5I1EH

Crystal structure of human germline antibody ighv3-53/igkv1-39
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1eH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1eH01
2R2BA 2NPLX 4MNHB 4FA8A 1NBYA 1CDUA 4EDXB 3D69A 4LSPH 5EIIB 2ZUSA 4W6WB 3KNBA 1MCEA 5DQJB 3D9AH 1FNGB 3EYVA 5DRWB 4B5EA 4MA8L 4FQLL 2E7LA 5T3XH 3TCLA 1NH6A 2D31A 4Q74A 4RMUA 4OZHB 4YXHL 5DURD 5HVFB 4MA3A 1ZKAA 4W4OC 4MXQC 4L4TA 3ZTNL 5K9JH 2EE6A 3V5DB 4PGDB 1HXMB 2L7JA 2Y5TB 5H35B 3CSGA 1W2KT 5E08L 4JPWH 4BFGA 3MA9L 1I85C 5J13B 4NO5A 2H1PH 3FAXA 1EEQA 2NY5L 3NIDE 1RQ5A 5MI0B 4CVWA 1H3VA 2CLZB 1X5GA 1K85A 3LMJL 4EUPA 3KPNA 4NN7B 5D6DC 2MTPA 1EMTH 1D5BB 4O2FB 3U9PH 1G6RL 3ETBF 4PLJD 1I7ZB 2VERN 4NM4H 2V2WA 5ID1B 1ZT1A 4UT9H 1CICC 1G7MA 1RSFA 1IM3A 4PY8J 2O5ZL 3KLAB 2ZCLH 1IAMA 5DHVB 3WS6C 4U2YA 3B83A 1LEGA 4ESKA 3AM8C 2DQUH 3D18B 4R9HA 1GGBH 5E2WL 4NBYB 3KS0J 4OZ4B 4V1DB 1U92A 4XNZC 4NKDA 1B0GB 3NFNB 3MMEA 1QBLL 3FO9B 1VFUA 1RZGB 1CU4H 2P8PA 2CUHA 4ALAL 1EJOL 3OJVC 2EXWD 1I7RA 2QL1A 3D48R 3WIHL 4BQBA 4U1IA 3U7YL 2YUVA 5EO1A 1CTOA 1G6RA 2X10A 4NKIH 5IFAH 4WHYH 2ICWB 1BQUA 3MO1B 2DOCA 3DX8B 5T3XE 3ARDB 1F5WA 1LDPL 1ZVYA 2VISB 2CMRL 4R0LB 3KPSA 1BECA 5EOTB 4YDVA 1FG2A 1SYVA 4OQTL 2OMNA 4E42A 2E27H 5FOJA 2AK4E 5GGQH 3V6OE 1AY1H 1BFOA 1WIPA 3VXTB 1WSST 5CIPB 3K2MC 3CFKB 3G6AA 2V5YA 3GJEB 2EDEA 3DVNB 2ITCB 1FAIL 3TBYA 4JHWH 2EH7H 4WWKA 1FNEB 3BX7C 3JVGA 1JNHA 2XZAH 3GBLA 3VXRD 4G9FA 3B8SA 3W39A 4ZUWB 4URTB 2B5IC 3WUZA 2YSSA 1HDMB 2BFVL 1X4XA 4EEEA 3RKPA 5L7XL 4JFXA 4Y4KC 1YY9C 4XXDA 5DA0B 1EO7A 1TENA 3QEHA 5DYOA 1L6XA 1OLZA 4PJIF 4IRSD 4Q0XH 5EUOB 3QRFM 1CDYA 3P3YA 3Q48A 2V17H 4HEPG 1KXVC 3GSVA 5DEFB 1OAYH 4AK1A 1U3HA 2ESVB 2BMKB 5IEHB 3QDJA 2A77L 5ITFB 4LQ1A 1L0YA 1JHLH 1M6OB 4R8WL 1FPTL 1LD9B 4JFFB 3IXTA 3SE3C 2P5EA 2PW2B 3HE6B 5I2IA 3PIQA 4HIXH 1JE6A 1CWVA 4ZUWA 2PUQT 3DI2B 2YD5A 4YIQB 5EUOF 4HIEA 4HGKC 2AXGB 1J05A 4V2BA 1P4IH 4DEPC 4AM0B 1OWRM 1F6AB 4O2EA 5FKAB 3MRHA 5AAMA 2DD8H 4P2OB 1MOEA 5KJRH 3QULA 2NY3B 1IAII 5KSVB 1KJ2H 3SN6N 3IDMB 4KZEL 1U3HB 4F2MA 3RWIA 1MIMH 3O3EB 4X8XA 1HHKB 2VLKB 3SDYH 5E2VL 4WFGD 4WRLA 4Z7WF 1VADB 1PG7X 1CFNB 3W0WE 3W5NA 4ZPTA 3RTQC 4PD4K 4FS0A 4H0IA 2BOBB 3CUPA 3GMRA 3TO2B 3WD5H 1ZHLB 3S96A 4XNQA 2MKLC 4NNXA 4WTZG 3PABB 5DFVC 5CSZA 4AQ1B 1PG7W 4X6DE 1RJZA 2IPUK 5I71C 1LDPH 4ZD3L 3EOAB 3RWHB 1T0MA 4R8WH 5CEZH 3PWVB 1T1WB 4GXVL 1FLTX 3G5YA 5D9SA 1VB9A 2HTLD 4PIRF 5GPRA 2R8SL 1DZBA 1UM4L 4OD3L 3WFHA 3UJJH 4XC3H 1B2WH 1GJIA 3QFJA 1J1XL 2NY1B 3MODH 4MHHG 5C9KA 4KJWC 3VA2C 3OAZH 4CU6A 4MMXC 3VJ6A 2CO6B 3D39A 4PJGB 3MV8A 3K8KA 5TDOB 1A6AB 5JLZB 3O4LA 1J7VR 3VXSB 1FNSH 2A6DA 5C07E 4J3WA 4I0PB 4HIIB 3LKOB 3FN9A 4GT7A 1G7LB 3BVNA 4K3JH 1JRHI 3P30H 1J1OL 2R69H 1A3QA 1UVQA 3BN9D 2BCKA 4MNGA 1DBBH 4P59L 5JW4R 4DUXA 3HMXA 4PJFE 1CVSC 2VLJA 1ZV5A 2JIXD 4OQTH 1DBMH 1YC8A 3G9VA 4KJQD 1EVUA 4XP5H 4JM2B 3KPRB 4I18B 4P4RB 2VZ3A 4W6XB 2YBRB 4LVEA 1QSFD 3VFWA 1U95A 1EBAA 1TDQA 3QUXA 3BD3A 4WFHD 3X13B 3GSUB 3VXSD 1U8QB 4ZFZB 1CLOL 3TN0B 3D69B 4IIQC 4R4ND 