5I1EH

Crystal structure of human germline antibody ighv3-53/igkv1-39
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1eH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1eH01
1J9CT 3D39D 1HQ4A 2QTEA 4FQ2L 4CMHB 4X99B 3RWEB 4UT6L 3HE6C 1F4WL 1LE5A 3QO1B 3O11A 3MOQA 3GMOB 3HFMH 1MLBA 2F8OA 5JNYA 1HYSD 4WY7H 3P40A 4FTVA 5HYQB 3QDJE 4O51B 3MRPA 4JANA 3ARWA 2AGJL 2NXYB 4UDTA 5ETUB 1J12A 4N0FB 5ALBL 5HDOA 4C54A 1WFOA 3QG7H 5ITBL 2D31A 3KPSA 4TRPL 1S8DB 4P2QE 2VLME 3MACL 3HZMA 3UTSD 1FYHB 4NHUA 3DOSA 4QGTA 4DKFH 4M48L 2Q8BH 1MLCB 2O61A 3RVUD 1G7MA 3UPRA 5B8CC 3QIWD 3BZFA 3PHQA 1KC5L 1BBJA 5FYLE 2FX7L 4UV4L 2R9HD 5EA0L 3MV7E 3HI1B 2XNAA 3RNKA 3L3DA 1IM9A 4NJ9H 3DUSB 4UDUA 4HWUA 1BGXL 2ZOKB 4WI2A 1P7QD 1AR1D 3F12A 4JG1L 3ZKMD 1EFXB 2CK0L 3T1WA 3L95B 3W82A 1F90L 3GRWA 2IG2H 2P8PA 4CU8A 2NY5H 3DYMA 4GXVH 3FOLB 3GFUA 2VZTA 1U8KA 1FNLA 4YE4H 3AAZB 3PV7A 5IEHB 1INQB 4U05A 4OD3H 2A6JB 3O9WC 4LDOB 1OP5K 4PLNC 3MOAL 3UTTE 1MRDL 4DOHB 2UWEE 3LS4L 4OZFG 3C6LA 1CGSH 2ATKA 4WV1B 1F6AA 5IBUG 2ZG3A 3WXWL 4LVEA 2A2QT 2NZIA 2V2XB 1TZIB 4WI6A 4F57H 3WFCL 1I1CA 2VZUA 4BSVB 4F15B 1KB9K 1F3JB 1NCWH 3IXTA 3KHOA 5GJTL 5JR1L 2R0KH 5F1IA 1EAPB 5C0DB 2PKDA 4QKXB 2BVPA 4QRUB 4EUPH 1CVRA 4FQIL 1OSZB 1T66D 3MRJB 4Z7UB 1D5XB 2GUOA 3L9RA 2EECA 5F7MC 5T5NG 1BD2A 1OSPL 5IMMA 4HD9A 5K33A 1DVFC 3QBTB 1NFDF 2G5RA 3KLAA 5KN5A 5FFLA 4YDKH 1P1ZB 4LF3B 2DOCA 4DKAA 4QRPB 2YEZB 2Q7YB 3S5LB 4PP1C 1FQ9C 3KPQA 5C0RL 4X5XB 2FO4B 4XI5D 2ZWLT 4PG9B 2P46B 5T1LA 2DWDB 1U8QB 1RI8A 5F89A 5J9PB 5HHQA 4JPWH 4OI7A 5DJZB 3PF2A 3REWB 1YMMD 3LEXB 3IFPA 1NSNH 1BFOA 3CFDA 5BRZD 4B50A 4LHUA 5CIPH 5ILTH 4YHZL 5C0NC 1UVQB 4RGND 3KPTA 5F6HI 1NMCB 4CVXA 3G9VA 1DN0A 1F2QA 2GHWB 3RTQC 4M61A 5DT1H 4HWBH 3SE8H 1BQUA 4MNHB 5A2KH 3VXUD 4HBCH 4M6OH 1I7ZA 1R5VA 5CD5D 1DBAL 1F3DJ 1PKOA 4WHTA 1FVDB 1WFTA 3BZEB 1L9NA 1KSRA 3FFCE 3V52L 5CWSA 5F7HA 3BFOA 2R23A 3NCJL 1BOGA 4OD2B 5DEGA 1CXHA 4HAFA 1FAKT 1UM5H 2HA1A 4RDQF 2QSQA 1UM4L 1T21B 5EH1A 1U8PA 1GZPA 1J1PL 4NPYB 1WZKA 1EA9C 4G8EB 1Y18B 5IW6A 4YXLH 2A38A 3G9AB 1MHCA 4MNQB 4FFVC 5FHAH 5IROC 2H2PD 5CGYC 1CT8A 1BEYL 3MGTA 6CGTA 5FK9A 2VXTL 4TSCL 3ARRA 4NKDB 3L6FB 1JK8B 4YNYA 5DFWH 3KDMB 4U1LA 1LO0H 2OTPA 2ZOLA 3QWRA 1BVKB 3SDDC 4U6XA 4PJFA 1HINH 4Z7UE 2ADFL 4J3UA 4XNYL 2EE9A 1KCKA 4OCSL 1JBJA 3HZVB 1N6QH 4S2SB 4HJGB 5DYOB 5JW3L 1W0VB 3S37H 1I9JL 1NAMB 3VMOA 5CP7A 4QRPE 1N3NA 1GOGA 5HVHB 1Q1JL 3CSBA 1MI5A 4L9DA 5LXGH 5E24E 3DXAD 4WENB 1I9RH 4XVTH 2DN7A 1RUQL 4EJ1C 1DLFL 2X4PB 2R15A 1AIFB 2X4RB 1FPTH 5IHUL 5EORL 5FKPB 5MERB 3OXRB 1MHHB 3MLXH 4G43A 3ZKSD 5L2KE 5CFHA 4X7EC 1XGYL 5TE6H 3IRPX 4TULL 3BP4A 4UB0L 1P2CA 2A77L 1G9MC 5IUSA 1D5BB 1E27B 3L5XL 5E5MB 4RNRA 4ONFH 3HG1B 1EK3A 4ERSL 4K7FA 1JHLL 1VCAA 3WUWG 2JIXD 2IAMD 1URLA 5HHOB 1WFUA 2EDYA 3MRIB 4MCZA 4PYGA 1A6ZA 4P9MH 1J87A 5DURD 3SDAB 3FTGA 2QKIB 1JL8A 3U0PB 5T1KD 4X5WA 3IYLW 1B4JH 4D9LL 5HHMB 2DQGH 4U6TA 4KMTH 4NQDE 4U0RB 1NCBL 2GK2A 1YEDB 5D2NA 3IDNA 1IT9H 3HN3A 3MUY1 4OB5L 4PJ7A 1W0WA 1ZGLP 5AD0A 4PJCF 5GRVK 4K7PH 4Y2DB 5ICYA 1U3HA 4KJYA 3PP3H 4MNQE 3UZVB 3M8OH 2R1YA 1A6AB 2Y4SA 3T0EB 3GI9L 4EBQL 1D5ZB 1KJ2H 1XF3A 4P5KB 4BQ6A 4RX4A 3L3IB 2VITB 4OCXH 4WUUB 4N0YL 1EHLH 3INUL 1VACA 5D1QD 1A7RL 1NANH 1R3KB 1QFWL 3PDOA 5GS1B 4XXCC 3HPLA 5GZOC 1FGVH 3F5WA 3QZWA 3BN9D 5ICXB 3V0AC 1IC4H 1EGJA 3TESA 3HMXA 3JVGA 4JFFA 3WHE0 5KTEH 4BYHA 1VGEL 1NQBA 4OAWA 5ESVB 5AUMA 1DLHA 4ZNEA 5BXFA 3MJ8A 2A9NH 5F88A 4UTBL 3WFHB 4MNGB 1QOKA 4GKZB 2Z31A 4XBPB 5IW1A 1H3XA 5FHBH 3LKPA 5ACZA 4OZIB 4Q9BA 3EOAB 4PRDB 4OLZH 2PO6D 4MB3A 2HVJB 5TF1L 4U7SA 1NC4B 5T3XE 5GRJL 5I1JL 2NCMA 4OM0L 5KSBA 4X6FB 3S8WA 1T5WB 1CDCA 1LK2A 2G5BB 4I5BB 3EO9H 4HGWB 1D3CA 2YUZA 2B20A 5IFHH 3Q3GA 1ZWIA 3F7YA 3PABA 2W9EH 5H94B 5HHME 4KKNA 1KPRA 4XNQB 2H2SC 4B41A 1UH2A 1WIOA 3F8UB 2ZJSL 5K9KB 1KOAA 5F7LB 5TJWK 1PSKH 1QR1A 4NQVA 5I1EH 4N8VB 1RHHB 3MNWB 3IFLH 4HKBA 1MFDH 3QDGA 2Y7QB 2RIKA 1ZLSL 1QFHA 3S96A 2OZ4H 1S7TB 1HI6A 1BBDH 5B39G 5EU6B 3L3JB 4YHOL 1AQKL 4HJ0D 5D9SA 1CDBA 2MCG1 3H9SA 2X4SB 4WUUE 1TJGH 3HE7D 4WI5A 5C7XH 4Y4HC 3E2HB 4KTEH 3RAJL 5C2BL 3MV8D 1BJ1H 3U2SA 5ICZA 1MJJA 2VJXA 1WLHA 1WCBA 3JXAA 2RQ8A 4HIXL 2AXGA 3IDMB 4JY6B 2FLRT 5EC2A 5D7JA 4NRYA 5FUOH 1T7YA 5D8JH 3WN5A 5JHDE 4CUCA 1IZKA 3STLA 3MC0A 4PRIA 1ZLVK 2XICA 4FQJL 2E7MA 3W2DH 5IB5A 4ZO9A 1AGFB 3JV6A 3O2VL 4QHMB 3WE6B 3SGJA 3T2NH 3TFKC 1AC0A 4Q0XL 1RUKH 5BS0B 5EZOH 5GGQH 5J6HA 1CU4L 1MCPH 5C09D 2CQVA 2UVFA 5IBLC 2BNQA 3TBTB 3OKOA 1MCRA 1EFQA 4CN4A 3MBEA 1JNLL 1L7IL 1RUAH 4P46D 3UJJH 1A7PH 1DE4B 1MFBH 1JTPA 3BDYH 3W9DA 5EPMB 2ZPKH 3CSGA 2NY6C 1WZLA 2ED9A 5JOEA 3QXDA 5IB2B 4LBEA 2VLRD 2PF6A 1WZ1L 1X5LA 3MV7A 4ISVB 5DD0L 2XI9A 4X6DE 2FL5B 1ZE3C 3MJ9L 4S11A 5HPOA 4G3YL 4JFYB 1B2WL 2PN5A 2VOTA 1QBLH 4NO5B 4IMKA 4K3DL 3GJEA 3EOBA 2YPKB 5F3HA 5KVFH 1JYXA 2A9MH 2Z91A 3CLFL 5A2LH 3VDBA 3MCKA 1KEMH 3HI5H 1QBAA 3MRRA 5GRYA 3FHAA 1U36A 3AU1B 3IDYB 4EI5C 1NGPH 4L3EB 3QEGH 1J0IA 1KFAL 1D6VH 2VIRA 5AYQA 1XIWA 3K1KC 1LK3L 4OBSA 1YEJH 3GSXA 1XF1A 2JJSC 