 4ZNEA 4OT1H 2Y07L 3UC0L 1LO0L 3QUML 3O2DL 2VAJA 5ALBH 2APWA 3QNXB 1TZHA 3MOAH 3VXUD 3FT4A 2X89D 4KKLC 4X6BB 3VFUA 3BDYH 4X7CC 4F7MA 1FGNH 4OZIA 3S36X 1LEGA 3OR6A 2FSEB 1NEUA 1C5CH 5GSRB 4J4PC 2VSDA 5EBWA 2OQJB 4IRSA 3TBVA 1ZOXA 4QTIL 4L8SC 3BPOC 5D1QB 4D9LH 5DWUH 4NKDB 5FYKD 3QPXL 2X4NB 4F3FB 1WBXA 5H2BB 3FTGB 2NY4B 3Q48A 4P57A 5ANME 3DMMA 3HE7B 5KVGH 2YUXA 4IMKC 4AMKL 2ENYA 1ZLVH 2HT2C 3VI4F 4UNVA 3K81A 3LEYL 3TO4A 3QRGH 4YBLB 1NCWH 3LHPH 3H9HB 4HS8H 2ITDA 3ESVF 4JZOA 5IESL 4PJ7A 3D6GA 4ZD3H 3PGFH 4EEEA 3FB6A 2WINA 3U30B 5F9JB 2ITCA 5K33A 4RISH 2PR4L 5ALCL 3OB8A 4KY1H 1YECL 5FYJE 4YE4L 1J11A 3VFVB 4X6EB 3QEGL 3MLYH 4ZFOB 4IHOA 4YFLI 3LY6A 3X3FL 4KK5C 3H3BC 3CXDL 3SQBA 4KUCD 3IF1B 3ZE0E 1U8JB 3HMXA 1S7WB 4RBPK 4TUOA 3CH1A 5IIEA 3MV9A 4OLYL 4MJ2A 4H0GA 4P2QB 3BP7B 4F7EA 3TPUB 1G9NH 3W5MA 3C6LB 4JKPL 1C1EH 4QGYA 2V6HA 5F9WB 3P3YA 2X4UA 4AT6A 2H2PC 3DO7A 1NCBL 3V4PH 5DMKB 2IPUK 3D5OF 5HBBA 3E6HB 1SJEB 1T83A 2YWZA 2MPAL 4JJ5A 5F7HA 1OSPL 4JEGB 3WD5L 4H5SA 4S1SL 2I07A 1IGFH 2A9NH 1VGKA 3BJ91 3RHWK 4FP8H 5FGBC 3MROB 3I50H 4I0PC 5F89B 1KB5A 4ZUVA 4BH8A 2Z35B 1GCFA 5GS0D 4KFZC 1MRDH 3MGTB 4YHKL 3TBYA 5IVNA 4L9LC 1XGQB 5TDOB 5DHXB 5TDNB 2EIBA 4Q7DA 4W4NA 4ZODA 3JWDH 2NTFB 1ZT7B 1Q38A 1N7ML 2X9WA 4XGZB 5D5MF 4R4ND 4M1DH 2BVEA 2AEPH 1JPFB 4Z7WA 5GGQL 4HCRL 4NHUB 3EDFA 1GPOH 5HHOA 3FO0H 2YPKA 4NUJB 5IT2H 3FFCB 3DNKA 4DFIA 4P59H 4EDWH 3QZWA 3KLAA 4P5MA 4QOKD 5J8OA 1YYLH 3T65A 3DX8A 4NC1E 3RIAF 4P2QE 1T1XB 1NLBL 4MD4A 3VE0B 3VD7A 1PG7L 3SCMA 3HR5A 3O3EA 3O3UN 4G6KH 5ETUA 4F9LA 3KPSB 3SOBL 3SY0B 3FB5B 5C09D 4L3CB 4M5YH 5EO1B 3HS0B 1DQQA 1FYTA 3L95B 5JPMA 1PZ5B 