4Z76A 1HN1A 2ZUVA 1FRGL 43C9A 3OHXB 2QSCH 5T33L 1YY8A 4GSDH 2HLFD 5D7JD 3G08B 3IFPA 4ODXB 3QQ9D 3L9RB 2A73B 1UENA 5I8EA 5J6GB 2C1PA 3NGBB 4RCAA 2Q3ZA 2ICCA 1FYTA 4L8DB 2HT4D 1OAQL 3V52H 5TFSL 5I73B 4HJJL 3BN3B 4Y4HB 2ATPA 2YD2A 3CLEL 4RIRA 4CU7A 2F53E 2B2XH 2DYPB 2GT9B 3U9PL 1I1AC 4P5TD 5F44A 5IFJB 1IBGL 1KTDB 3MCG1 4YEEA 3MLUH 3Q6FA 5CD5D 1C7SA 3I50L 3T0BA 2P5WB 2V2WB 4WV1B 5C0GB 4LPYA 2A9ML 4RGOH 4F57L 4JQVC 5FGBC 3TFKD 2Z92B 4H8WC 3MO1A 3DUHA 1T7ZA 3RZWA 1YEHL 4PD4J 3SKUD 1T5WA 2VQUA 4JN2A 5BZDB 3BJLA 4NYLB 1KTRL 3RDTD 3KDMA 4FXKA 4RX4A 4EI5C 2ARWA 1NLDL 3N85H 4OZ4A 1D6VL 4DKAA 4G5ZL 3MRPA 1A1OB 1JRHH 4HJGB 5D1XC 2GK0A 5GGUB 1TZGL 3UTQA 4KMTH 5JORB 4R3SB 4LVOC 3CVIL 5L8LB 3BPCA 4OIIL 4WJ5B 4M1CD 4P5MA 1ZHKA 3RL2A 3BUTA 4DFHA 4KMQA 1SJXA 5SWZB 3FL7A 2W9DH 1INEH 1LO2H 5HHPA 4Z76B 4TRPL 4ONHA 1FBIH 4KRNA 2I5YL 4PRHD 4PJBA 4XX1G 1B6DA 4LDEB 3TJHD 3EDFA 1FZJA 4WEBL 3GHBL 2NCMA 3FN0L 4C4KO 3I6KB 4X6BB 4DOHE 1INQA 4YDKH 1RK0A 3PG2A 4FQ1H 5IW3A 5ID0A 1ZT4A 4HIEB 1S9VB 5BXFA 5CEZD 1V3KA 4R90H 5BRZD 3KAAA 3K3QA 5FYKE 4FABH 5IWLA 4GRLD 4ZFGL 1U93B 3IU4L 1S9YB 3DRQB 3TT1H 3LPFA 2ED7A 1F42A 5JHDA 4OSUL 2IAMC 5JHLH 5MENA 4XPAH 4UTBL 1QFWH 4RMTA 4ZS7H 2APFA 1EEZB 5IM7B 4X9FA 1G0DA 3F7VA 5IMLA 3MV9B 5DSCA 2B2XL 1QLRA 2A2QT 1I8KB 5DEFA 4PRNB 4P3CH 4F80A 1EFXB 3MRGA 1CGSH 4ZSOE 5CBEB 3CU1A 5EWIL 3BPNC 5I76B 4ODTL 4OIIH 3SCMA 5GRXG 4ZYKA 1A14H 2FX8H 1MFEH 5JW4Q 1IM3B 3B4NA 5EU7E 5I6XC 3TVMA 4BH7A 1FO0H 5DJ6B 1Z2KA 1KENH 2AXGA 3G04A 5KZCB 5IVXB 3Q2CA 1PEZA 1IAOA 4LASL 2N4IA 3B43A 4NNXB 1BD2D 1BF2A 1EXUB 5F88B 1ZHKB 4MNGE 4UUJB 2IBZY 3DUUA 5IVZB 5ENWB 3CCHB 3KYMA 4HWNA 4X4XA 4DW2L 4XHQA 5I75C 4V2CB 1JTOA 3ZKMC 4PJGA 4XCNB 3GSXB 3HG1D 3HZVB 4HUUB 5ETUB 5CUSH 4LSQH 3VE0A 2ERJB 2CQVA 1V7MH 1UQSA 4KHTH 3CLEH 5KSUA 3OKEB 1OARH 2JELL 4P5TB 3BI9X 3RGVA 4PLOB 2ZNWA 4BA8A 5CCKH 4R4NC 2GYSA 3WHXA 3NTCH 1R24A 1A6PA 3PE9A 1FAKT 4XNMB 1E4WL 1KELH 1MHEB 4KDTA 1ZLWH 1LE5B 4Q7DA 2IAMA 1I1RA 1SJHA 2FL5B 4PJ7B 3PP4L 4HH9A 1RI8A 1KEGH 4QHMB 4KVNL 4BH8A 3U2SB 2HH0H 3QI9D 1D9KD 4OKDA 2C3GA 4L4VD 5K9KA 5FKPB 3GSOB 2ERJC 1RURL 1QFWI 5J56B 1A6AA 1BD2E 1P5UA 1SBSH 5D1QD 5EBLB 5JLZA 4OI7A 2CSPA 3O9WC 3BH9B 4WY7H 5DRZB 5TF1H 2VXTH 4E41E 4D9RD 4JFYA 3KHOA 5D8JH 3B8YA 3D5OF 1IE5A 4EI5B 3WCYA 1F3JB 2CKBL 4RAUB 3BZDA 2RIKA 5FUOH 4F8TA 2IAND 3L3IB 3FONA 3PV6B 2J2ZA 1ZVHA 5KVEH 3FRUB 3KXFB 3ROLB 1CR9H 4U1KB 2H2SC 4J4PD 4Y19E 4EI5D 1HQRB 3KPLA 4QHKI 4GMSH 2HFGH 5I1DB 1A7BA 1ZLVK 1ZGLM 3S7GA 3Q3GA 1KJ2B 4FFYL 3S3SA 1IC1A 5KJRL 4JO1H 5E4EB 1JGDA 2Z8WC 4S11A 4WVRA 1HYRC 5D93C 1UEYA 4GSDL 4WCYH 2OQJB 1AD9B 3GI9H 4JJHA 4PRBA 4Y2DB 3JV5A 3OQ3B 4P4KB 1BPVA 3P0VL 4XBPB 1BWMA 4XWGL 1VEOA 2P4AB 4LLDA 1A1OA 5C6TH 2J88H 3P9MA 3SDDA 4L8DA 3IFLL 3OBAA 3WLBB 1U8NB 5CGYD 2YUZA 3LEYH 4QRUA 3EYUH 2WMPA 4PY8I 2D9CA 4JY4B 1NPUA 1S7XA 5F3BB 4IDJL 2VXUL 2GSIB 2KDGA 1FG2B 2AQ3A 3SDXE 4WI2A 3NCYP 5EU4B 4BELD 3EJJX 1AXTL 1HHHB 5J9PA 4G6AC 1IAKB 2EDLA 5IBLD 1MCSA 1EFXA 1YEEH 3VCLB 1MHPL 1I9JH 4JZOA 3TYFA 2H2PD 3RY5A 