3TT1L 1YNLL 3IJHA 2GITB 4OZFB 2ZSWB 5FKAA 2IH3A 2JK5A 1A6VH 2R56H 5IBUB 3UTTA 3CH8A 5GS0L 1RD6A 2UWEA 4ZD3H 3LB6D 4AT6B 1I3GL 2R2EA 5JPNB 2PXYA 3BHBA 4DEPB 4ODUA 2FR4A 1JWMA 4N90D 4M1DL 1UB5A 4Y4KC 4PJ9A 5I8CB 5IVZA 2EDQA 1FFNA 3P0YH 2E9BA 2YR3A 3DMMB 3O0RL 3CFJA 3HS0A 2IGFL 3C5ZD 4MMXC 4LGRB 4S1SH 2DI7A 3IDJB 3QDMD 3Q6GH 3O6KH 1PBYA 12E8L 1KT2B 4MJIA 3BRGC 4G7YL 1MCOH 3KPOA 3WIHA 5DTFB 5MP6L 4OUUA 1Q9WA 1R3LA 3TIDB 2ORBH 1PKQB 1KELL 2BY0A 4HS6A 2R2BA 4LARL 2FYYB 5HDQL 1KCSH 4QXGH 4XNUH 1OD9A 3MLYL 4J3WA 3GHBH 2P24B 2VQ1A 5HHPB 1T3FB 1SYVA 4KK6C 3WNPA 4JDTH 1KLGB 3BX7C 4UU9B 5TQ2H 2PR4L 2VSDA 1JGVL 1YC7A 2ZUQB 3DI3B 3JSSA 1FNEB 5E99H 3CZFB 1AHWB 4LMQE 4PRPD 3GGWB 4XMKH 4OF6A 2IPTH 1NDMB 1N7ML 3HZYB 3BQUC 1RHFA 1Z9SA 5DD5L 4ONGH 1KJVA 5HHVL 4DGYH 2PUQT 1QSFD 2ZCKL 3QULB 4Z78A 3MODL 4YHYC 3TVMB 4APQD 4CJ1A 2V17H 2YSSB 4H88H 2XQBH 3L95A 3MRKB 2FRGP 3DVNB 2Y5TB 1QEWB 3FFCA 4JO4H 3VGFA 4FABL 1ITBB 3WYRA 1TVHB 3KR3H 5MENB 4L3EE 3I75B 3OKLB 5DQDH 2BC4B 3TBYB 4JY4A 3LRSA 5HI3C 5F7EL 4TSBL 4PJBF 3SPVA 2BHZA 1HHIB 4NZUL 1CCZA 5F96L 2AJVH 2NXZB 2CKBA 2IQAB 4NC2B 1X3DA 3BT2L 4MD5A 4HCRA 3FB8A 3UYRL 3PWJB 1LO5B 3WFBH 4NM8L 2UYLB 4LSSH 3ILQD 4MAYB 4L4TD 3AGVA 3WV0A 4UNTA 3ROLB 3KS0H 3O2WL 1MHPH 4JLRA 3PV6A 5J0BA 1CGUA 3LH2H 2UZIL 1IQDA 1U58A 1YDPA 4X8JA 3TWCL 1PEZA 3V5HA 3B9KA 1TJHL 4NGHH 3FO1A 1A02N 4N9GB 4G9FD 4PPTA 3RY5A 5I17A 4NN7B 2HTLC 4LASH 1UACH 2YPVL 1CE6A 5I1LB 3ZZ1A 4YBLB 1CD9B 5D93B 2NW2A 1UQSB 1YPZF 1BM3L 1P1ZA 4I77L 4CAGA 1X5KA 3P0GB 1A1MA 4PBVC 3MA9L 2FO4A 5JOFB 3T8XB 2R4SH 1LO3L 4DGVH 2X1WL 3LSOA 5IHZB 4JGUA 1TMCB 1MJUL 2WWKO 1UZ8A 3KXFD 4PY7B 1TZGH 4C83A 3MLTB 3MX0A 4YWGL 2NZ9D 3QNXB 3WLBA 5L2KA 2X89D 4BUHA 4LCWE 3C6LC 5DZLA 3MYJA 1YY8B 4OIAA 3WUWB 4AENB 3DRTA 1SYSA 1L4IA 1XAUA 4PJ5B 2IFFL 4L5FH 3UJIH 1OAUL 5L2JB 5F9DC 3MA7A 5C07D 2QHRL 4ODVH 3KPNA 3ZE0E 3DBXB 1HHKA 2DQFA 2E8YA 2WM0A 5DMGD 4MX7A 1T1ZA 3EFDH 2HKFH 2R39A 5MENE 4NQDA 1XGTA 2VZOA 3ZE2E 3WNNA 1NAKH 2DLIA 1S7QB 4PLKC 3MRHA 2GJ6E 5DD6B 1G7HB 2Q86B 4HJJH 3GMLA 4OZGA 5EOTB 1Y18A 1W2KT 4MNQA 1JNNL 4ONHA 4KI5F 2JCCF 2VDNL 4EDWL 2GK0B 4F3FA 2CLVB 3MV11 3FO9A 4I0PA 4P4KA 3U4AA 4IBLT 3EYOA 1S7VA 4RZCB 1J7VR 3MZGB 4XMPH 5LGKA 3HB3D 5D1XD 3QHZL 3QI9B 1NCDH 3V4UH 2VXVH 4DJMA 1U42A 4I3SL 3VE0A 2ADJB 5C0GA 4M9OA 5J1SC 3MO1A 3NN8B 2CIKA 1QACA 1NAMA 2NY1B 3HRZB 4RAHA 1GOFA 1MRFL 4M7ZB 2F74A 2Z4QA 3LMJL 4D9RD 5I6XC 5LGHH 4BSWA 4HS8H 4HX1B 1TQCB 3RVWC 4TUJA 4NJAL 4G7VH 5E8DH 3LN5A 1DQQA 4AQOA 1E6OH 2I9LA 2G2RA 2VLKB 3PWUA 1U92A 2EICA 3D18B 2EH7L 2HP4A 3GJFH 2CXGA 4HBQA 4LLYA 3U6RB 4PB0H 1MWAH 4QWWD 1IC7H 4PJ5E 3MRNA 2DQJH 3DIFB 5D6DA 2V2TB 4GS7C 2EZ0D 4LNRB 4NQEB 2QKIA 3BPCB 2VABB 1UGNA 3NA4A 4ODXB 5FOJA 3TBVA 1CLYH 3K4AA 1DQMH 4HWZB 1F58H 1A9EA 5LBSH 3ARFA 5DD1H 3I02B 4F33B 4ZSOB 5FYJD 2VZSA 2P1YA 5JW4M 2J88L 3C9NA 3OAYH 3ZO0A 2KUTA 1HXYA 1MFEH 4HS3A 5B39B 2J6EL 2ARJA 3VXTB 4OFKA 5FYKU 3TP4A 5KAQG 3FT2B 2VRAA 1N6UA 4PRHE 3DX6A 1ZT7B 5AZEH 5F7UA 2DQHH 1IM9D 2NQCA 1TTGA 1G6RB 4OGXH 35C8L 4AIZB 1S9KC 4KRMB 1AXTL 2AXJA 1BVLA 2V7NB 3BXNB 5B38G 1H3GA 4BFBD 2C7UB 5JXAH 2YPLD 3KPPB 2XRAH 5GGSB 3PWPD 3FQNA 5FM4A 5J8OA 3BH9B 2K7PA 5ICXA 5ID0B 3P4OA 2APXA 2BHYA 1T4KA 5JMOC 5JHDA 3K4DA 1EEZA 3QAZB 4WU7A 1NLBH 4P99A 5J4MA 4C57C 4JHBA 1HH9B 3CUPA 5EU7E 5D2NC 5BZDB 4DVBB 3LQAH 1S9YB 1CLZL 3DTXA 3G6JB 2HLAB 4OCNC 4TSAL 4O9HH 1RJLB 4LLVA 2AI0L 3SKOB 1IAKA 5IVNA 1UENA 3VXSE 4ZFOL 1AXSB 2F53A 3GSQB 3SOBH 1QBBA 3ULUC 2ZKHL 4F2MA 2VLKE 3SKJL 4LLUA 4LSQL 4HHAB 1U3HC 1XR8A 1DEEB 5JZ7D 1B0WA 1IEBA 3CAFA 4DK3A 5KANG 4Y8AA 2QLVB 3B8YA 4BQCA 3A0OA 5EBLB 4NT6B 4I48A 5GS3A 4YX2H 3O45A 5TDOA 1WTLA 4NQEE 4X6DA 1ORSA 4JDVB 5SWSA 3V5DB 1JF5A 2JF1A 3OL2A 3WIFA 2ADGA 3HFML 4K94H 4LCYA 5IJKA 4JREC 1NEZA 4WY7L 2X9YA 5IB3B 4ZXBB 2YRZA 5ID1A 3JVGC 2CSPA 1RZGB 3QG7L 4NUJA 2EYSB 2PNDA 2Y7QA 4PRBA 4RRPA 5CEYA 4HIHB 4ZUWB 3HNVH 3LN4A 3ULVE 4DGIH 3MROA 4IIQB 5IMKB 1I7UB 3NIDE 4DKFL 2Q8BL 1FSKB 3GSRB 1JGEA 5CLTA 5I8EB 4L3CA 5FYKE 3QHTC 2Z31C 3OR6B 1T1XA 3CVHH 3GUTB 2VLJA 1JWUB 2Z8VC 2E5EA 1X6NA 4E42A 2H41A 3TPUB 5D7LE 4MB4A 1EPFA 4X80H 4EIZC 4NJ9L 3KWWB 4XCNB 2CUIA 1CIUA 5HGBA 1XMWA 1BJMA 4TN9A 4PTTA 3MNVA 3ARGB 4AH2B 4ZUTB 4Q2ZB 2ITCB 2D7PA 2AJ3B 4LMQI 3PE9A 5C8JA 4Q9RH 5D1ZD 2A74B 5GIRB 2IG2L 5IVXB 1E4XH 4K71B 5FM5O 2NY5L 2R2HA 4GXVL 4TPRH 3WL9A 3G6JE 5J56B 4WI9A 1EDQA 3B9EA 3N06B 4YE4L 2B5IC 1K4DB 1KB5A 3MZTA 4OD3L 4FHBD 4LL9A 2VUOA 4YPGA 1FC1A 4U6VH 3OR7B 5CD3B 2UUDH 3ABZA 3HAEH 2E6PA 4MDIA 4TUOA 4XP9L 4XC3H 1CGSL 4BFEA 1SVZA 1A6WH 1NC2B 1KYOJ 1ODAA 2HT3C 1MRCH 5T3ZE 4GXUN 4H25B 1A1OB 5E9DB 3O4LD 2W92A 4F57L 1KCRL 3OG4B 2AXFB 3DX8B 1T0NA 1NCWL 4L8SB 3RIAK 4D0BB 4KROB 1JHTA 4ISVA 3IDGA 4WDIB 2R0KL 3NCBB 3VGHA 4CW1B 2NYYC 3VJ6B 1J10A 4JFPB 3IGAB 1XF4A 4RFEA 1BOYA 4WGWB 3DI2B 3ARUA 3BJLA 1ZA3A 2QL1A 4GAGH 5DZOA 4EN3B 2XTLA 4P2OD 1YEEH 4K8RC 1KIQB 5D7JC 1J8HB 4GBXA 4M7KH 4NQSA 2BDNH 4X0KA 4D0DB 5GZNC 43CAA 3WN5C 4PJEB 4QY8A 1MCFA 4FFYH 4NOFA 1LEKA 3KYNA 4P49A 3U82B 4YDKL 3RHWF 