5GGRB 3TCLA 1GAFH 1CT8A 5EFIA 3QEQB 2HT2D 4J1UA 4WEMB 3DX7A 5DRNA 3K2UL 1UACH 5IOPA 1A3LH 2NW3B 2VDOH 4TTDD 2EZ0C 4M7JL 3WFDH 1G7LA 2P7TB 3VFOB 1T1YA 2NY5H 2FR4B 1ORSB 2AJUH 2C1OB 3IDGA 3W81A 2H8PB 1D9KA 1FYHB 1OGTB 1AJ7H 3J7HA 3F5WA 1A6ZB 1NAKL 3GSWA 2NNAA 2WUBH 4U6VL 1ES0B 1S3KH 3KHQA 4BQ9A 3BKYL 1MJ7H 2KL6A 3P9LA 4O5LL 1YQVL 1K8IB 2N56A 1JYWA 4JG1H 1YEJH 1MJUL 3MUJA 3TVMD 4P23A 1I1FB 4KJYB 3U83A 3UYRL 1GGUA 2KQMA 3DO3A 1LVEA 3EOBA 1MEXH 1TVDA 2AQ2A 1IGML 1WZKA 2E27H 3GRWH 4KK8D 3SDCD 2O61A 5JW4M 1J0YA 1AGDB 3D87B 4MNQA 3TNNB 2DQGH 5L2JB 2A77L 3ES6B 4R3SA 1JF1B 3ZKXC 1D5XA 5ERWA 4G5ZL 1U8OA 3PABA 3KPSE 3D18A 3ARQA 1JMZA 3SDXA 5F1OB 1NCCL 4WHDA 3QUXA 4HPOL 1JZ2A 4X4ME 1AP2B 2ORBL 4W6WB 1IQDA 5D7JA 3UPAA 4I5BA 1WZMA 1P9MA 3QEQE 3BX7C 3MRIA 3OKEA 2Z91A 3LEVL 5DUPL 4OFIA 3RKDC 4TVSa 4OZ4B 4F57L 1FZMB 5HYJA 1L7IL 4OCYH 3X17A 1QSFD 3U7AA 4XNUL 1B0WA 2Z8WC 2WWKO 4RFEB 2FBJH 1QRND 3RY5A 3GMOB 4MXVF 4RNRB 5HDLA 1U2HA 4F7PB 4HUKB 2GK0A 5IFHL 4FQ2H 1YMHB 5JMRA 1MREL 3L9RB 1DSFL 1DVFC 5F3HA 4HQQL 4PJBB 3FRPA 5TPWL 3VJ6A 4EI5B 3BOVA 1CDJA 3VMNA 1G9NC 2CIKB 1WGOA 5L8JB 1CLZL 3F58H 5DC9B 4M5ZL 3OMZA 1CR9L 4LCUB 3VFMA 5CEZD 3LN9A 3FB7A 2G75B 2IQ9H 2NXYC 3UBXI 1ED3A 3H0TA 4X98A 5JDSB 1MQKL 5HYSG 4PGZA 3UPRA 1JE6A 3NPSB 4TUKH 3ET9F 1TMCB 2EE6A 4MA3A 1KIQA 2R1XB 2PYED 3OGCB 1SM3L 1TQBC 4JFQA 1Z0NA 3PP4H 1E28B 1CE1L 3QUYC 4LAJH 4WEUD 3SE8L 5TE6L 4IS6A 2FEDD 2D7PA 1G7IA 3JWDC 4FFZH 3SKJL 5GS2H 1DL7H 2BSRA 1Z5LB 2O93L 3GMNB 1L0QA 3AS1A 1RZFL 5GS1A 4EUPH 2EE9A 4CJ0A 4PLKD 4R2GD 1RFDH 2O5YH 5E7BA 1FZOA 3BVNB 4NO2B 1VSCA 2QQNH 1A9EA 5T5FL 1NBQA 4YIQB 3S4SG 1QVOB 2DD8L 