4U6TA 1MWAB 1ZAGA 3CFEA 2YXMA 4O2FA 1P7QB 5ECJE 1P7KB 4PJDB 2XACC 3C8KB 1BLNB 4JDZB 1ORSB 2O5YL 4QRTB 4W81A 4JN1L 3H7BB 1MFCL 2RFXA 3MOBH 5GS0H 1SJEB 4S1DD 3PQYB 3KYNA 1DVFC 1IRAY 3QUXD 1JF1A 1YMMA 1JUFB 3RVUD 2A83A 1S7RB 5HGDB 3BT2H 3T4YA 3C09B 3K81A 4FMFA 5A40E 4LKCA 5KZCD 5CWSA 4LRIC 3RP1A 2RJMA 4E41B 1TJHL 1NMAL 4XI5C 5DRXA 4PRHA 5C0AD 3R8QA 3PWPD 1JPGB 4QXUH 1TPXC 3IFNH 1OB1B 4WW1A 4X7CC 3VD3A 5C1MB 1JHLL 2BSRB 3ALXA 2QHRH 4B53A 2DQFB 3ZKXC 5GJTL 3L5WB 3V5HB 4QHLA 1X7QA 1ZANH 1YNLL 4RGND 2R39A 1L4IA 1HHGB 5EU6B 4NRYA 1WC7B 4LMQI 4L9LA 4ODSH 3BHBB 3WN5B 1A47A 2BNQA 4LAJH 3MV9D 2P5EE 3IGAB 4NZDA 4LGPB 4KKCD 3PP3H 1JGUH 3MV9A 2Q8AL 1J12A 4G80B 4LLDB 4HQQL 2Y4SA 1OAKH 5JHDD 4TSBH 4L8CB 1X5YA 4CN6A 1HK6A 1VFAB 4K3GA 1DBKH 4OCMC 4RAVB 4ODWB 3UTZA 2FEEL 1AJ7H 1CXIA 2VB5A 1XGPA 5LAXA 3FFDB 3SKOB 4PJAA 4JFHD 3F8UB 3RWFB 4QRPA 5IOPA 4DJMA 4WI7A 1XIWB 3F58L 4QTHA 1HHJB 4O02H 1LEIA 2HT4C 3U7WL 4OLVH 1RU9H 5C3LD 4EJ1C 1D9KB 5GGVY 3QWOB 3QEQE 4X7DC 2EDFA 5TGBB 3QISA 3HFML 5C2BL 3CFIC 5KG9A 3LKPB 3MYJB 3QT2A 4NCDA 1WIOA 2DQCH 4GG8A 3ELAT 3NIFF 3OPZH 4MJID 4PRHB 5ADPL 4Y4FB 5BS0D 3ARDD 4HK3J 1N3NB 1A3RH 4S1SL 1L9NA 1Z9OA 2NY6D 1LNUB 5DK0B 2IPTH 4RAUA 3PDOB 4QHNB 1XGRB 3V0AC 5I1EL 3WXWH 2A83B 2YUXA 1UWGL 3NPZB 2FO4A 3GMLA 1BQHA 1A9BB 5C7XH 4F33B 3DYMA 2HH0L 1GGBL 3ALWA 5IBUG 4NQVB 2EEDA 1ED3A 4N5UA 3MRQA 1W72H 3ECBA 3V0VA 2EIDA 5KS9A 2IQ9L 4KKLD 4YGVA 4JDTL 2A6JB 3GKWL 3C08H 1YYMH 4GMSL 3DUUB 5C8JB 3QHZL 3SDCA 2DTSA 2YA0A 3LHPL 5E5MB 2YPLD 1CN4A 4H26A 2OJEB 3BAEL 3C5ZD 1PKQE 5HGBB 1BVLB 2Z93B 1WBZB 4N0CD 3CDFA 5FECB 1FCGA 3QRGH 4CN4A 2WK2A 3ZKQD 2CO7B 5D96B 3RY6A 3WL9B 2C1OB 2P7TA 4MAYC 3O9WA 2AI0H 4QRRA 5FA4B 5CP3H 3QUMA 3X11A 4XMKH 5IV2A 4MYWB 3RU8L 5D1XB 1I9RH 4PJXB 2JJSA 2RB8A 4FQJH 4YH6A 1KB5H 3U7YH 3R0NA 3RA7H 2JJSC 1PYWB 4XPFH 3VXRA 4MDIB 1RV6X 4NQEE 3CXHJ 3DETC 3HMXL 1IGMH 2LTQB 2OMBA 3PDDA 5JOFA 1U8HA 1G7PB 3AUVA 1UXWB 5KG9B 3JV6A 1JWSB 1JPFB 1UJ3A 4F7PA 3UYOD 2BDNH 1KCUL 1GGTA 2A6JA 4OLWL 3BXNA 2J8UA 2X1OA 2QADD 4K8RC 4XP1H 3SGKA 3MXVL 3GZKA 4FQCL 3HMWH 1NANI 3DPBA 3KHQA 3WNLA 3EYOA 3PL6D 3FMGL 5JIIA 2VXQL 2GSGB 2V9RA 2Z31A 5FHAH 1G84A 2FYYA 3FKUS 2E7MA 5GRVL 2ADFH 3RVXD 5LGJA 1FO0B 2UUDH 2DL9A 4GJTB 4I9WE 1JRHL 1RZIB 2YC1B 1ADQH 3D25B 1KCRL 4LLQA 4KY1L 4ODUA 3ILPB 1FSKB 1VGEL 4NO0D 3MJ9A 5JQ6L 1JPFA 3MOAH 1I1AB 3VXUD 3DOSA 2Y06H 2DQFA 4JM2A 1KB5L 2BVUA 5F88A 1QFHA 1XF5A 4OFYA 5IG7B 4BQ6A 2J4WL 3P40A 4Y1AD 3DO3A 2XG5A 4X6FB 3IAGC 5GS0D 1ZE3C 2IANE 3PNWA 5EO0A 1RAMA 4X6DA 3QA3A 2R29L 1ADQL 1U8MA 2LU4A 3T0EE 4F9PC 2VJXA 3VXRE 1GOGA 2KZWA 4KI5F 5JR1L 1EX0A 1ZA3A 3U0PB 3FAWA 5EA0L 5D1XA 1R3KB 4Y2OA 5EULV 5IESL 3T04D 3STLA 1C16A 5I1KL 4PJHE 3EZ8A 5D6DA 4R7DB 5JW4M 3IDJA 4LLMB 1MI5B 4ODUB 1RIUH 3RAJH 1JZ6A 3QDHA 4PJDA 4PGJA 4X6EA 3MNWB 1ZK9A 1KCVL 4YXLL 3MV9E 4KROD 3B2UC 5A3ID 3FO2B 1RHHB 2M1KA 3U7AA 1QSVA 4F2MB 2DQDL 5HDOA 5HXMA 1BD2A 4NGHH 1A7OH 1GZPA 1J5OL 3ARFD 5C92A 2I24N 5IHZA 2UWEE 3I3BA 2EO1A 1T5XA 3BIBX 1YC7A 3L3HB 3TEUA 4I18C 4QRPE 