5I1KH 1AD0A 3SGJC 1MOEA 4KPHH 1XZ0A 5JUEH 3TN0A 2OL3A 3GSNH 1LHZA 1S9XA 2CJUH 5CZKA 2GJZA 4POYA 4JPWL 1UJ3A 2A83B 1ZOXA 2Y07H 1JRHH 3M17A 3MBEC 1NSNL 4ZOBA 5ILTL 3VD5A 4DN3H 1BFTA 2I07A 5FGCE 3TEUA 2MWCA 4JM2D 1NGXB 3FN0H 4Z7UF 1A0QH 4JEGB 4M93B 3ORJA 1LO4H 1KIPB 5DT1L 5C0BD 4HWBL 3SE8L 2H45A 2NY7H 5EBWB 3T3PF 1CR9H 4HBCL 2R69H 3AB0C 4M6OL 8FABA 4ZPVB 3VI3E 3CXHK 1U6AH 2NY2C 3BPLB 4EDXB 3PWNA 4MQ7A 1GH7A 1F42A 2DQIH 3DLQR 4RA3A 5ACLA 5AAMA 4KMLB 4PV9B 5IVXE 1BZQK 4TVSa 2YN3A 4IMKC 4JPKH 4F9LA 4M4RA 4LHJB 2GSGB 2EKJA 1UM5L 2AJZB 4LVNC 1XIWC 1GVIA 5E5UB 2VYRE 1FN4A 3T1FB 4YXLL 4CGTA 5FEBA 3EJJX 4BKLB 5FHAL 4JRXE 3GSOB 4I0KA 3E6HB 4LCWA 4CADB 3QQ3B 2PXYC 5ISZD 2EDNA 3JTTA 5E8EA 4GG8B 1NDGB 4FZ8H 2APTA 1LO0L 2FB4H 3TA3A 4PJ9C 1RK0B 3CU7A 3VXME 4PJIB 3QULA 4D0CA 1HINL 5E8NA 4HUWA 3O3AA 4U1NB 4KDTA 1N6QL 3EDEA 5I1IH 5F7KC 4PJEE 1BFSA 4FQQB 4NNXA 3U30B 4GKOA 3L5HA 4R96B 3S37L 4BQBA 3OKLA 4Y4FB 1JF6A 1XGQA 3V5KB 3C60A 1TTFA 1HHIA 4X7DC 5LXGL 1CDJA 2GJ6A 1I9RL 4XVTL 4PBXA 1U8JB 5BV7B 4MLSA 1FPTL 2CDGB 2X44D 2BVOB 2F54D 3RVXC 3MLXL 1Q9KB 5KZCB 4X7FC 5TE6L 3VCLB 4IMLA 3D3VB 4M7LT 3D85D 3HZKA 4NFBA 4IRSB 1H8NA 1NGZB 1YEFH 1QLFB 4I18A 4ONFL 4KK8D 1NJ9B 2EDBA 1N64H 2BY1A 4KKCC 3MLPA 2DJSA 4P9ML 1ZHLB 4N0UB 3O3BA 2XQYK 2OQJA 5C0IB 1B4JL 1GGBH 4GMTH 2NLJB 1ZSDB 2EC9U 3R8BB 1FLRH 1BQLH 2DQGL 4KMTL 4NZJA 4NN6C 1EEYA 3P9MB 1IT9L 1QR4A 3BVNB 5C0FA 5JIPA 1NGYB 4QRRE 5E6ID 5INCA 2PYED 2D7QA 5EUOB 2WWMD 1L0XA 3QXWA 1QYGH 4K7PL 1Z0MA 5E8PA 1IKFH 1ETZB 3GEWB 1F11A 3M8OL 3CNKA 1QVOB 2VERN 1IBGH 3RWGA 1KJ2L 4YGVB 1YMHA 2D3VA 1T6WA 4M6NH 4OLYH 2BXYA 3GKWH 4OCXL 1EHLL 4OZHE 1A21A 4P23B 2E8ZA 5I8OH 5EU4A 4R4BA 4R4FH 4U6YB 2WIIB 1PG7H 5C1MB 1QO3B 1RZKC 5SWZD 3DV6A 3IKCA 1FGVL 3MFFB 4JJ5B 5HTSA 4N0CC 1R5IB 3B9KC 4YDJA 4XB8A 4RBPK 1CD1B 1IC4L 2AV7A 4ORGB 1ZHKA 3VA2C 4Y19A 2VKWA 3OKKA 3UC0H 5LG1A 5KTEL 1L0YA 5CCKH 1KPVA 3BGFC 3G08B 2I9TA 2A9NL 2W9DH 3D69B 3TLRA 1QLEH 1B0GB 4LPVA 1FFPA 3LEVH 1IM3B 4YFLI 5FHBL 4V1DD 5FGRA 1WBXB 4PRHA 3BH8B 4FQHA 1HKLH 4HQQH 4NHCH 4OLZL 5IFAH 2P5EB 1ULVA 3TO4B 3NOIA 5EC1B 5DMKB 4BFIA 2WINB 2O5YH 4DK6A 4NWTH 2L4OA 2CRIA 1I3VA 2KKQA 4OLWH 4X7TA 2X10A 4WRLA 5DS8B 2OCFD 1QRNB 5MEOA 3EO9L 2MHAB 1FYTE 4NO0A 3DYPA 4ZUVB 3VFPB 2ZNXA 2OTUB 1GC1H 2W9EL 1CICA 1M1SA 3VH8G 1A2YB 3VWKD 2IBGA 1HSBB 3B6SA 2RHEA 3T4AB 4OZIF 5I1EL 4LRIA 5EUOE 4UV7H 1RY7B 3GMRB 1IKNC 1Q72H 3N1FC 1AJ7H 2I5YH 3IFLL 2ZP0T 1MFDL 1LE9A 4U1MA 4UILH 4JY5H 1JYWA 3VXSA 3RWDA 2OZ4L 1BBDL 1QA9B 4YDVA 3LZFH 4JCLA 1OT1A 3MCLH 4O00A 2Z35A 3I6LD 1LEGB 5DJDB 1XF2B 4Q9CA 3ARXA 2QQQA 1TJGL 3EOTH 5C7XL 1QSEB 1WWAX 4I0PC 4KTEL 1HK6A 4P4KC 1H3UA 3SDCD 3GMMB 2C4FU 4YBQC 4OI8A 1B0RB 1OOAA 2DTSA 2NY0B 2YOCA 1MCBA 5HBBA 5CJOH 5FUOL 5D8JL 1ZGLA 2ZCHH 4G42A 3MRDA 1OAQH 3ULSA 1IEAA 5FDWA 3FAWA 3K2UH 3B2VH 3HKFA 3MMEA 1SM3H 3BN3B 3W2DL 4U33A 3CX5K 3T2NL 3WXVH 3W39B 4Y5YA 1FV1A 1RUKL 1OGAD 5EZOL 5GGQL 3VXTA 4QHKJ 3NZ8B 5HVHC 2H32A 1MCPL 5ESAB 1RUAL 3TCLA 2BNUA 4LPWA 3UJJL 1A7PL 4E5XB 1MFBL 3RDTB 4HWEH 3CZJA 2B0SH 3BDYL 1Z3GH 4WFGD 4HUVB 4POZC 5HD8D 3Q1SH 3QUYB 2ZPKL 3VWJB 4LKCB 4BZ2H 2FGWH 2LU4A 4UQ3B 1JZ6A 1JPGB 4QHUB 3HLAB 3QXUA 5D7LA 1FIEA 1I1AA 3BI9X 4QTHA 4I3RH 4H1LA 2I60H 4UI2A 4WEUD 4ENED 5F9JB 2VH5H 5D6DC 4E41B 2YD4A 3VFRB 2WP3O 1KUMA 1VEPA 1MCSA 4K55A 4QF1A 4YO0A 5E94A 1QBLL 4P2RD 1TZHA 3PQYB 4R0LA 5KSVA 2F19H 4H5SA 5KVFL 4G6AD 2A9ML 5JW4R 1KEML 3HI5L 3LKOB 3P4MA 3TIEA 2WBJB 2XZZA 2BVQB 1NGPL 2X4NA 3QEGL 5GGTH 1D6VL 2X7LA 4PS4H 4UT7H 5ACMA 1AXSA 1UXWB 3QRFM 3U4BH 2D7NA 3ARBB 1A6VL 2R56L 4PD4K 4OFYD 4ZD3L 4KV5E 4OD1H 4YZFE 2VL4A 5DRZB 1CXEA 4YC2B 3QIWB 1J0KA 3L7FA 4FQXB 2XWTA 4LCCB 3P0YL 5J7CC 4ACPA 2EEAA 4U1GC 1NUGA 4WTZA 5DO2D 1M71B 2EO1A 4S1SL 5MHSE 1MFCH 3Q6GL 1KIUA 1CGXA 3O6KL 5FB8B 4NQUA 3MLZH 1ZVSB 3G04A 4G6FB 1NEUA 1MCOL 2AJSH 4AIXA 2NX5B 3UZEA 1RZ8A 4F37F 2VDPH 2R1XB 2ORBL 3EAKA 4NDMA 5HGHA 1N0XH 3VU2A 1KCSL 1NH6A 2CRZA 3HC0B 4QXGL 3RKDD 1NCCH 4HUKB 2OJEB 4XNUL 3L7EA 4X7SH 2W0KA 3GHBL 4JDTL 2AKRB 3PL6A 4JR9H 5TQ2L 4A6YB 3KPRB 5E99L 3P30H 4JZNB 1IAIM 3QH3A 1T04B 3MREB 4XMKL 3L3OB 2P7TA 2BOCB 2GTWB 2IPTL 1NMBH 2MTPA 4JFDE 1CWVA 1BZ9B 2WMPA 4NFDA 1MQ8A 4LLAA 3IFOB 1IGJB 3H7BA 5IJVA 5EO1B 4ONGL 4E41E 1Z0NA 4DGYL 4KRNA 1JNJA 2UZXB 4Q2ZA 4NO2A 3MRCB 3RWHB 2OS7A 1FFOB 2V17L 4X4ME 4H88L 2XQBL 4JFQB 4RQQA 5JOPD 2JB6B 1EO8H 4JO4L 4TQEH 3CVIH 1QFWI 3KR3L 1INDH 5IKCA 1P4IH 4F7MB 3K8LA 5DHVA 5DQDL 1SY6H 1SBSH 5I66A 3OGCA 3QO0B 4MJ5B 3BE1H 4I4WA 2AJVL 2Y1VA 3NCFB 3SQOH 3B5GA 3UTSE 3RFZC 4NRZA 3OKEA 4OCRH 3R8QA 3QFJB 1XCQA 3VI4E 3WFBL 4JRXA 4WU5A 2NNAB 1AFVH 3NCMA 4LSSL 2H26A 2L7JA 4C56D 5BRZB 2YD7A 3WS3A 3FAXA 4WDIA 2X4QB 3RVTC 3JWOC 5KSAD 1QRKA 4CVZB 1MHPL 2B4CC 3EYQD 3LH2L 3VXMA 1C5BH 5E95B 4NGHL 4Z7NE 3N9GH 2PW1B 2V2WA 4KZEH 2NX5E 4CU7A 1A6TA 2QSCH 4LASL 5JIIA 1UACL 3MUJA 2VISB 1SBBA 1VFBA 5DFVC 2X4UB 1WIUA 1CI5A 2IANB 2BMKA 3OXSA 4HWNA 1VKXA 4DZBA 3QEQD 4EVNA 1XR9B 1WBZA 1BF2A 5HGDA 4BH8A 4LDEB 2IBBA 2R4SL 4DGVL 3BEWA 3NFPB 1SJHA 4GRMB 1TZGL 