5I1CL 4PJBE 3P4OA 4GRMA 3BIKA 4PRAA 4N8VA 1OM3H 4PD4J 3U7YL 2R1YB 3ARBA 4OF8A 4Z8FH 4U3HA 1BJMA 2IALA 3NIFF 1H3WM 4XCNB 5JA9A 3C60C 3EGSB 4CN1A 1AR1D 3FRUA 5GZNC 2I60L 1YUHB 2Z92B 5LBSL 4OBSA 1RZ8A 3QUZB 5HPOA 1RI8A 3BPNB 3CFCL 3KPLB 4UBDD 2MQ0A 5C0BD 1A9BB 5FOJA 3L3IA 4YH6A 3SE4C 4GRWH 1HDMB 3VWJD 5DHYB 4X6CB 4UB0L 1RUPH 3WFCL 4F2MB 5I18L 1NMBH 1QFWI 5C0NC 2A6JA 2OI9B 2F53A 1CFNA 2CK0L 2NY5C 3LKOA 1W72A 4KDTA 3DRTB 5EPMB 3LKRB 3ARFD 4WFGE 3IJYA 2Y6SC 4LLWB 4PJEA 3NCFB 4EIZC 1LO3L 2JIXA 1T04B 1Y0LB 3OZ9H 3PGDB 4NCC2 1MLBA 1BVLB 4KJWD 4H1LB 2X4RA 4GXVH 2DLFL 5I71C 1AIFA 4XBPB 1PW3A 3JUYA 5IR1A 1CGWA 5L6YL 3EO0A 1RZJH 1LK3L 2BNQA 1ZHNA 1CD9B 1MI5A 1IBGL 2IEPA 2GITB 5IFAH 3MRBA 3G5XB 3SN6N 2P43B 2QSTA 1VACB 1CCZA 7FABL 1PAMA 2FJGB 4NJ9H 1T3FA 2NXYD 3EYVB 4RWYH 4WWKB 1NANI 2VTFA 3GSNB 2G5BB 4P46A 3WNPA 4J3OC 4IIQB 5F96H 1Q0YL 3U36A 3O8XB 2XKNB 4WUUD 1M6OB 1AKJB 3ALXA 3OV6A 3L7EA 3EDKA 2BFVL 5DJCB 2ED7A 2F74A 1I85C 2AV1B 4J3XA 1NGWA 4OV5A 3LV3A 1R3HB 4YHNB 2ZUYA 3QUYD 4JVPA 4YHOH 1NDGA 2XIDA 2ZCHL 4WU5B 4EUPG 4X6CE 4KC3B 2VXVH 1ND0B 3VGBA 3WIIH 3RZWA 2OL3B 3VXUB 3RWEB 5JLZB 1RZKH 1T03L 1XCTA 2A74B 5D6DC 2VN4A 1VFMA 3GSOB 1A7NH 3AGVA 4Y4HD 3U6RB 4JY6A 1X5GA 1ZLSH 5I1JL 5KS9A 2OTWB 1IM9A 3X14B 3WKML 3AUVA 4DK6A 3PWNA 4Q6IB 3ULUL 1U95B 1I4FB 3ILPA 1KJ2A 3W9DB 5E4EB 3GSUB 2CKBA 2XPGB 3N1QC 1SQ2N 5IQ9A 4ZXBD 4KHXL 5TE4H 4HKJA 2EYSB 3VXQB 2XWJA 2V5SA 3MV11 4CVZB 3GSRB 3BD4A 4LRIC 2V7NB 4PY7A 2AJXL 3KLDA 2M1KA 3EDJA 4DKFH 2CIIB 1IL1A 4FTVA 1IAIM 1I7RA 4YHZH 5IFJA 1WZ1H 2R2EA 3RP1A 5CZVH 2EIZB 1I9JH 1DR9A 3MRKB 4OCWL 4F7TB 4HV8B 1TETH 3ZT7A 1KN2H 1A6WH 3EDEA 