1U8OA 4WWKD 5BCAA 1M7DB 2ZUXA 4ORZC 2E7LC 4JJ5A 1MUJB 4ZTPL 2ARJA 4IEFB 1UA6H 1F90L 4RQQB 5T1LB 5HGGS 2QLVB 3AS0A 3UJIL 3ULSA 1DDHB 3DURB 5DURB 1BJ1H 4O4YL 2FO4B 4JFEA 4RISH 4K7FB 1EVTC 4ZUSA 3IU3A 2X44D 4YC2C 5HI4C 3T0VA 1CDBA 2OP4L 2HMIC 1K3ZA 3A6CL 5IBUB 4K7PY 1NMAH 5MENE 3BZEA 1HWHB 1UYWL 5IMKB 2NW2B 1KTLA 3G6JA 2VRAA 4OM0L 3LHPH 1AGFA 3O11B 1CQKA 5DLMH 1EERB 2WV3A 2FR4B 4KJQC 1N7MH 1RMFH 3MV01 4P4RA 4P23B 1K2DA 5EZLB 3KPLB 4XT1C 4UT7H 2R2BB 3NPSC 4M00A 3ESUF 5F71A 1BFTA 3EFFB 2OK0L 1U8MB 1ZOXA 2XZZA 5JW3L 4APQD 3VFOA 2YD7A 1GZQA 3HAEG 5I75B 3U46A 3QDAA 4KC3B 1U8IA 4CN1A 1OPGH 4DN4H 2M2DA 4QXTA 4K3HA 5DYOB 3CFKA 4NCC1 1N2RB 4OZHE 3GSRA 3RWDA 3RZCA 1HOCA 2YWZA 1ZVSB 2DN7A 3LEXA 4PJBF 2XQYK 5AUMA 3S4SG 3GSVB 3KWWB 2AEQL 5F8QC 4ONGL 3WMSA 1NDGB 2CKNA 3BRGC 3IKCB 4Z18A 4U4BA 3O6KH 3ZHDA 1CGWA 5IJVA 1JBJA 1OCWL 2VDKL 2YR3A 5D72L 2NY1D 1OOAA 1K4DB 1MFBL 2BNUB 4P5KB 4GLRH 1FVDA 3ZTJG 3QI9B 1NBZB 2R4SL 3O6LH 1OTTD 3G6JB 3VFWB 1LO3H 4TULH 2D7QA 4PB0L 4BSVB 3ILQD 4UNVA 5JTWA 3WJLA 2C1OA 1CICD 2VTFA 3OR6B 3HAEA 3MRKB 3WS3A 2EYTA 5FO7B 1S9XB 3PHSA 5DUBA 3PWJA 1HCVA 3QIBB 4K7FA 1U8LB 2HFGL 1CBVL 3GK8H 1E28B 4LPTA 4IIQA 1DQLH 1YN7A 1LK3H 4QCIB 3BE1H 4JDZA 2VXUH 4MQSB 4Z77A 2W92A 4GBXD 1H8NA 4K3DL 5MEQA 4ZTOH 2DBLL 3DETD 2GJZA 3VDCA 3E6FA 3VFRB 1ZHBA 2X1PA 3INUH 1F11B 3EYQC 4LSTL 4FG6C 3QDGB 4G3YH 3MLXH 5DUPH 4LLYA 5EZLA 1GH7A 2J88L 1OQOA 4P2OD 1N26A 2E3VA 2FRGP 3LRSB 2IWGA 3TLRA 4CVZB 1DEDA 4UUJA 5J11B 1NCWH 4TUOA 1A7QH 1FH5H 1UGNA 5IFAL 1KLUA 1WBXA 1KUMA 3RUGA 1T83C 5IFHH 4LLWB 3OKKB 5C0BB 3BT2L 4OJFL 5DVOA 1WITA 4X7SL 1Q72L 3VXQB 4HPYL 3SCMC 1G7LA 5LGJB 5HHVL 2D31B 1K8IA 4NHCH 4PRIA 5GRUH 5GS0C 1NAMA 1D5XA 4RFEB 3FRPG 3NCEB 3FHQA 1HXYA 4NSKA 2UV3A 2ESVD 5TQ2H 1S9WB 5JZ7D 3PJSB 4EZMA 5F1OB 3FT4B 5AD0A 4RSVA 4L3AA 4TTDC 3NZ8B 2YPVH 5E94A 2EYRA 3GMQB 4IHOB 2XZQL 3CDGB 3QO1B 1CD1B 4F37K 1CG9A 1P6FA 1U3HC 1S3KL 3EGSA 5FGSA 3LEYL 4OLXL 1WZLA 1YNTB 4TQEH 5ISZB 1W0VB 4WV1C 2D0FA 3FCTB 4ZAKD 1A2YA 5EU3B 1FGNL 4KFZC 2HKFH 2KUTA 4GRLB 3RZCC 1T0NB 4JZOB 4YX2H 4PRPA 2AJZA 5D7SH 4L3CA 4LVNB 4Y5XB 4J6RH 4KK5C 5IVXE 2PTTA 3HC3L 4ZTPH 1X44A 2FNBA 2ITDB 2R0KH 5E8PA 2V9QA 1QFWM 4ORGB 4JPKL 1CD0A 5HHQB 1ERNA 1IL1B 3QEUB 3HZYA 5L7XH 3GBNH 3TO4D 2BZDA 4LVOB 4MD0A 1FORH 1UCBL 4PV9B 1VFBA 5TQ0L 3SO3C 2DIAA 4XBGB 3LS4L 4N8VB 1CF8H 4NHCL 3J8F7 3QULB 2XKSA 5AZ2H 1CR9L 4LLMA 1UFUA 1NFDE 5GGVH 3QEGH 5BJTA 1ROWA 1M4KA 1LO0H 3PWPB 5C0AB 1GPOH 1O5DT 3R1GL 5F7EH 1X4ZA 4LCCC 1TQBB 2DL2A 2I27N 3CXDH 1SHMA 4OKVB 4LMQE 2FATH 3KPPA 1OARL 5E99H 3O2WL 5GJSH 3K8LA 1MLCA 4PJCA 5IW6B 4FFZL 5D2LE 5DDHB 4LLUB 3L3JA 3QUMB 3FB7A 5F96L 2R29H 3VG0H 3MSPA 5ACLA 3JZ7A 4OV6F 2BNRB 5DWUH 2NZ9C 5SX5H 5DRWA 2OL3B 4NKIL 3CFCL 3OSKA 4KUZL 1FE8H 1L0QA 5ACMA 4YDLC 4FOMA 1BOYA 3ZE1E 5T1KB 2LFGA 4KVNH 5IIEB 4U1GB 3QAZC 2BVTA 3ZDXF 4GKOA 2CLZA 1IC4L 1II4E 1LEKB 1MCNA 1RY7B 5KVDL 3T2NH 1Q0YH 2J8UE 1K4CA 4H1LA 4AEHH 1FIEA 1I75A 3I02A 4LDLB 1EXUA 4HKJA 3QFJE 3OKOB 1GRWA 3BSZH 3WNPA 2VLLA 1L6ZA 5GSRA 1LMKA 1B88A 