3PIQB 1I1FA 2P4AB 3WJLA 1N8ZA 1RJZB 4YUEH 5EU5A 1FBIH 3HE6B 3CDGB 2YWZA 4PJGB 3W9EB 4KC3B 3O2DH 1QUNA 1IGTB 2CXKA 2PTTB 4L5FL 3UJIL 1A4JB 4JZJA 3ARFD 4OQTH 5GSVB 4GQ9H 1CDHA 3HNSH 4ODVL 3T77A 5D7IB 4ETYA 5EN2A 3W0WA 1HXMA 2IPKA 5CAYB 3D25B 3FN9A 4L4VD 3EFDL 2HKFL 2V5RA 3DURB 4GBXC 5DEFB 1IGYB 3MRFA 4M7JH 2OTWB 1NAKL 4O58H 1RZIB 5F7YC 4RCAA 4XTRC 5C0CA 4HUXB 2FSEB 4QRRA 2BNRA 3ARED 4Y0GA 5FA3B 2C26A 5B8CB 3MRLB 3N1QC 2ZCLH 5EIQA 1UWXK 3TN0C 5F3BB 3F65A 4HJJL 2B8OT 3PDDA 3U46B 2D03H 3SGDH 1UJ3C 2HJFB 3QWQB 3E6HA 2BY3A 4PGBA 5BRZE 1A7NH 2EDFA 32C2B 3FT3B 1ONQA 1BZ7B 4JRYB 1AO7B 4OZHA 4XMPL 5HY9B 3AS2A 4MHHG 2RCSH 1NCDL 2WK2A 5A16A 3O3EB 3V4UL 2VXVL 3L3KB 3VXUE 3VFVB 5JXED 5GSRB 5HYJD 1A64A 5F71A 3OAZK 4IEFB 5DK0B 2DLHA 1CL7H 5J3HD 2ED7A 3NFSH 4KDWA 3DHMA 1FJ1B 3EW3B 3O9WB 3FONB 2XWBB 3PJSA 1XF5B 4F9LC 1CXFA 3VXRD 5LGHL 3QNZB 3VMNA 4HS8L 1O0VA 4NZRH 4G7VL 5E8DL 3D87B 5ANMB 2VL5B 4FXKA 4JHWH 3VRIB 4RFOH 4PP2B 2B2XH 4NWUH 4CKVX 3RY4A 1YN6A 1MVUA 3IKKA 3B5TA 2ITDA 2ZUQC 2OLDA 2DWEA 3BJ91 4RMUA 1QBMH 4PB0L 4LAJH 1MWAL 1IC7L 2APFA 5C0AB 4HKZB 1IQWH 1J86A 2CLRA 4TVPH 1AKJA 2C1PB 2DQJL 4RSVA 3MJ9A 4NKMB 4MAUH 4BK4A 4PLJD 5ALCH 1QD0A 3TA3C 2YRLA 5D7IE 2OR9L 3WLWC 3VH8B 4ELMB 1FYTA 4MCYB 2QEJA 3TFKD 5J57B 1DVFB 2H1PH 3FQTB 3KG5A 4WWKA 5C0IA 2AV1B 2DJ4A 1CLYL 5L9DH 1DQML 1F58L 4KDTC 5LBSL 3F58H 3VXOB 4TYUA 5DD1L 4HV8B 2ESVD 5FCUH 1LNUB 4ELKA 4WEBH 4OFDA 4PR5B 2HFEA 1T0MB 3RIFK 1ZT1A 4ZODA 1LO2H 1MFEL 5HI4C 3SKMB 2C4FT 4HW6A 4XXDB 1DQLH 3C60C 3KPLA 1E6JH 5KOVC 4Y1AD 1MJ7H 1UXSA 4PGEA 3SCMA 1KPUB 4KKLC 5AZEL 2DQHL 3LAFA 2HJKB 3RTQB 2HTKC 4OGXL 5E08H 4Y7MA 1ED3A 4PJ8A 4MZ3A 1N2RB 2EXWD 4NYLB 1HDMB 4JFEB 4RISH 5JXAL 4I18C 2XRAL 4HIEB 3UMTA 1YYLH 3ZDZE 3RVVD 4OBRA 4X4YA 5KG9A 2XPGA 3QG6B 5F9WC 1I8IB 1YUHB 3T0XA 1NLBL 3ULVF 3VFNA 3G08A 4QRQB 5GGUA 3LQAL 5F1NA 2NW3A 1NCTA 5F72S 1UWEH 3IFNH 5DQ9A 4LEOB 3SOBL 4M00A 3QNYB 5EB9A 2GYSA 1OTTC 1D9KD 2FIKA 4IRJA 3RL2A 4HUMB 1HYRC 4RMVA 1AGDB 5B38A 5D5MB 5C0AE 3SDDB 1CVSC 4U1SA 4Y16A 2X09A 2CDFB 5IB4B 4YX2L 2WBWB 2W0FA 3UPAA 2HT2C 5KANI 4D8PA 5IM7B 4ELME 3AXLB 3PP4H 1NFIA 3OB0H 3MRGA 1EEQA 4K94L 4JGJA 4HK3N 4AM0B 1JHKH 5KS9B 4ZUUB 4MDJB 2LAAA 1DR9A 1J0YA 4HG4J 5DJCB 1JI2A 4GRLA 5TDNA 3GMRA 5KVEH 3G5VA 3P9LA 2E7CA 1WC7B 1BLNB 3HNVL 1T80A 1U95B 3RWJB 1EAJA 1OQOA 1HHJA 3DX9B 3QUZA 3CVHL 5GGRA 1BIIB 3S3JA 4P46B 3KNBB 3R0NA 3KYAA 4OZ4A 5FO7A 4Z18A 2QADD 1WSST 4ZFFB 4X80L 1OAKH 4KHXH 2EDJA 4YDLC 1RIVH 5FGBA 5HYFA 4MD4A 5GHWH 4JFXB 3DETD 1CFSA 4P9HH 4YAQA 4Q9RL 4M1CC 3G5ZB 1PGRB 4ODWB 4F9PA 1E4XL 2EYTA 5CJXA 4TPRL 3EHBD 2V9RA 3U36B 5C9JA 3B83A 4LRIC 4YQXH 5EU7C 3U7YH 1VDGA 1TQCC 1M7IB 1JPFA 5M94B 5CMAB 3WKMH 3MRQB 2FJHA 4Z7OE 1G6VK 4U6VL 3CC5B 4XC3L 4K9EH 3EJZD 2DYPB 1A6WL 1X44A 3OQ3B 2I26N 3BMWA 1MRCL 4LHUG 3RUGE 5A2IH 3C8DA 4TVPD 3C08H 3VI3F 2VKXA 4RAVB 1T0PB 4BSJA 3MLUH 3DECA 4GXUM 4GUPA 4JFDA 4NQCB 4RA0C 5IHLB 4MQXD 3REVA 1R24B 4M8QA 3MV8E 5IVXF 4GG6A 1MSPA 3HPJB 4E41A 5D2LE 4U49A 3EZ8A 3D39A 5DJ0A 4GAGL 4YFDB 1Z5LA 1X7QA 1A4KA 4CRPA 1YEEL 4JFOA 4X4MA 4M7KL 2BDNL 3CFBB 4ZS7H 3SJVD 3LKSB 1KEGH 1BIHA 3BUYA 3QIBD 4V2CB 2WWKT 4ZO8A 2FEDC 4KRPD 1LDPH 1CF8H 2ICEB 4FFYL 2VXUH 4JDZB 4JPIB 4X9BA 3VMPA 5F8QC 2EKSB 5F6IC 3MUHL 3D9AH 5I1KL 2FJFB 5JUEL 4KPHL 1OP9A 4XC1H 3GSNL 4Y5YC 3RWFB 3QUKA 2CJUL 3MR9B 4CDGC 5H35A 4DZ8A 3EO0A 4KVCH 3UTSA 1TQBB 2Y07L 1JRHL 3FCTA 3MYZA 3CFEB 5JIKA 4JG0H 3AFLA 4DN3L 5C08B 1ZA6B 4NFCA 3QIWA 5EBGA 1HSAB 3FN0L 1DQTA 1A0QL 1QTYT 5E00A 1OWWA 1ADQH 1P7HL 3BP5A 1LO4L 1C08B 5JA9A 2C1OB 4HPOH 1EZVY 2NY7L 4PJEF 1UZ6E 4U1JB 3CK0H 3Q2CA 1CR9L 1I1AC 2R69L 1KTLB 2VAAA 1REIA 1U6AL 4P3CH 1G7LB 3QQ9C 2DQIL 3BRFA 1KG0B 4JM4H 1KJMB 1P7QA 2WZPD 2XTJD 4JPKL 5EFIB 4R0LC 2GFBB 4D9QD 5FF6A 43C9B 3H9ZA 1HEZA 3RA7H 2BVUA 3L1OH 1LILA 2WW8A 3L5WB 1HCFX 1E28B 4S1DD 2E9JA 1KBGH 5JW5A 4QRSA 3JTSA 1FZOA 3ARSA 2AKRA 5D6CB 1AY1H 1GGCH 2GTZB 1MELA 4Y4HB 5I1DA 5IG7A 4G80A 5JPMB 1JVKA 1T04A 3P4NB 1OARH 4YJZL 2P5WB 3O8XD 1T7WA 1T89A 4POUB 4N90E 4L8BB 4FZ8L 2FB4L 2BFVH 2IADB 1Y6NR 3WEXB 3GMNB 5EU3A 3QDME 5CEXB 1Y0LB 5I1IL 1FZMA 4O2CB 2HT4D 2ZSVB 5DFTA 2XG4A 1U8OA 5CS7A 3MJ7B 4F7MA 2RAMA 3P77A 3O6FD 2IQ9H 2R1WA 3CU1A 1RJYB 1Q94B 2J6EA 3LRGA 3HR5B 1I8KA 5CBEA 3ZDXF 5ADPH 2NY6B 3BO8B 4PTUB 2EIZA 3WO4C 5C08E 3PL6C 2VDLH 4PJIF 3UJTH 4F7PB 5CSGA 3NFNB 3VD3A 1X5HA 1YMMA 5BZWB 4XH2A 5BRZA 1PY4A 5BQ7B 1FCCA 5F1SA 4HIJB 2P8LA 3VFOB 3ZYJA 1YEFL 1CICD 1QPXA 4WFHE 2V9TA 4UOJA 3EZJB 1CFVH 4Z7VB 2MOVA 2VE6A 1MCCA 1N64L 4XHJC 3MJ6A 3VW3H 2ATPA 5D71H 3VXUA 1P69B 1QSFE 4FFWD 3NABH 4EI5B 1GGBL 3EDFA 4GMTL 5KSUA 1FLRL 1BQLL 3IJSB 1EO7A 4Y5VA 3QJFB 4MJ6A 5E6ZA 3SE4A 5DEZA 4B7IA 5I9QC 5DJ6B 4K71C 2BVYA 3BWUC 2ZZUT 5K9OA 2JELH 4RIRB 3SBWA 2Y5EA 1GZQB 2FWOB 4ZFOA 5CLWA 1YN7B 3ZE1E 1QYGL 3QPQD 5F7DB 1IKFL 2YD1A 4U1IA 1VGKB 4YHIB 4Y4KB 1IBGL 2XY2A 3B9DA 1CGYA 3BIBX 1JFQH 2AW2A 4ZYKB 4HKJA 1HQRA 4M6NL 4OLYL 2Y36H 3GKWL 1A3LH 1FO0H 1HH6A 1IGIH 4HMEA 3TF7C 4L4TE 3CDCA 4GW4A 4J3XA 3LKRA 2BSTB 2KDGA 5GSVA 4R4FL 