3SDYH 4JFYB 4P9ML 3AREC 4OKVA 2GCYA 2DTMH 5GRUH 1CFVH 3JTSA 3OWEA 3MX0A 1IEAA 5DJDA 5JXAL 1MCKA 4DEPB 2BVTA 1JVKA 1BHGA 1GGIH 4GAYA 3GO1L 1A0QH 2EKSA 2BOBB 3VXUE 1N0XH 4KU1A 1P6FA 2DB8A 4PJAA 3H3PH 4W4OC 1CFQB 4HMCA 4MVBD 3EYFB 3MJ6A 3CJJA 1A6AB 4K2UH 1YDPA 1MCSA 2A6KA 2DQEL 3JV5A 4XCEB 5D2NC 3RHWF 1G6VK 1T22B 2VLJD 5D7KD 4BFIB 4LSDA 2X70B 5IHZA 2CXKA 2XZAL 5IVXA 1KFAH 5GRJL 3KYOB 1ZHLB 4NKMB 4V2BA 5I1LB 3MOQA 5LAXA 2DWEB 3HB3C 2ZSVB 2EH8L 3SKOA 1QOKA 5B39A 2X44D 1DQJB 1FNEA 3OAZK 5DRZB 3P40A 4Y5VB 3JZ7A 12E8H 4IJ3B 5DHVB 4ZSOA 1Q0XL 2ED8A 1RUMH 1DLFL 4HDIB 2UVFA 4JO2H 3FL7A 5M7QA 2WWMC 3MXWH 4X9IA 3T0ED 3RWGB 3JTTA 5GSVB 4F58H 1YNKH 5KSBF 1TJGL 4RGNB 4EQ2A 4X4XB 4QOKB 4XZUA 2AEQL 2VDQL 5DJYA 4HFWA 3UTTA 4HG4J 1F6LL 4QRPB 3T4AB 3I84A 1KPRA 4ODTH 1YJDC 1G6RB 1FL6A 4UV4H 2APFA 5C09B 3VXRA 4NBXB 3PWUA 1S9YB 2HN7A 4PD4K 4M93C 2D31A 4JFZH 2FH6A 5J12C 1SBSH 2EEBA 2I24N 4P5KB 1UCBL 2IAMA 4OIIL 1QP1A 2HFEB 1N5AB 1F00I 1HHHA 2X4QA 3JWOH 5LQBL 5FO7B 2VXTH 2NY7H 5M94B 2WBJA 4UDTA 3S98A 4ZS6D 1JTTA 3B2UC 3VMOA 2DQUH 5KN5A 3LD8B 2DRUA 4DKAA 1T66C 4MS8C 2DQHL 3HZKA 3OKOA 1S7RA 2HT3C 4BJLA 5GS2D 2JB6A 3RWIB 3PDOB 2HJFB 5DI8A 5EO0A 4A6YH 1W0VB 1X4XA 5EOQL 5CBEA 2IG2L 3PXJA 5DFWH 5FDYA 4HJGB 4IRJD 1LK2B 4LASH 1FZJB 3W9EA 1RZKC 2E7CA 3KJ6H 3NTCH 4OD2A 4NPYB 1KYOJ 2FO4B 2BSSA 1MRCH 4NJAH 3FQUA 4OF7A 3C5SA 3TVMB 3UO1L 2DBLH 3NFNA 4QOKE 1FO0B 5I8KL 2ICES 3SDCB 4PRBB 3MRJA 3ZL4H 1U91A 1TCRA 1Z3GL 1FVDB 4GSDL 4LMQI 4L8CB 4YLQT 2OK0H 1I3GH 2O5ZH 3STBA 3PGCA 5C09E 4HKBB 5FK9A 4HD9A 1AXSB 2Q1EA 4YZFF 3S96B 5FYKL 1AHWC 3BH9A 4MD0B 2ZJSL 3TN0B 1ZGLA 5MENA 5J6GB 1LDPH 3PWJB 