2IH3B 4NM4L 4U6VL 5DLML 4PTUA 4HT1H 5GISH 1XF3B 1QOKA 3RWJA 4KJPD 2W0FB 3S35H 3WIFB 3A6CH 5JXEC 5FUOL 4N8PA 4OZGA 4PJAE 2P5EB 4MCZB 4DAGL 4HV8A 4LSSL 5B39A 3DLQR 5CD3B 5MEPA 1B4JH 1WF5A 3BGFB 1ACYH 4JZJA 1FZMB 4L3EB 3LMJH 3RVXC 3ILPA 4R4FH 5FYLL 4JM2C 4K23L 3CSPA 4UV7L 4WI8A 4NN6B 2LQRA 4JFFE 4G6MH 1AO7D 1MHHB 4HK0A 1MJ7L 1YA5A 3WO4C 1BF8A 5C9JB 4X98B 4GW4A 1OT1A 3RPKA 1WCQA 4MJIA 3U30B 2X5PA 3BISA 4YHMH 4YQXH 3SE9L 2BSTB 4C58B 2DLTA 4YLQT 2YWYA 2PO6B 5EIQA 3P4OA 2IQAA 1PEWA 1P53A 3CLFL 1NMBL 1BM3L 4RMQA 4QYOB 4X8JA 2A73A 1T21B 1XCQA 1U58B 3AAZB 5E00A 1JPSH 3GO1L 5GRYA 4K7PL 2DAVA 2VDPH 4XTRC 3IS0X 5HYJB 4AEIL 3LSOA 1MCPL 1X5IA 3C9NA 3AMKA 5E5MA 5I1KH 3VXOB 2JB5L 3AY4C 5D2LF 3PP3K 4FXGA 4G8GD 5CGTA 5ANMB 5F7DA 5GXBB 1QFOA 2FX9L 2IG2H 1XGQB 3QG6A 3V6OC 3VRJB 3U9UB 3QEQD 3P0YH 3BEWA 1YQVL 1JZ2A 1NGWB 1E4XI 4DGYL 1FZMA 3CMGA 1UH2A 5ICZB 3EZJB 2CRMA 1A4KA 5JHLL 2I26N 3C6LB 1A3LL 4RRPG 2B0SL 4KKNA 3NA9L 4XPHL 2BXYA 4MQ7A 3MRGB 1A3LH 4OZFH 4DGIL 2CK0L 5I30H 3L3DA 5I8CA 4ZFOL 4XCCL 5IK3A 5CHNA 3P9MB 3SDDB 3VW3H 4HS6A 1CFSB 1ZLSL 4JFFA 4OD1H 3JBG7 1I8IB 3IRPX 5AEAA 4MJ6A 3C8KA 4M7LH 1ACYL 1LK2A 2FHBA 5BV7L 3P9WB 3RNQA 2RCSL 4QGYA 1X5XA 3DMMD 4KI5D 5DD5L 3B5HA 5IMOB 4Y19D 5HD8D 5T5NG 2A6IA 2GQHA 4NZTL 1IAKA 3VI4E 2D7PA 1TITA 5GGVL 2AEPL 3L5XL 2GT9A 2YD1A 5JIPA 2EXYD 4L8BB 3EUUA 3ARGA 5F9DC 3IDUA 4LEOB 2CDGA 2OTUB 1YMHB 2DQGL 4C83A 3T0DA 4M7LL 4P2QE 3RKDC 2DQTL 1AIFA 3PF2A 1TQCC 4P3DB 1MCKA 4JRXB 5IB3B 3O8XD 1QSZA 4X9GA 1KJVA 3BXNB 3D3VD 3VXPA 2UUDK 4X5LA 3TZVB 1UM4H 1F3JA 1ZHLA 3S96B 5CJOH 1CGUA 3BKYL 1VGEH 4XPTL 4LSRH 1JZ3A 4GKNA 2BY2A 4JGUA 2R9HD 2VE6B 5L2KE 4IJ3B 3DWTA 3RU8H 5IQ7H 5DC0A 8FABB 3VFUB 1BFVL 3MR9B 5K59F 3UTTE 5FF6B 5FUZL 5LBSH 4OF7A 43CAA 2I5YH 1NBVL 5CWSB 3WUWA 2G75B 4LEOA 4GKZA 1KV3A 2B7DT 1OAXH 4QY8B 3LCYA 1RZ8B 2R1YA 2X70B 5SWZE 3QCTL 5KW9H 3QFJB 2P8PB 1MJUL 1WV7T 5DD3H 4YHLH 4YBLC 3ARBA 1R3KA 1E4XH 4U6VH 2OQJA 4Z7OF 3W9EB 5LWYL 5CBEA 3GKWH 3PGFH 2H6PB 1CF8L 3OB0H 4G8IA 3FN3A 4TVPE 3P4MA 1EAPA 4M61A 5EC1A 1HSAB 1U3ZA 4PG9A 3DXAE 5DJXB 5EZOL 4JEGB 3R8BB 5IVNA 2K7QA 2FJGB 3QQNA 1N6QL 5C7XL 5F6IB 5JOPE 1S5HB 3HMXH 3KPTA 1G7MB 1I9IL 4I9WD 5IOPB 3BP7A 4NO2B 2PYEB 4Y5VB 4I0PA 3GBNL 2Z8VC 3IJHB 1T04B 4NUJA 4YFLI 4YAQB 2R9HC 4Y2DA 1CZ8L 3SKMB 5BQ7B 1I8MA 1TZHA 1IKFL 3MNZA 3CSBA 3ECBB 4MMZC 1JYNA 3S34L 1D7FA 3PXJA 3IFNL 1KJ3L 3GMPB 3M1BB 3S88H 1TETL 3STZA 1RUMH 5IROC 1KC5H 4IRJD 4LSTH 2VSDA 1WWWX 1JN6A 1SEBA 1T7VA 4K9EC 1LNUA 1OW0C 3TA3A 2I9TB 4R26H 3ARPA 1IARB 4G9DA 2MOVA 1XCTB 2DWEB 4WUUD 2JCCA 3MGOA 1YEIH 5DJDA 2XN9D 4H1LG 2OCFD 4OLZH 5J9PB 3ULUE 3BPNB 1FNGA 3VWKD 5EZIH 3NH7H 4U05A 3WSQH 4Q9RL 1KIQB 3MJ7B 2I9LB 4OGXH 1OAKL 3VMPA 5HDBE 3LRHA 2IFFH 3WLBA 4BM7A 3WE6B 3BKJH 3HPLA 3JXAA 1OP3H 1M71B 4R4BB 1U8PB 1X5JA 5CJ8A 3IJHA 4OD3H 5A2FA 1R3JA 1J10A 1NGYB 1TCMA 4UT6L 5D71L 5GGQL 4TVPH 4M6OH 4HG4J 4LCWB 3RL1A 5FA4A 3MRFB 5TH2B 4POUB 2OZ4H 5KSAD 4N9GB 1RJLA 3INUL 5IMMB 3DTXB 2CRIA 4YHYC 4GXUM 1T04A 2J12B 4WI6A 1FDLH 3MJ8A 1I9IH 5C09E 3SDYL 