1PG7L 2BOBB 1U41A 4WHYH 3QUMH 4YFEA 1JGDA 1MJ8H 5EUOF 1CFNA 4HDIA 1LP9B 3L5IA 3IF1A 1KNOB 4J8RB 4G9FE 4UINH 1FZKA 1R3JB 2XN9B 3UC0L 3BGMB 1JNHB 2D4FA 1DUZA 5TPWH 5FV1L 3TNMA 2WNGA 5CCKL 4ZMAT 3QUXD 4WTWA 3PGCB 2G75B 2W9DL 1IL1B 1QLEL 1YQVL 3QWOA 5IK3B 1TCRB 3LEVL 1IC1A 1L0QA 5HHNB 1FFQA 1X4ZA 1CDYA 3D0VB 3DXAA 1HKLL 1RSFA 4HQQL 4NHCL 5IFAL 2R0WL 4KI5D 4EQ3A 3LPFA 2NY4D 3WJLC 1OLLA 4WO4D 1HQ4B 2O5YL 4NWTL 3GK8H 4Z7VE 4YHYB 4OLWL 1BAFH 1LE5B 1CDGA 2GJJA 3O11B 4KK9D 3BIKB 1MLBB 5JNYB 3IS1X 4JZJC 2JIXA 4FTVB 5I0ZA 2IAMA 3FZUC 3WIHH 3MRPB 1GC1L 4JANB 3BPLC 3RI5K 1YYMH 4FG6D 1VFMA 4UDTB 5DJXA 5T1KA 1LEIA 2LVCA 3S97C 2D31B 1YZZA 3KPSB 5EOCJ 4UV7L 1Q72L 3HZMB 4LEXH 4JN2A 1AJ7L 4NHUB 2I5YL 1WITA 3QDHA 4UILL 4JY5L 2O61B 3VRIA 1G7MB 4IRZH 3UPRB 3BOVA 3BZFB 3PHQB 3BW9A 4TNWK 4NM4H 4XP6H 1RURH 4WW2A 2HMIC 3LPGA 4J23A 5FM5M 4G9DB 1BBJB 3LZFL 3MCLL 2YA0A 4HH9A 5EWIH 5TQ0H 2XNAB 4JHAH 3TJEH 3RNKB 3L3DB 2X70A 2VDQH 1IM9B 3EOTL 4RMWA 4UDUB 2IJ0C 4FFZH 1JGLH 5J11C 1S3KH 3RZCA 4EUPA 3F12B 3T09A 1NMAL 1OM3H 5D1QA 1RIHH 1LP9E 4PY8J 4L29A 5CJOL 4X98A 2ZCHL 5ABDE 2P8PB 1OAQL 2AVGA 2BXZA 2XN9E 1C8PA 1M6OA 4QOKD 6FABH 3VXQA 1JJUA 3K2UL 1U8KB 3B2VL 1SM3L 4Z77A 3S37X 1II4E 2HRPH 3WXVL 5D7KD 1CLCA 4XXDA 4D9RE 4FNLH 1H15A 4OM1H 4YZFF 2GT9A 2H3NA 4R2GC 3QIUD 4UIKH 5IR1B 3MCG1 4ZAKD 3C6LB 2MPAH 5FO8A 2ATKB 4OKDA 2H8PA 1F6AB 4HWEL 5IMLA 2B0SL 1Z3GL 3KYKH 5CIPA 3ARZA 3Q1SL 3GMQA 5J12C 4BZ2L 2FGWL 3IXTB 4OF0A 2PO6A 1W72L 4GAFB 5F1IB 4RGOH 2H9GA 1I4FA 3ISWA 4NZTH 3WKNA 2K3TA 2BVPB 5E8OA 4PJHF 4HWBA 2BRRH 4KUZH 1LVEA 2I60L 1AGBA 3QDJD 1SMAA 2VH5L 1WWCA 2X05A 5L6YH 5J89A 2GUOB 4TOYH 1BD2B 3ILPA 1RU9H 5IMMB 5JHLH 3KLAB 3OTTA 4WWKC 5KN5B 2F19L 3ZKND 2EC8A 4P2QD 1J0JA 3H6JA 2VLMD 1VENA 4R3SA 5CILH 3VFWA 3KPQB 5FYJE 5T1LB 4D2NA 3MQIA 2O5XL 4PS4L 4M43H 4UT7L 2WANA 3UROR 3LY6A 1OP3H 5F89B 5F97E 5HHQB 5GQBA 3U4BL 3BYTA 1U8NA 5IESH 4K3JH 4MSWA 4OLUH 3IFPB 3CFDB 1BFOB 4QHKI 3ZSTA 4LHUB 3SCMC 4JO2H 5GS0C 4OD1L 1VSCA 4RWHA 5I75C 3ZKXC 4GAYA 3UAJC 4CVXB 1DN0B 5E2WH 2N7BA 3RUGA 4M61B 3D2UD 3RWCA 3HC3H 3HE7A 2M1KA 1I7ZB 1R5VB 4PJ8C 5KOMC 3MV8A 2NY3D 3D0LA 1J1XH 2X5PA 1MFCL 5D2LA 3S34H 4R7NA 5CWSB 3PWPE 3MLZL 1I3RA 2AJSL 3ALPA 4H0IA 5E2VH 5I76A 1FNGA 2Q3ZA 5I6XB 3IJYA 4KKAC 2R23B 2VDPL 1BOGB 5DEGB 5KVDH 1EHNA 3VD7A 1N0XL 2HLFC 1OTUD 1U8PB 4Z0BH 1NCCL 3ARDD 1QHOA 1GZPB 1U95A 2PW2A 2HWZH 4X7SL 1JZ2A 5IW6B 5T1DH 1MHCB 4O2FA 4JR9L 5C09A 1CT8B 4QHNA 5A40E 4PJXE 2CIIA 3MGTB 3SY0A 5FK9B 1XH3A 2AJYH 3P30L 5B4MD 4IRJC 4P46A 4Z8FH 4YNYB 4IOFD 3NMEA 4U1LB 4RMSA 4GS7B 4Q9QH 4Z7NF 4XBGA 1NMBL 2C3GA 3KLDA 4U6XB 4XAWL 4Y16C 1X6LA 4PJFB 4MJ4A 2VLRA 3JUYA 3R06A 3FO2A 2NXYD 1BD2E 2X1PA 4NQXA 3ECBA 1WAAF 5DHXB 1FLTX 5E4EB 1EO8L 1SEQH 5HI5C 1NAMH 4TQEL 3CVIL 5CP7B 2ZUWA 1NANI 1N3NB 3VG9C 2HFFB 4K3HA 2VDMH 1INDL 1MI5B 1P4IL 1SY6L 1SBSL 4GRLC 1YY9C 4LPCA 1OTSD 1T7VA 3BE1L 2FEEL 3VGDA 3SQOL 4G43B 5EO9A 1YEHH 4KXZH 2K1MA 2JTDA 4WHDA 4OCRL 1P2CB 1KJ2A 3H3KA 5ERWA 4HEPG 1DBJH 1TETH 3PWLA 3CJJA 3V79C 3QUZC 1AFVL 4RNRB 3KJ6H 3F7VA 4K7FB 2GKIA 5DVNA 3U0TA 4X9IA 3P0VH 3CSPA 4R8WH 4HLZH 1I3UA 4AY0A 1EFXD 4MCZB 1A6ZB 1EERB 4YGAB 3S35H 3FTGB 1C5BL 2V5SA 4X5WB 4PBWD 1P9MA 2EXYD 3N9GL 5FGBC 3C5ZA 4R4NC 4KZEL 3KAAA 3BKYH 1ACYL 3QDMA 1PVHA 4GRWB 3IDNB 5TGBA 4HLJA 2QSCL 1JWSA 2XZCH 4MXVE 4PJ7B 4PJAF 5L0QC 1W0WB 4ZOAA 4F9PC 4HZLA 4G8FA 5CJXC 5AD0B 5DJ2A 4YXKH 3RKPA 1CDUA 5ICYB 4J4PD 4KJYB 1ES0A 5HVFB 1SVCP 3FB6A 2R1YB 1U0QA 2VB5A 1IMHC 1XF3B 1L7TH 1FE8H 3EIFA 3L5JA 1X9QA 2BP3A 2CLZA 4XVUC 3BISA 3DO7B 4YUEL 1VACB 1FBIL 1C08A 4HMCA 4PRPA 1R5WA 3PDOB 3N1MC 3O2DL 4ETQA 3HPLB 3F5WB 3QZWB 1KTLA 1NCAH 4OQTL 4GQ9L 3MV9D 2F9BT 4PREA 5FA4A 7FABH 4X8XA 2WBKA 4JFFB 1QSFA 3VGEA 4QRPD 1A1NA 2FZ3A 2YC1A 4APQA 3P73A 4OAWB 5AUMB 1DLHB 5BXFB 4Z7QF 3MJ8B 4M7JL 4OLXH 4B5EA 1HYSC 2LVEA 5F88B 4O58L 5DRNA 1SJXA 2QV2A 4G6KH 3MGAA 1FC2D 3E8UH 2Z31B 4NBYB 5IW1B 4XPTH 5F9OH 3LKPB 5ACZB 2ZCLL 4X6BA 3QQ4A 2OZ4A 4PJGF 3O41A 2N1KA 1PW3A 5CZXD 2E9WA 2D03L 3QXVA 5LKNA 2XFXA 3MGOA 5D7IF 5KSBB 3L3GA 1A7NL 3QCTH 3RVUC 1INEH 4GKNA 1E0OB 3QIWC 1LK2B 3SDXF 3Q3GB 1EVTC 1ZWIB 2R9HC 4L4TA 3UDWA 3F7YB 3PABB 4JB9H 2RCSL 1AD9A 5MEQA 5ESQA 1KPRB 5HPMA 2WSKA 2XACC 1X5AA 3WDJA 1CL7L 1QR1B 4NQVB 4IDJH 4G9FA 2B5IB 3NFSL 1AR1C 2W91A 3ULUE 4D94A 4HKBB 3ZKMC 3QDGB 1JP5A 3QA3A 4UIMA 3HRPA 2E3VA 1JZ5A 1ZLUK 4NZRL 3S96B 1HI6B 4JHWL 5EZIH 4RFOL 2B2XL 3MNZA 4NWUL 5D9SB 3V4VH 3O6MH 3H9SB 1QSZA 3NIFF 1T03H 3KXFA 1RFDH 3U2SB 2WUCH 5ICZB 4PLOB 4RDQG 1MJJB 2X89A 1WCBB 1CK0H 1IQWL 4KJQD 1T89C 1Z9LA 2AXGB 4UT9H 1V5JA 3QB7C 3LVEA 4TVPL 1NUDA 3QSKB 5EC2B 4MAUL 5D7JB 5ALCL 4NRYB 1WWBX 3WN5B 4KHTH 3STLB 1V05A 5C07A 2H1PL 1EZVX 5JW4N 4L8DA 4PRIB 4Z7WA 5L9DL 1JPSH 4XMLH 3F58L 3JV6B 4ODHH 5FCUL 1T66C 5DJ6A 4WEBL 3T65A 1DTUA 5J6HB 1MVFA 1LO2L 2Z0BA 4BUGA 5H8DA 2FWOA 1A9BA 2BNQB 2EH8H 3OKOB 2YA1A 3F7QA 3T2OA 1KYOK 1DQLL 1E6JL 3MBEB 1SJEA 5IIEA 1MJ7L 3K2MC 4JQIH 3W9DB 2FJGA 1NGQH 4KAQH 3WJJA 1S5HA 3HG1D 4X9GA 4GOSA 4XI5C 2WP3T 3QXDB 2F54E 4LBEB 5KSBE 