4N0UA 1S78D 4WI5A 1KJVB 4QYOA 1CICA 4G3YL 3FHQA 4RA0C 2OJZH 1QSFB 3UTOA 3G6DL 3V0VB 2P8MB 3NACH 4I1NB 1QRNB 3I6KA 3BD5A 1T6VN 5BRZA 1RIVH 2VZ3A 5I8OH 5I1GH 3P73A 4UT9L 3TNMA 5IW1B 4U1SA 1DLHB 4LPYA 4YPGA 3IDXH 1MF2H 1N26A 2JJSA 3VDAA 3JXAA 1ZANH 1MAKA 4LVNC 1OAQH 4Y5XC 3MZGB 3CDGA 4ISVB 1T0MB 3DVGB 5ICZA 4EN3C 4G43B 1RURL 2XNAB 4GMTH 2FCBA 1CDYA 2YXMA 4O2FA 1IZKA 1NGXB 2IWGA 4U0RB 1G0DA 3IFOA 1EEZA 2CJUH 4HF5L 3NN8A 4PJEF 2EDKA 3RVVC 3BI9X 1VFBA 2J8UF 4WI4A 1C5BL 2PYEB 3RWDB 5FXCH 4XWGL 2H2SD 4MSWB 1F2XK 4GUPA 4OD1H 4F80A 32C2A 3SKNB 4Y4FD 3C09B 4LSVH 5F88A 1IGCL 2AJSH 5CD5D 1T66D 1XF5A 2GTWA 5IBTH 4MS8D 2W0FB 4V1DD 3ROOA 3SDAD 1QSFE 4PRPD 3G5VA 3EOAA 1L7TH 3D85A 3VWKA 2AXGA 1AH1A 1QRNE 3QQ4B 1CG9A 4XPBH 3RPKA 4NQVB 1HKLH 4R2GB 3PWVB 5BXFA 4LSUL 3IDNB 3CX5J 3C5ZA 3WL9B 3LVEA 1KSRA 3ZTNH 1DQML 4YDJA 2GFBA 1OF2B 2GT9A 2FX8L 2XXMB 4N8PA 3UBXG 1OD9A 3BGMB 4KK6C 1U3ZA 3MV7D 3L3KB 4G8EA 4I3RL 4YGAB 4M3KB 2AJ3B 4APQD 2FGWH 3HNVL 5KSUB 4PJIB 1I9RH 3BAEH 5DEFA 3QXDA 5CEZE 4P4KC 3VXOA 2A6DA 2HMID 5EA0H 3BP4A 4LVHC 5F3BA 2ATPA 5E8PA 2OCFD 3BD3A 4HBCL 5SWSD 3THMH 3N50A 3WS6A 1J8HA 1DQDH 1KTDA 1ZXQA 5HD8C 5KS9F 1YY8A 5C0BB 2IC2A 2PYEE 2F19H 1A7PL 3I75B 3VWJB 4LLVA 1G7PA 3CSBA 8CGTA 3EJYC 1HYSC 1S7VA 1UADC 2YA2A 2R56H 4LPUA 3ARFB 4PJCF 2AEIT 4OUUA 1EBPA 3HMXH 2ARJB 3G04B 1AGCA 4P49A 4WTZA 4YEFA 4LRNH 4I8DA 3TA3A 3UXFA 2W65A 3ECBB 4GXUM 3L3HA 4Z7VA 2JK5B 5JW3H 2OMNA 1CL7L 1HXMA 5F9OL 1L9NA 5L0QC 5FO9B 1ZS8A 4LSSL 2IH1A 3N85H 2BERA 3BHBB 1WWBX 5I1AA 5LGKA 4LKCA 3LS4L 4BH7B 4ZUSB 3DV4A 2B7DT 1I7TA 3PQYA 4AEIH 2FZ3B 3TWCL 4HG4K 1Y18B 2F58H 2YOCA 1KB5H 4PJIE 4XWOC 2BMKA 