3JUZA 4RNRA 4LL9A 3FRUA 5LVEA 2F5BH 4JM4H 4PBVC 4QWWC 1AP2A 6CGTA 3QIWB 4ELKA 2CJUL 4DN3L 4A6YA 2DD8L 3OX8B 3RHWF 4JANA 4QNPF 4R96A 1DE4B 4N0UA 5GRUL 5E4IA 1AXIB 5HYFA 1H3PL 2PW1A 1E27A 4GG6A 1CFQB 4PJHA 4U1HB 2J5LB 2D9QB 4P57A 4NRYB 2BERA 1LGVA 3T65A 1N3NA 4OV5A 3FO0H 2GY5A 3OAUL 2C7UA 1CTNA 3FTGA 5H94B 4HGWB 3NABL 4L5FL 2Z9TA 1P4LB 5K9KB 4DGVH 3S34H 2AEQH 2QR0B 4HLJA 1NCAL 1R5WB 2XRAH 3VI3F 5D1QA 2ARJQ 2HVJB 4DQOL 4QRPB 3BRDA 1IGYA 5IP4A 3N0PB 4PJIB 1CBVH 5B38G 4M6AA 5DD1L 2HA1A 3AREA 1QPXA 1GOHA 4GQ9L 1KFAH 4Y4HA 1J1PL 5IEKA 4U0RB 4LCCA 1HHIB 3LQZB 3EFDL 3HZMA 3FTGB 4NQUA 3T0EC 2ICWJ 1UH4A 3AB0B 5BVJA 3NTCL 4IMLB 4JRYB 3SCMB 3RAJL 5BV7C 5DJYA 1RZFL 3GSNH 1OGTA 4IMKA 1CFQA 3Q3GB 3KYNB 2AJVL 1NCWL 3ARRA 3P77A 1MFDH 5ACZA 3OAYH 2CMRH 1KB9J 3DXAA 3LV3B 2BSED 1P4BH 4ZNCD 1U8JA 3REVA 3GNML 3SDAD 3LIZL 5EG6C 4FTVD 4HIJA 2O61B 3TPUA 3WIHH 4ENED 4ZTOL 4X6EB 5I30L 5I9QC 2NNAB 1RJYA 4PJ9A 1OF2A 1A7NL 2VKWA 1F90H 1GHFL 1QSFE 2QQLH 4BQ8A 1JN6B 2FDBP 2AGJL 4TUKL 1GIGH 4KTEL 4XNZB 2GCYA 5ERWA 5SWSA 3DARA 4PJ5A 4FQXD 5HI5D 2DQDH 2G75A 2EIBA 1LP9B 4XCNA 3RWEB 1DR9A 4HGWA 5CFHA 2B39A 3GM8A 2PXYA 4M93B 4EUPH 1CE1L 4PV9A 4AYFA 3KJ4B 4ZOCA 2Y07L 4ZUUB 1KNOB 2R2EB 1YY8B 1C5CL 1G7QA 3QDMB 1FNFA 2AEPH 5IGXL 4Z0XA 4O2EB 3AAZA 5E00B 2VIRB 3SKOA 5E8PB 3BPCB 1U92B 5DJXA 4RFOL 3H3PL 3T4AA 1GGCL 2A1WH 5CBAB 3PIQB 4N1EA 4BSWA 1UKTA 3NIFE 3MRPB 1AGEA 3IXAA 3SKNB 4KQ3L 3H7LA 4JPWL 1KN2L 1NGQH 5ILTH 2NY1C 1OSPL 1WTLA 1ZEAH 1P69B 2OI9B 3QI9A 2CK0H 4LSRL 5DMIH 2R0ZL 2PN5A 4F9LC 2ADJA 5JDSB 3G5ZA 3W9DB 2CK2A 2NX5A 4N5ED 1XAUA 1DTUA 2EIZB 4OCLC 4L3EE 1OB1A 1X5FA 2AJYL 2P5WA 1IM9B 3PUCA 3T3PE 1U0QA 1MF2H 3JWNC 2E8ZA 4HMDA 4UT7L 1I1FA 2XTJC 1S9YA 1PD6A 3DRQA 3FB7B 3UPCA 3B6SA 3BKML 3L7FB 3MLRL 4ERSH 1N2RA 5IJKA 4LKCB 3O45B 2LU3A 4JRYE 3ULUF 4TNVK 3EJZC 5FOBA 1GSMA 3MACH 3SPVB 4P3CL 1UYWH 5FDWA 4TOYH 1C5CH 5D7KE 4PLJC 1H15A 1FV1A 4K7PH 3SQBA 3FOLB 1DP0A 1F3DH 1N4XL 2IGFL 5MHSD 4PR5A 4KK9D 3ZYOA 1U95B 3SE4A 3DIFA 3TH2T 2CDFB 3RPIB 4KKBC 4KPHL 3E8UL 4AIXA 1JWMB 4BSWB 2MSPA 3O41A 5D96C 3BHBA 3MRJB 1UADC 3QH3A 3QXTA 3HI1A 3RWGA 4PRNA 1IZKA 3TT3H 1WK0A 5IT2H 5I17B 4LCIH 4J1UA 2VR9A 3O2VH 3UTTA 2XNAB 3VXPB 1S7UB 1TTGA 3HE6C 3OR7B 4MQXD 2IH1A 3QFDB 1FCCA 1IAOB 2ZUQC 4R2GD 5E6ID 4ZS6C 3EBAA 3WNKA 4ACPA 4DWHA 3W11D 4PJAB 4MS8C 4GAYA 2DQGH 2D7OA 2JB6B 3H0TB 4KPHH 2R2HB 3RBSA 1H8SA 3D2UB 1OL0A 4M3KB 4OGYL 1WJ3A 2J6EH 4NT6A 4JCLA 1LE5A 4M5ZH 1EA9C 4X7FC 3VFTA 2FX8L 4AZ8A 5FHAL 3RI5K 4N0YL 4XPGL 1QP1A 2DLFL 3WFZA 4HS3A 3QWRA 3UTSB 2CIIB 4HWBL 1KBGH 4N0YH 2Y07H 3ARUA 1T1YB 2HG5B 4KUCF 3KG5A 3CNKA 3WBDA 4QLRA 2QQNH 4A6YB 3PL6C 2C3WA 2FB4L 1TZGH 5FCUL 1P7QA 6FABH 3F65A 3MV8E 4P2YA 1R3LA 4M7JH 3TYFB 1U8QA 5FYLE 1NCDL 2VNCA 2OLDA 2R56L 3P4MB 1NMCB 2GSGA 2Z31B 4O00A 5HDBF 3RX7A 3KXFE 3ZE2E 1BJ8A 2A74B 3EJYC 1GXEA 1IFHL 1A1MB 1ONQA 3SDDC 1T21A 4YUEL 4GAGH 5DVMA 4OZGB 2GTZB 2R8SH 4UDTB 4WW2B 5HGAB 5GZND 3QIWD 4HFWA 1T1WA 2UWEF 4LHJB 2AI0L 4NSKB 3MLUL 3OPZL 2G5BA 5F3HB 2AXHA 3V8CA 4F7MA 4NOFA 4QRRD 