2OR8A 3W11D 5HHOD 3NA9H 4ELMF 2CMRL 3MV7B 1X5XA 5E08L 3AB0B 3SDAD 3V4PH 1CBVH 2NY2B 5FO9A 4RISL 4RGNC 4X7CC 5HHMD 1YYLL 1U8HA 4FP8H 4YXHH 1S78D 3GJEB 5BJTA 2VZ3A 5AZ2H 5HVWA 5D1XA 3EOBB 5F3HB 1NEZG 4QNPF 1R3JA 4BA8A 2QHLA 3GIZH 2Z91B 3MCKB 3RPKA 5CD5C 2LU3A 2NR6D 3MRRB 4PG2A 3QDGE 4Y2DD 1P53A 4LVNB 2X1QA 3TPKA 2VIRB 1XIWB 2G75A 3SE4C 3GSXB 3T0ED 3IJHB 4OZFH 4NRXA 1UWEL 3IFNL 5FKAB 2IH3B 3P3YA 3SBWC 4JFHE 3UTTB 2BZDA 2UWEB 5BVPH 2VQTA 2ZG1A 4WUUD 5EZLA 2R2EB 3RWIA 2PXYB 3BHBB 5F7FA 5B3JF 4ODUB 2FR4B 1JWMB 2D9QB 4WI7A 3BZ4A 1UB5B 4DW2H 2C3XA 4PJ9B 5IVZB 1MPAH 1FFNB 3V6OA 1G7IA 3WFEH 4HMDA 4GMSH 3CD4A 3CFJB 3HS0B 4H26A 4L4JA 2H2PC 3BIKA 5BW7A 3PP4L 4MJIB 5I74C 3KPOB 4OUUB 1Q9WB 1R3LB 4PRIE 5SWZE 1JYNA 1JHKL 3IDIA 3GMPA 4HS6B 2R2BB 1GOHA 1OB1A 3CMOH 4Z7OF 1T1YA 4OV5A 5CJ8A 4Z5RA 5EULV 1I9EA 3S98A 2BNQE 5KVEL 1AGCA 2VQ1B 1SYVB 1K3ZA 2YMXH 5D5MF 3H3PH 2GEEA 1MCWW 4XNMA 3LKNA 5EO0A 5DJYA 1NC4D 4G9DA 4P57A 5C70A 4V1DE 3UXFA 1GCFA 3V6ZA 4WCYH 1JUFA 4KKBD 1F8TH 2X42A 5KS9F 1QQDA 2KZWA 4LAQH 1KJVB 1OAKL 4KHXL 4BELD 2XWJA 1P4LA 1RIVL 2B39A 4Z78B 2YBRA 4FN0A 3VGGA 1H3VA 4S1QH 3AY4A 3ETBF 5GHWL 5DQJA 4P9HL 3BIAX 2YPLA 4NN6B 1CDIA 2YD9A 3FFCB 3SEPA 4HIIA 3ZT7A 2X41A 3S88H 3PWPA 1DJSA 3BGAA 3C5JA 1U3ZA 2D7TH 4JY4B 3LRSB 1J0HA 2MQ3A 1YEGH 2NY5C 3SPVB 5EU6D 3TNNA 1YEKH 4WNQA 4YQXL 3LDBC 2CKBB 3U7YL 1OF2A 2FNBA 3WKML 5IR1A 4MD5B 2XY1A 4BQ9A 1NGWA 4FQCH 4QT5B 3FB8B 4K9EL 4YDIH 4PJXA 1T7XA 4J3SA 4WW2C 3ROOA 5HYSG 3LIZH 3C08L 4HXBH 3I6LE 4W6WB 1V7MH 1C7TA 3HI6H 4JLRB 2VWEE 3MLUL 3PV6B 4CJ0A 3MV01 1IQDB 1IARB 1U58B 1YDPB 4X8JB 3V5HB 3B9KB 3FO1B 1TCMA 1ZHBA 4MJIE 4I3GA 5LCVH 5I17B 2FIRT 3RX7A 3VRJA 5D1QC 1CE6B 3BGFB 4J6RH 4ZS7L 5BS0D 1KEGL 2QQLH 2NW2B 1RPQA 3FRUA 1LDPL 1CF8L 3WNMA 3BN9C 3B2UD 2VXUL 1A1MB 3X13A 3Q5OA 3ZMRA 3D9AL 4HH8A 3H0TA 3OF6D 3LSOB 4XC1L 1HE7A 2AK1H 3PWVA 1CFTA 3V95A 1UZ8B 4C83B 1B9ZA 3WLBB 5L2KB 4KVCL 2CO6B 1MF2H 3MYJB 4JG0L 3DRTB 4WFGE 1SYSB 1K5NA 4P59H 5DDHA 5KBNC 1ADQL 2PO6C 3MA7B 4RGMC 4HPOL 1IGMH 4UUJA 3CK0L 3KPNB 5I30H 3MSPA 5FOBA 1HHKB 2DQFB 4P3CL 3WHXA 4MX7B 3SQBA 1T1ZB 2X9WA 1CGWA 4L3ED 2VDOH 4JM4L 1ZXQA 4KGJA 4NQDB 1XGTB 5CSZA 3QFDA 4P2RE 5C3LD 3R1GH 2EEBA 4TTDD 3LS5H 5CEZE 5A3ID 3A67H 5D1ZA 2FO1A 3RA7L 3MRHB 3L1OL 4FZEH 5TH2A 5CBAA 5GS2H 3UTZA 2D7OA 2HVKB 1KBGL 2ERJB 3GMLB 4OZGB 5K93A 4ONHB 4HFWA 2KPNA 1AY1L 1GGCL 1RV6X 4NZDA 1UB6A 3HMWH 4F3FB 3FO9B 4I0PB 4P4KB 2CDEA 3DMMD 3GJFA 3EYOB 25C8H 1OARL 1S7VB 3EO1A 15C8H 1MWAA 2F8XC 5KVGH 3M45A 3BAEH 1P6FA 4HJ0C 3O4LA 2BFVL 3VFGH 3GSWA 2A6DA 4W6YB 4P5TD 3VFUA 3HE7C 3VE0B 5C0GB 3AROA 1NCNA 3MO1B 2I25N 2CIKB 1I8MA 4P2OA 4PJHA 1VFOA 2E6QA 2F74B 2Z4QB 4KU1A 3TCXA 3WNOA 2HFFA 4BSWB 1F5WA 2DICA 2NMSA 5EUKA 4M7LH 4S10A 4TUJB 3VDCA 1K8IA 3ET9F 3LN5B 1DQQB 4HC1H 4OFVA 2I9LB 1NFDB 2G2RB 1F4YH 1D5MA 3PWUB 1U92B 5ADPL 2EIEA 3RL1A 2BY2A 3LKQB 4LLYB 5JORA 2VDLL 3FHQA 3UJTL 1BP3B 4YIQA 5DVKA 1DBKH 3EYVA 3MRNB 4P46C 1Q9LA 3TVMD 1KCLA 4JM2A 1D7FA 4JHZA 5IWLA 3FQWA 1BX2A 4OF7A 1CFVL 4JKMA 4IJ3C 1UCBH 3MRBA 5C0BA 3VW3L 1Z6JT 3TBVB 4L9LA 3C8KA 5MEND 5D71L 1T20B 3LQZA 1A9EB 3ARFB 3NABL 2GCYA 1ZANH 5F7NC 4GLRH 5JOPE 3C9NB 2NXZD 4YEFA 1HXYB 2J3SA 4F8QA 1X4YA 4HS3B 1JF1A 2ARJB 1FORH 1MIEH 2JELL 4OZGE 1F4XH 3EYSH 3ULVH 2VNCA 3DX6B 1CQKA 1OAZH 5FYKH 4MAYD 3BPOC 1G6RH 4RFNC 4K2UH 4F7TA 2DS4A 3S4SA 4MA1C 3ME0A 1BVLB 4U1GB 3RZCD 4KK5D 3DO7A 1JFQL 4N8CH 4GQPH 2Y36L 2AQ2A 2AJXH 1A3LL 1FO0L 3LB6C 1IGIL 1OGTA 5ISZA 3FQNB 3BSZL 5AYUH 4XZUA 2V7HA 3QCVH 3P4OB 3QUML 1T4KB 5JHDB 1C5DA 1TJIH 1EEZB 1MJ8L 4WU7B 1P9MC 1DEDA 3C5ZC 1DP0A 1FG2A 2ICWA 4UINL 3U48A 3CUPB 3IXAA 4IOIA 3N0PB 4EQ2A 5HGAA 3DTXB 4LLVB 1IAKB 2F53B 1G0YR 2BSSB 1NFDE 4F2MB 3PP3K 3C09C 3TJHD 1O7SA 4LLUB 3CFIC 1XR8B 1QPPA 3OSKA 5D70H 1E4XI 1G9EA 1IEBB 3CFCH 1Y6KR 3CVHA 4XBEH 1TQBC 4PJ5D 4K3EH 5T3ZH 5CHNA 2D0GA 1PFCA 2F54A 4I48B 2FECL 1FDLH 3ZDYE 3O45B 5TDOB 1LP9F 3GK8L 3FL7A 4X6DB 3D85A 1ORSB 5SWSB 1BAFL 4G5ZH 3X14A 3WIFB 3ZTJG 2DQCH 3JV4A 2ADGB 4LCYB 4MQSB 5IBTL 1NEZB 5E1AB 4YH6A 1GGUA 3TYGH 1U93A 1BWMA 2BK8A 1YYML 1XFPA 5ID1B 4XPFH 2Y25A 4CDHA 5GS2D 2Q76A 4APQC 4L4VE 4NUJB 3CGTA 2P8MA 4PRBB 1K6QH 5CEYB 4LEXL 3LN4B 3MROB 3C5SA 4OCYH 5E6IA 1JGEB 4L3CB 2PYEA 4IRZL 4PJDA 1T1XB 3HAEA 1KXTB 2JE8A 1FZJA 4NM4L 4XP6L 1RURL 2VLJB 4TULH 3STBA 4E42B 3U4EA 3I3EA 5EWIL 5TQ0L 4BH7A 2J8UF 4JHAL 2QQKH 3QI9D 3TJEL 3O4OB 2VDQL 1EJOH 4XWOD 1C1EH 4P5MA 5TDPA 1N5YH 4FFZL 5HGBB 2EYRA 1JGLL 4G8GA 4QRTA 4PTTB 3MNVB 5C0JA 5I71C 1MUJA 1JRHI 1S3KL 3DO3A 4H1LG 3ILQC 4OT1H 3GBNH 5DMJB 1OM3L 1RIHL 2NY1D 5TE4H 5C8JB 3UDWC 5E0QA 4D9LH 4GT7A 2MCPH 1XEDA 5SWZA 1HN1A 4G8IB 6FABL 3I6GA 5LQBH 2R2HB 5HYJE 2ZUYA 2HN7A 5HXMA 3WL9B 4FQ1H 3T0AA 3V0VA 2F53E 2J8OA 1G0DA 1KB5B 3G6DH 1YC8A 2HRPL 2DI9A 2VLKD 3CXDH 4EI6A 3QEHA 5F8RC 1IE5A 4YPGB 4FNLL 3GSNA 4OM1L 4MDIB 4TUOB 4AMKH 4UIKL 2ZUXA 2FDBP 2MPAL 1T2QH 2UVEA 3VD9A 4F80A 1J05A 3KYKL 1CGVA 4V1DA 3BP7A 1T0NB 3F6LA 4IM8A 5C3TA 3CSYA 1JHTB 4NQED 3IDGB 3U1SH 3OAUH 4RGOL 1M05A 3OJVC 3C6SA 5SWSE 2NZ9C 