5AUMB 1FSKC 2FGZA 2MFNA 5GJSH 4WUUB 3TZVC 5GGSB 1DBAH 5JHLH 4PG9A 1XGTA 4XP5H 4PJ8A 1BJ8A 3QAZB 3WSQL 1KC5H 5E70A 5DC4B 5DJ0B 1AGEA 5I1IL 1FVEA 1A4JB 1JYVA 5C0BE 3B9DA 2MCPH 1RAMA 3U0PA 4QCIB 5IB3B 1J1XL 2FHBA 1N5YH 2FECL 3SGJC 2G9HB 5ILTH 3VD9A 4JQVA 3BP6A 1HHKB 1M7DA 3QO0B 4CAGA 2XZQH 4JANB 5GISH 3WHXA 4AG4L 4J3WA 2H45A 1TQCB 5C0JA 1NC2A 1F6AB 1RPQA 1YEDB 3QCUH 2MHAB 1B3JA 5HHQB 4RIRA 4M61A 3RDTC 4U3XA 3E2HC 1EXUB 2BRRL 5F6IC 4XNZB 5DD1L 3HUJB 4Y4HB 1BP3B 2FJFA 3J8F7 4RBPH 4QHUA 2W9EL 4X6DB 2DQTL 1BWMA 1KYOK 2YBRA 3C8KB 3KWWB 3KLHD 1CLYL 5ISZA 1FRGH 1JL8A 3IETA 3WIHA 5FV1L 2DQIH 1DBML 1S9XA 2PTTA 4U6HA 4DCQA 2NW2B 5INCB 4ZXBB 4RSVA 1MHPH 1WZLA 2SEBA 1CXFA 1SHMA 4PBWD 3U2SA 2J4WH 3BQUA 1JNHA 3IDMB 4ODXA 1W0YT 2LVEA 3EYSL 4WUUE 4M1CC 5CGMA 3C9NA 3KPQA 3SE9H 1OB1A 5HYSB 3DHMA 2F54D 3OAUH 1NGZA 1A5FH 1NMCC 1RULH 5E6ZA 2HLFC 4GKZB 4RGMC 1WIPA 3WNNA 4OZGF 1AQKH 5GGUA 4YUEH 3GJFK 2LABA 4ZG1A 2EDNA 3W39B 1ORQB 2DQCH 1A7QL 4IRSC 3MLZH 4OI9A 4GKOA 1CIUA 2W1NA 3QDMA 3M8OH 1FNFA 3HUJE 3L3GA 2E7MA 3K8LA 1NMAH 4XVJL 2B4CH 4HMEA 3DIFA 1H3PL 4X4YB 3DMMC 2EH7L 2VWEC 1J1PL 3S4SB 1UM5L 3OKDA 5DJZA 5D9SA 3GUTB 4ZQKB 4XWOD 3TO4C 1KIUA 4GW5A 4D9LL 5KVFH 5DWUL 2XQYG 2PXYD 2VLKD 4MNGE 1CGXA 4RRPA 4PGBA 5B22A 2V9QA 5KVGL 5C2UB 4MDIA 3ARGB 2GJZB 4WNQA 4PLNC 4QHMA 3QT2A 1B9ZA 3MRPB 5CP7B 1NCWL 3LHPL 3EHBC 1K3ZA 5IMLA 3RNQB 3GI8H 3PGFL 2HFTA 4K8RH 3MLPA 3A6BH 1T4KB 4JDVA 4RISL 1U2CA 4P2OD 2CRIA 3T0EB 3PV6B 4KKAD 3B3IB 4X7TB 1JPSH 2DYPD 1B90A 4TSBH 5HDBF 3VG0L 3MLYL 4ZFZA 5A2IH 3PWLB 4ODHL 4IDLA 1Z9SA 3C5JA 3NOIA 3MNWB 3AB0B 3KPPB 2IPUG 4HX1B 2A6IA 5ADOH 1T83C 1IGYB 5MEQA