5CGYC 2EE2A 5C0EA 5IEKB 1CDIA 3S4SA 5KSVA 2NY7L 4EOWH 2VAAA 2X4SB 1YYLH 3CVHB 2AKRB 3FMGH 2AS5M 1FBIL 2A1WL 3OAUH 1R3LB 3CFDB 5GJSL 5KOVC 3K4AA 3BAEH 2X4TB 4WENB 4FFVD 4IOSD 1DLHA 4HJJH 5H8DA 1YEKH 1N0XL 5EZJA 5I8KL 1Q94B 4TVPD 3B2UD 1QBBA 1NFDF 5IB1B 1CI5A 4PJEE 3X11B 3SKJL 1T1ZB 1J1PH 4KMTL 1NL0L 4Y89A 3QQ4B 5FA3A 1EDQA 5E6ZA 1VKXA 2C4FT 1H0DB 4CU8A 1KCSL 3CH1B 1DVFD 4F7MB 2X41A 5KAQG 2Q86A 3VXOA 3T1FB 4OCSH 2DJ4A 5FYJL 3PV6A 3MOQA 1VHPA 4AH2A 5FM5M 2CXKA 3WXWL 4OKVA 5IG7A 4MX7B 4ODSL 3VGHA 5ESQB 5DT1H 1GGIL 4KHXL 4JO4L 5EDXA 4X9HA 1HZHL 1LO5B 1MWAL 3H9ZA 1YJDC 4PY7B 4P46A 4YHZH 1CDGA 1A5FL 5EOTA 2XN9B 1QA9B 4YEFA 1NANH 3FB6B 2BK8A 4KDWA 2WUCL 2CLVA 2FBOJ 1AIFB 3U48A 1T2QL 3TIEB 4J3UA 1V7NH 3GSUA 3P30L 4HUWB 1JTPA 2VUOA 4IRJB 1GPOL 3F58H 1DBBL 3NACL 5I1LA 1W0WA 1DQTA 5F72S 4MJ5B 2H26B 3MC0A 1VPOH 2Y5EA 5B3JE 4BUGA 2D03L 1CIDA 3OG6B 3TNMA 1TVBB 1I8LA 3HS0B 5C0RH 4YK4B 4PJEA 1TQBC 1R0AH 2YK1H 4XAKD 5IIEA 2B5IB 4AQOA 1WBYB 1QLEL 2A6KB 4ELME 4I13B 4N8CH 2IPTL 3DX7B 2VN4A 4OJFH 1B0RB 1SYVB 1MCOL 3C6LC 1G9MH 4HBCH 2GY7B 3AXLA 5MP6H 1NLBL 4XXDB 2DDQL 2VXVL 5HHQA 4HBCL 1RUQL 4XP5L 1UCTA 3LAFA 2EDWA 3O9WB 1QRKA 1WAAF 1MSPA 1JZ4A 1OLLA 5HGHB 1YMMD 4OGZA 4XB8A 3WIFA 2ARJB 4Y5XA 5H35A 2EKSB 4N8CL 1T0MB 3LKRA 3VXMB 4L4TB 1C5BH 1VGKA 1K6QL 4KKCC 5IHBA 4Z78A 5F6HJ 1IC5H 3BE1L 3FFCA 1RIHL 4LSUL 4M48L 1C5DB 4XH2B 4EXPX 1W0VA 2H2SD 4J4PC 5E8OA 2IANA 3ULUC 5KSUB 5C0CD 5T3ZD 4ZO8A 3P4NA 3T0EA 1I9JL 3TZVD 3JTSA 3VWKC 1WIUA 3MV8B 3KJ6H 1A8JH 2F58L 4J4PA 3ROOA 1QFUL 4ZSOA 2IBZX 2A0LD 1H3TA 4L8SC 1KYOK 1FL5A 2OL3A 3BVNB 4OF5A 1UJTA 2BSSB 3O3BA 3QCVH 1NKRA 4HJ0D 2NX5D 2MPAH 4HPOL 1I3RB 2IPKA 4GS7B 4V1DA 1HI6B 4K8RH 3OWEA 4NRZB 4U2ZA 4ZNEA 2P24A 5L2KD 3D18A 2NY3C 3GM0A 3ZDZE 2JIXA 3EYFB 4IJ3C 2YN3A 2V6HA 3QXDA 4XPTH 2NMSA 3DMMB 3D0VA 4GS7C 5DTFB 1BFSA 4MQTB 1HHJA 3DX9A 1MCRA 4K94H 5M7QA 3BKJL 5FO9A 4R0LA 1I1YB 4JFDA 4PRDA 1C12B 5DEZA 4G6AD 3V4VH 3RIFF 5FUCE 1IQWH 15C8L 4JRYD 3LEVH 4WFHE 1LILA 4LLUA 3D9AL 4G9DB 3TH4T 2ATKA 4OV5B 3C2SA 4M1CC 3RNKB 3RWEA 1NBYB 2EDRA 1B9ZA 3O3BB 2ZSVB 4U1MB 1NFDB 4YHPA 4EN3B 1QR1A 1T1YA 2HG5A 1XZ0B 3MRRA 4PRIE 1EIBA 1LO3L 1U8KA 3NOIA 3VFSA 5B8CC 1Z9SA 2OSLA 3PDOA 3MLTA 1YYLL 1OWWA 1LDSA 3BQUB 4MJ4A 4I4WA 4Z7UB 1MREH 4PRPD 2JLLA 4LSQL 1LVEA 4IOFD 5L88H 5HYJD 3SDCD 3IDIA 3NCYS 2F9BT 3IDYB 5DC4B 2HT2C 3FCTA 4YR6B 4HDIB 2E9JA 4YGAB 4U1KA 5C0CA 4A6YH 2MFNA 3BKYH 3P9LA 4GRLC 5LKNA 1GGIH 1NGXB 4YFDB 3RZCD 3QUYA 3SOBH 3QNZA 1S78D 4EN3C 5GRJH 1T7YA 4N9GA 1PKOA 2IFFL 4JRYA 5JW4N 2R15A 1UACH 3LKQB 3SGDI 1BIIA 4IIQB 1IFHH 1BBDL 1A7PH 4MNQE 3IXTB 4HV8B 5CD3A 1B4RA 3HC0B 4NKOA 3VFNB 5CSBA 2JJVA 4ZUVA 4CAGA 4NGHL 5HHME 2VABB 4X9IA 3K2UH 4XCYA 4PTTA 3IU3B 3BQUC 2BVOA 2ATKB 4CRPA 1N59A 5E6YA 1OGAA 2HRLA 1AXSA 2X7LA 1KBGL 2D7TL 3RVTD 4LLVB 3OXSA 5DJ0B 4TOYL 1CG9B 2X89A 2QQNL 2X4RA 4L3ED 3T1WA 4K9EL 1RVFH 4WFFE 4OZFG 2BHZA 2EC8A 2YPLA 3I6GA 3FFCD 1ACZA 1HXYB 4JQXC 2VWEC 3C5SA 1XGUB 1Z3GL 2GJ6A 2APWA 1XR9B 4WIQA 1YNKL 2EDKA 5BV7H 4MNQD 3SBWA 3VRJA 