3MLSH 2BRRL 2I27N 1FVEA 4KUZL 5HDLA 1XF4B 4RFEB 2K9UA 1ZA3B 3H8NA 1MCJA 4WTZG 4Z6AT 3QPXH 1J0ZA 5IVOA 5L6YL 3GO1H 4GBXB 4K07A 4NQSB 4X0KB 3FFDA 43CAB 1M7XA 4P4RB 1C7SA 1RU9L 4QY8B 3IDXH 1LEKB 1ZK9A 5LAXA 5JHLL 2EDDA 3KYNB 4PY8I 1GJIA 3AS3A 3VWKA 5ENWA 4TTGA 3UCRA 1AD0B 2ESVE 3ULVD 1XZ0B 4YHNA 3TN0B 2OL3B 5CILL 5DMGC 1S9XB 1A7OH 4XPHH 5FYKD 1T1WA 4M43L 1A3QA 1A8JH 3A6OA 2GJZB 3EGSA 1UJ3B 3M17B 2VLJE 1AQDA 1B88A 1L9MA 4K3JL 5IESL 4KFZC 4OLUL 1RAMA 4PJCE 2OXHA 3TM6A 2I07B 2R8SL 4L8CB 4M8VA 5SX4I 4JO2L 4P3DA 3WJJC 4LSRH 4BQ8A 3K0WA 4JKPH 3ESVF 5E2WL 4X6CF 2DTMH 4HUUA 5FUZH 3TT3H 4LPTA 3VFSA 3HC3L 8FABB 4EKXA 1TENA 1GAFH 3PWNB 1H0DA 4MQ7B 4KUCF 3SDCA 1J1XL 4B53A 1PG7X 3S34L 5LGJA 1KIRA 2G60H 3UBXI 5AG9A 4F7CA 3HB3C 2XKNA 5E2VL 5D1XC 3B3IA 5DR5H 3C2SA 5MI0C 4LGSB 5KVDL 1JCKA 1FVCA 1NBVH 4PG2C 1KLFA 1W8OA 5J1AA 1BFVH 3PHOB 4Z0BL 1AGEA 1RZJH 1FN4B 1S9VA 1SEBA 2HWZL 3ZHDA 4C4KT 1IAIH 4WI3A 1A6PA 1OGAA 5T1DL 5T3ZD 1DSFH 5AG8A 1DFBH 4LCWB 2AJYL 5E8EB 3JTTB 4Z8FL 3UBXA 3TA3B 4Q9QL 3OJMB 1EUUA 5IQ7H 3V6OC 4D0CB 3ZL4H 5E8NB 1G1CA 4HUWB 3HUJA 4GFTB 4ZXBD 3O3AB 4QWWC 3FMGH 1V3MA 5BW7C 2A1WH 4LCIH 3I6KA 1A6UH 4WUKH 4NNXB 4OF3A 1YJDH 3IS0X 2EZ0C 4WHYG 1GSMA 2Y6SD 1NAML 4E0RA 4XGZA 4NKQB 1XGQB 4OJFH 2OMBA 4P2RA 3C60B 2H6PA 2VDML 3QCUH 3X3FH 2EE6A 2Z93A 4KRPB 5IB1B 2GJ6B 5BV7H 3ELAT 4MXQD 5E1HB 4UNVA 2DMKA 1YEHL 3FQUA 4QT5A 3ES6A 4PJFF 3E3QC 4IMLB 5F9AC 3HZKB 3OKMA 1DBJL 2F58H 1TETL 3B4NA 4OFYA 1GHFH 1FIGH 1RUMH 3ARGD 4NNPH 3OJDA 4I18B 1AP2A 3KJ6L 5DSCA 3P0VL 4R8WL 5IF0A 1PEWA 5F9WB 1V8HA 3VRLF 4UQ2A 3S35L 3BP6A 4LSUH 3O3BB 1KV3A 3T3MF 4UOW0 2OQJB 3AY4C 1UH3A 1V3KA 3A6BH 3BKYL 1MY5A 4BM7A 3U9UA 1G7PA 1EEYB 4HUNB 3CLFH 2XZCL 1E4WH 4I9WE 5C0FB 5INCB 5DJAA 1ORQA 2XYCA 4CMMA 3STZA 3HTLX 5SWQA 3TYFA 1XGUA 4WJ5A 4YXKL 1YNTB 5E8PB 1ZLWH 1NL0H 4H8WH 4EOWH 1F11B 4MVBD 1S7XA 3FB5A 1NC2D 3GSUA 3I9GH 1K8DB 3FT4A 3DX7A 5E9DD 3RWGB 5IMOA 1VEOA 4LPYA 1K4CA 1L7TL 1T2XA 4LQFH 1YMHB 4J3VA 4KROD 1FE8L 3HHRB 2DQTH 4JQXA 2VN7A 4LLDA 4XCCH 4YHPA 1UT9A 4EN3D 1I1YB 4GRWF 4J1UA 4TVPE 5EU4B 5JZ7C 4R4BB 1J8HD 1TFHA 5DRWA 3DV6B 3IKCB 4PJ7F 1NCAL 3IVKA 2X2YA 4YDJB 3ULUF 7FABL 2AV7B 4LVOC 1ZHKB 4Y19B 1WFNA 3OKKB 2D0FA 3O3DA 2X40A 3NZHH 3DNKA 1KPVB 2EO9A 4YHKH 3SJVE 4LARH 1N4XH 1FH5H 1DN2A 5F70A 2I9TB 4OLXL 3CFKA 4G6KL 5SX5H 3DROA 1IC5H 1FFPB 3E8UL 2HVKA 3MUZ1 3OGOE 4MGXA 4YLQT 4XPTL 5F9OL 1VESA 2PR4H 3RRQA 2AQ3A 4PRHB 1CLOH 4FQHB 3DGGA 3PGFH 3NH7H 5L8KB 2L0DA 4OIIH 2B1AH 5E2JA 2ADIA 4BFIB 2DQDH 1O5DT 3QT2A 4YDLB 5I15H 3FZUD 3QCTL 4AJ0A 2JJUA 1INEL 3BMVA 4X7TB 1P84J 5SV4A 4UMGA 4ZTPH 4M6MH 5MEOB 4NO0B 4C56A 5IV2B 1VEMA 2W0LA 4JB9L 4HG4K 1CICB 2MMXA 4S0TD 1KTDA 5KSAA 4JO3H 1NBYA 4Z95H 4LIQE 4YR6A 3B6SB 4EXKA 3F7RA 4IDJL 3RNQA 2XTJE 1LE9B 3DYOA 3ZYIA 5JA8B 1I7TA 4U1MB 4D9QE 5D1ZC 5EZJA 3VXSB 3H9HA 3RWDB 3EYFA 1NFDA 5KSBF 5EZIL 3CX5J 3QEQA 2JJVA 3L3HA 3LKQA 5JQ6H 4YDVB 3RIAF 3V4VL 3O6ML 2Z35B 1T03L 3OMZA 4U7KA 3BZDA 1V3LA 5J1TC 2ENSA 1FG9C 3NGBC 1RFDL 3QXTA 2DDQH 2WUCL 1W72A 4TNVF 2PTVA 3O2WH 1CK0L 3ARTA 1NBQA 4UT9L 1VADA 3HCVA 5DK2A 2HJLA 2CD0A 3RJDA 5E03A 1K2DA 1ZGLB 4G42B 3MRDB 2XZAH 4PGCA 1IAOA 4KHTL 1T20A 4Y19E 3GSVA 3ULSB 1IEAB 3FQRA 4Y4FD 5FDWB 3QQNA 4DKEH 2PYFB 4KTDH 5F6IB 4CNIA 3MMEB 3EJYD 1JPSL 5E4EC 4XMLL 3SKNA 4ODHL 4N0RA 1UWGH 3GM0A 4P2OC 5A2FA 5D4QA 4Y5YB 1FV1B 4L4VA 5FUCE 1TVBA 2H32B 2CPCA 2MJWA 2RGSA 5TFSH 5KZCD 2EH8L 5DA0B 1KULA 3TCLB 2BNUB 3VDAA 3D3VD 4Q7DA 1JPST 3AREA 4JQIL 4OGAD 1EVUA 1NGQL 1EHAA 1QZ1A 4IRSD 4KAQL 3WD5H 2BHUA 3G5XA 2DLEA 3NA9L 3W81A 5D7LB 4H0GA 3VA6A 2D9CA 4WHCA 5GISH 1TPXC 1I1AB 4QTHB 4H1LB 3V4PL 1CBVL 1G9NH 2LFGA 1PQZA 1OAYH 4JM2C 4NCC1 4LLMA 5IWLC 4QF1B 4YO0B 5E94B 4FP8L 1JTOA 1TZHB 3GDBA 4YXHL 4R0LB 5I1AA 5AZ2L 5KSVB 1S7SA 4C55A 4L9LC 4H5SB 5DUBA 4KY1H 3IU3A 3GIZL 5JXEA 5HYJA 3P4MB 3TIEB 2X4NB 2X7LB 3TH4T 2EDTA 3HNTH 4UTAH 2BSSA 3LQAC 3BD5A 1HOCA 4Z76A 1FGNH 1ZLUH 1ZS8A 3VXRA 3EBAA 1YPZE 5ECJE 2PETA 3MLVH 5BVPL 2HKHH 2D7MA 4P23D 1UM6H 1OVZA 4DW2L 3L7FB 1FL3A 2XWTB 5JLZA 1MPAL 2A6IA 1UYWH 1AI1H 3WFEL 1CS6A 4GMSL 5DI8A 4X4XA 4KVNH 3UTQA 3MLWH 4HLZG 1HHGA 5CUSH 5E1AA 1CFQA 3G04B 1RZ8B 1BF8A 4K94C 4PV8A 2G9HA 5I19H 2FD6H 4M3JA 5I73C 1ZEAH 2UWEF 4NDMB 5HGHB 3Q6FB 3IAGC 3CMOL 4ZDHA 4J2XA 1SY6A 1IFHH 1MH5A 1X5IA 2ESVA 3L7EB 3E6FA 2P5ED 4LU5H 1U8LA 3X12A 3WO4B 2YMXL 5T5FH 3H3PL 3PL6B 3TO4D 4A6YH 3GIVA 3FJTA 1RUPH 4NSKA 1V7NH 4XCEA 4Y1AA 1EEUA 2YZ8A 4M5YH 3QH3B 4PJCA 5FGCB 2P7TB 1PYWA 1OL0A 2C3VA 4WCYL 1QRND 5FV2A 4MS8D 2VXSH 4XPBH 2YD3A 1F8TL 4X6EA 3H7BB 5IJVB 4GKSA 4LAQL 4DVRH 3QXAA 4NO2B 4S1QL 1L6XA 2R0ZH 4RQQB 2XXCB 4H0HB 2ZUSA 4ZTOH 5I9QB 4KK8C 4G8IA 3S88L 4N5ED 3T4YA 2D7TL 8CGTA 5IKCB 5DHVB 3UZQA 3IRZA 3RGVD 2MQ0A 5I66B 1YEGL 3OGCB 1F4HA 4LOUD 1YEKL 4I4WB 4S1RH 3BDBA 4NKOA 3MBXH 5GRUH 4NRZB 3BKMH 1S9WA 3OKEB 3JBG7 5E6IC 1QSED 4FQCL 2W0PA 4NNYA 5BVJA 5JDSA 1XCQB 2A0LD 2WWMC 5A2JH 4JRXB 4YDIL 4WU5B 1D9KA 3B9VA 3V0WH 2H26B 3WS3B 1ZT4A 3LIZL 4HXBL 5EIVA 2NY0D 1V7ML 4JN1H 3DARA 5E2UH 3HI6L 5FECA 2PTUA 3VXMB 1HHHA 5DD3H 1XGPA 4QHLA 4F7EA 1EMTH 4ZS6D 3SGDI 5I2IA 4LLWA 2KL6A 4TNVK 2V2WB 2CK2A 2YXMA 1A6TB 2X4OA 4P4RA 4J6RL 1VFBB 4JJHA 2RFXA 2QQLL 4LSTH 5H2BA 4QOKE 1LD9A 1I1RA 2Q1EA 5MEPA 2BMKB 3OXSB 3U83A 1VKXB 4IDLA 4DZBB 4EVNB 4QO1A 4JQVA 5ADOH 1WBZB 4GW5A 3RDTD 4GW1A 5HGDB 4BH8B 4ZUSA 1WT5A 1N26A 4QYOA 3BEWB 4X9FA 1SJHB 2UUDK 3QUYD 4IS6A 3VWJD 1FAIH 1S7UA 1CL7I 2AK1L 3T0DA 4HGKC 5HYSA 4KJWD 4LKXA 1I1FB 4L8CA 3BDXA 1N8ZB 4NC1C 1MF2L 1F3RB 3BQUA 5ITFA 5EU5B 3TZVD 4P59L 3BWAA 1WJ3A 3KLHD 4JZJB 5KW9H 3PQYD 4UAOC 4XRCA 1IGML 2PCPA 2VZVA 3T77B 5I30L 5EN2B 3K7UA 2E27H 3W0WB 1HXMB 2IPKB 3IU4H 2J8UA 4O2EA 1DUYA 3GBMH 5CZVH 4K3GA 2WBJD 3V7AG 3VFMA 2EDWA 2VDOL 5HSFA 1T22A 3QEUA 3MRFB 1X5FA 5K59E 1A3RH 3R1GL 5C0CB 3LS5L 4QRRB 2BNRB 3A67L 5DRXA 3ARBD 3VWKC 4FZEL 1OP5H 3PHOA 4KQ4H 2VSCA 2EDOA 5K9JH 4DCQA 3GB7A 1Q9OA 2N7AA 4FQXD 1I9IH 3HMWL 4ZPTA 2IH1A 4PGBB 4DAGH 1KLUA 5F44A 2FBOJ 5J11B 1U91A 25C8L 5D72H 4FMKA 15C8L 1ONQB 3HC4H 4JPVH 4OZHB 5KVGL 3BAEL 5IW3A 5EIIA 4G6FD 2VDKH 3VFGL 2NX5D 5A16B 3NIGE 2DM2A 2VWEC 1C12A 2LE9A 3CPLA 1JV5A 2HG5A 4Q74A 4AEIH 3SDCC 3KYOA 4ZFZA 5IFJA 1J88A 1ITCA 5HDBE 2BSRA 4OZGF 2DL9A 5DVMA 4PGJA 1TTUA 3DVIA 3PJSB 1EUTA 3PGDA 3X3GH 3SJVA 3VFTA 3QIBA 4M7LL 5FIEA 2VLLA 4R2GB 3DRQA 5IB1A 4FXKB 4HC1L 3KPRD 1JZ8A 5LJYH 4KGLA 1FHGA 4MA7H 4XP9H 1YN6B 1F4YL 1MVUB 4RMQA 2ITDB 5J12B 1NBZA 5JW4Q 3IB4A 2DWEB 1V3JA 1TNMA 4RWYH 2GAZA 1KCRH 4GSDH 1M7DA 1KXQE 4XP4H 1DBKL 2CLRB 1T5XA 5GGVY 4MD0A 1AKJB 1I7RA 3T04D 4ONOA 5HD8C 3NTCH 2VR5A 4KJPD 4LK4A 5AWNH 4U4BA 1FYTB 3W0WE 5C71A 1UCBL 4WWKB 4LCUA 4ALAH 1ZGLM 2GSIA 4X6CA 1S7WA 1U3YA 4W81A 4ENEC 3MV9B 4ELKB 1ZANL 2CRYA 5C0CE 2HFEB 3U9PH 2BNRE 1ZT1B 1CXIA 1DDHA 2J2ZA 4JVUA 4XVJH 4DUVA 1F13A 1YNTA 2W65A 5CP3H 5DUMH 3KPLB 1MIEL 1FORL 1UXSB 4PGEB 3SCMB 1F4XL 1GYAA 3EYSL 4G6AC 2L7UA 3ULVL 3QFJD 1K8DA 2X4TA 5I75B 1OAZL 2BCKA 3ZKXB 3ZDYF 1GGIH 1FL5A 4KRLB 5HYEA 5FYKL 5I16A 1S7RA 1U2CA 1G6RL 4G8GD 3VXNA 4K2UL 1D5IH 2Q7NA 4AZ8A 1ED3B 4PJ8B 4N8CL 1GGTA 1I1YA 3UYOD 2AEPH 2AJXL 3O8XA 4O4YH 5F1KC 3ZLQC 4X4YB 5KG9B 2XPGB 5AYUL 1BWWA 4G6JH 3FOMA 3QCVL 3G6AA 4UBDD 5HJ3A 1TJIL 2P45B 2IAND 5DO2C 1BQHA 3NACH 3VFNB 1R3HA 1GRWA 5GGUB 3D5OF 1JI1A 1XT5A 5F1NB 2NW3B 4NQTA 5I18H 5DQ9B 4BZ1H 5DJ8A 1VPOH 3WSQH 4DOHE 2EE3A 3O6FA 5CJQH 2FIKB 4IRJB 3RL2B 5D70L 5HVGB 3EFFA 1IVLA 4PJBA 3HE6D 1AR2A 3CFCL 3RKDC 5B38B 2AK4D 4XBEL 2XV6B 4K3EL 2XA8H 4U1SB 5T3ZL 4Y16B 4QXTA 5C0EA 3RBGA 1FDLL 2J5LC 5IQ9B 1A14H 4JQXC 2W0FB 4V2BA 4PGDA 1JGUH 4D8PB 3PXHA 5IV2A 5IFHL 4DWHA 1C16A 1NFIB 4G5ZL 4OLVH 2DQCL 3MRGB 4EUPG 3UTPE 1DQJA 3G5YA 2A6KA 3VG9B 3TYGL 3MV9E 3TBWA 3T3PE 1MHEA 1QLRA 1GC1C 1PSKL 4XPFL 4GRLB 5TDNB 2DQEH 2B1HH 1D6EA 3LV3A 5CSBA 3G5VB 3P9LB 4Y89A 2JKXA 3RQ3A 1K6QL 2DD8H 4X83A 4OCYL 4I2XA 1HHJB 1G9MH 4OSUH 2ERJC 1YPZA 1EJ6A 1EXUA 3QUZB 5GGRB 4X6DF 4QCIA 1UADC 4Y8DC 4JRYD 1AO7D 4X9HA 2GY5A 5J6GA 5FO7B 4OZ4B 1M4KA 2QQKL 4OFPA 2W59A 1RK1A 1EJOL 1C1EL 5EBMA 2DF3A 4FXGA 1N5YL 3C8HA 3OKNA 2J8HA 4MD4B 2MKWA 1DZBA 1CFSB 4YAQB 1C5CH 1DANU 4OT1L 3GBNL 4PYHA 1WIPA 1RZ7H 1WISA 3O9WD 5TE4L 4PB9H 4MZ2A 1UG9A 4XAKD 2MCPL 2PYFA 5KSAC 2YUWA 3EYQC 5L0QB 2EYTB 3KHQA 5LQBL 3UPCA 2Z8WC 1MCNA 4HF5H 4FQ1L 5C9JB 3I2CH 3G6DL 3DUHA 1JPFB 3CXDL 2FJHB 5DUPH 3QUXA 4W4NA 4I0CC 1MFAH 4O5LH 4AMKL 3RPIA 3M1BA 1T2QL 5C0AD 2V5MA 3K1DA 3RU8H 4FQLH 5JO5A 1HILA 2MNUA 4GUPB 4JFDB 1ADQA 3REVB 4M8QB 3U1SL 3OAUL 4U6HA 2JCCA 1DVFD 2CUMA 4GG6B 2X1OA 3MLSL 4N1CA 2IPUG 1QFWM 3D39B 4PRAB 4WO4A 5DJ0B 1Z5LB 2RB8A 1X7QB 3QPXL 1A4KB 4PP1D 4PRNA 4MYWB 4OIBA 4QLRA 4JFOB 4U1HB 3GO1L 2Z92A 3WCYA 2OSLB 4OUOA 3BUYB 2DIAA 5DWUH 4HPYH 1PLGH 4JZOA 5AAWA 3FRPA 3IDXL 4JO1H 4OF8A 2OI9C 4LLQA 3ARFC 4XNZC 2YHGA 4WWID 3DUUA 5C0ND 5E6YA 1YEJL 4HK0A 3QUKB 3SGEH 1A7OL 4XPHL 2SEBA 5H35B 1IILE 3C2AH 3RTQD 4DZ8B 3EO0B 1UEYA 3UTSB 1NUFA 1J1OH 3FCTB 1MREH 2MFNA 2ZUTA 1R0AH 3AREC 3N85H 5DHYB 1VERA 3OHXA 4JFED 4LSRL 3HG1E 5E00B 3BP5B 4JKPL 5HHOE 2DTML 5FUZL 2E7BA 2BJMH 2O5ZH 4XCYA 3TT3L 4M3KB 3UO1H 2VAAB 3BPNC 3OV6A 1GAFL 1H5BA 1NKOA 5EDXA 1WBYA 4EZMA 1KN4H 2DL2A 2BVTA 1CXKA 1P7QB 2G60L 3CCHA 1ZLVH 4N9OB 5IOPA 4JVWA 1GIGH 5FF6B 3WFZA 2R0LH 5DR5L 1HEZB 3Q6FA 4FFVD 1NCUA 4QOKA 5IEKA 5CGYD 1MQKH 5JXEC 1NBVL 1E4JA 2BVEA 1N59A 5JW5B 4QRSB 5J3HC 3FB7A 3JTSB 1FZOB 1BFVL 1ZHNA 1K9TA 3T0EE 1RZJL 1IAIL 4WTXA 1KJ3H 5I1DB 3SDDD 5IG7B 3DHJA 4G80B 1DSFL 4XP5H 1DFBL 5T5NF 3NAAH 3QIUA 1G7QA 4ZAKA 1CIDA 3V6FA 1PZUB 3BEVA 4Q6YA 1IGFH 4WFED 5T1MA 4GG6E 1KENH 4OV6F 2KQNA 5IQ7L 3D39E 4NC0B 1WTGT 3ZL4L 3SO5A 5D96C 5EU3B 4BFGA 3TBSA 3RIFF 3TO2A 1H8SA 3FMGL 5D7SH 4CU6A 5IJKC 2A1WL 1FZMB 3FQXA 4LCIL 2VR4A 3QDJA 1A6UL 4JFZH 3RZWA 4WUKL 3ZT5A 3CH1A 1YJDL 4PLJC 1U8OB 4EXPX 4U1KA 2NTFA 3P77B 4OJFL 2R1WB 4MNGE 3QCUL 1CTNA 3X11A 3X3FL 2NTSP 2WLZA 1I8KB 4P2QA 5CBEB 5SV3A 2QQNH 4OZIE 1J8KA 5BV7L 2EIZB 3SHSA 2QR0A 3LD8C 5INDA 4GAJH 7CGTA 3WDHA 1YMMB 1Y6MR 3NPSB 4XH2B 2F58L 4LSDA 3ZE0F 4CVUA 4XHQA 1GHFL 1FIGL 1RUML 2P8LB 4NNPL 4RGNB 4JAMA 1FL6B 1JN6A 1U8IA 4XVSH 1LWRA 3RX5A 1FO0A