1DLHB 2FEDD 2Y7QA 3CPLA 3TT1L 1YJDL 4X4ME 2X1WL 3ARBB 5IF0B 1AO7A 3FB5A 4UTBH 3O2VL 5DFTA 3C6SB 1F4XH 4JQVA 4LCWD 3VA6A 1TVDA 2J8OA 5I1CL 4DN4L 4G6ML 5FM5O 5E0QA 5IT2L 2OSLB 3NA9H 3R06B 5D4QA 2ADGB 3WXVH 3UYPA 1FJ1B 1EJ6A 1C16B 1Y6KR 3C8HA 5I8OH 4OF0A 1BZ9A 5I1AA 2HMID 4R2GC 4YDKL 3LS5L 5CEYB 1SY6L 5MERB 3HR6A 1XF4A 1DLFL 3IKCA 5CP7B 2AJXH 4Q9QL 3CX5K 1A14L 3SKMA 2JB6A 3FQNB 4OI8A 3BYYA 1N0XH 4M6ML 3DX7A 5E8NA 3VWKB 1LEIB 3O0RH 3VI4F 2VDLH 3UEZA 2EDJA 2DLFH 4P3DA 3IDGB 5KS9F 4Z5RB 3KXFA 3ROLA 4H8WL 4XBGA 5JXED 5TE6L 5DMGC 1JPST 1OGAE 1S7TA 3VD5A 3BD4A 4YWGH 4KJPC 2XT1B 3PWJB 5C0NC 4OTXL 4RAVA 1ZSDB 3IF1A 4HK3N 3VJ6B 4OI9A 4D0DB 3OKMA 2GJ6B 2HTKC 1YPZA 4P9HH 4W70A 4U6HA 4C56E 2DKSA 2PXYC 4KK6C 5DJCA 3PV7A 5GZOC 4UIMA 3MA9H 1I7TB 2J4WH 5FGCB 3QUZD 5DRNB 2PETA 4PUBL 4GG6E 4QHNA 3IDNA 5KVFH 2JTDA 3PHOB 1NKOA 3E6FB 3VFRA 1KLGB 2PW2A 2IC2A 3HE6A 1T5XB 2R0ZH 3L3HA 1BZQK 4E5XB 1WAAE 4JFQB 4S1QH 2CIKA 4O2CA 3WE6A 3QP3A 5MEND 5JIKA 2A9MH 4KVCH 3TBWA 1JHKH 2NX5E 2OZ4A 2QTEA 2IMMA 3ULSB 2FATL 5E99L 2VXQH 4UV4L 5IB4B 3TYGH 5TFSH 1ZS8A 3C60B 4G7VL 5EU5B 1ZTXH 5DUMH 2W9LA 4NQVA 3TN0A 3ZDYF 5CILL 4XZUB 3W9DA 1X6NA 1SJEA 1DBAL 3RGHA 4JO2H 3PWPE 5DVKA 1WCBB 2NTSP 2IJ0C 3NVQA 1T3FA 2GITA 1OTUD 3WLWC 1SY6H 5IV2B 4EIGB 4JREB 3SE3A 2ZG3A 3V7MA 4EI6B 3L5JA 2OTPA 2FEEI 3T2QA 5C08D 4ELMF 2PNDA 3LD8C 3CFCH 3WDHA 4DQOH 3GSNB 3QYCA 1JF1B 1YMMB 4WFEE 4YAQA 3O9WD 5DS8A 4M7ZB 2ZZUT 4HG4K 4GRMA 4MX7A 4FNLL 1F4YH 4LHUG 4F9LA 4DGYH 4KY1H 3FN0H 1NGQL 3P4OB 3RRQA 4K23H 3QNYB 3EYVB 1DQMH 5ADPH 5CINH 1BX2A 1RULH 3JWOC 4LARH 1J8KA 3CFEB 3BESR 4PTUB 5C0BD 3IJSB 3LN4B 1ETZB 4FQXB 4LBEA 1GAFL 3D39B 4XP6H 1GGCH 3D85D 4H25B 1NAMH 1T5WB 3N1GC 3U1SL 1J1OH 2R69L 1R24B 2Z92A 4NPYB 1DEEB 5HD8C 5D1ZB 4HZLA 1MFCH 3MOBL 3ILQC 3CFJB 1U6AL 1OTUC 3WLWD 4ERSL 1NMBH 3LS4H 3N50A 1YYML 3EFDH 4LLQB 1MPAH 3CU7A 4Y19B 1DUYB 1LP9E 3EJYD 4MSWA 1HE7A 5C0BE 2UYLA 1IGFL 2R1WA 2DLHA 1N0LA 5C0EB 5GS1B 5GZNC 4PJEB 4W4NA 1TQCB 3UZQA 3OGCB 1FE8L 5I1EH 1AQKL 3PWUB 4O9HL 5HHOA 1S7WB 5F9OL 4D0BB 1T89C 4KQ3H 4P2RE 1CL7I 4DGVL 1BOGA 4BKLA 4H5SB 2BJML 1SM3L 5D1ZD 3R06A 4QRRE 4XI5D 4CW1B 1MCBA 2GITB 1TIUA 2X4NB 4KK5D 3U0WL 1HWGB 4GUPA 2WWKT 2R1XA 2Z4QA 1L7TL 3EYOB 1S7UA 3PXHA 1I7RB 3QQ4A 3QIWA 4ELKB 4Y4FA 5DQDH 4BQ9A 2F8VA 3EW3B 2XZQH 4DCQB 1I7UB 4QRQA 3QUYD 3ARWA 5I16B 3HNTH 3VWJD 4U7SA 3V2AR 5EU4A 4ODVH 1A4JA 5TE4L 1YEFH 5TPWH 1NGXA 5ESQA 4OCYH 1H5BB 2UY6A 4RIRB 4YGVB 5D5MF 4G8IB 1ZHNB 1QQDB 2NLJA 1MIEL 2X4QA 4M02A 4S1DC 1ETZA 3UJJL 4GFTB 5KAQF 3GRWL 1HYSD 2APXA 3MODL 4UILH 1S5IH 2ZCHH 3CDYA 5ICYB 5J12B 2YD6A 1LP9A 3X3GL 1N8ZB 4WU5B 2R1XB 1XF1A 4F7EB 2CR3A 2BY3A 4P2QD 4IRSA 5HJ3B 1FP5A 4JFEB 5D1QC 5F1NB 4YHNB 3RFZC 3LVEA 1P4BL 4DZBB 4K8RL 1AO7B 1GC1C 2VZVA 1G9ML 1PLGH 1JV5B 2B1HL 1IEBA 1UZ8A 3AU1A 1DJSA 4WU7A 5ENWA 1VA9A 3GSNL 3C87A 4YBHA 3GMNA 3KLSA 4JB9L 5C0RL 1WWCA 3JV4A 1I7UA 4HD9A 1P6AB 5JW3H 2F53B 1EGJH 4NM8L 4HFUL 3O3UN 4NFCA 2WM0A 3IAQA 1QVOB 1T2JA 4C56B 1YQ2A 4HWZB 4NZUH 2KH2B 3O45A 3RUGB 2PO6A 3RQ3A 5K33A 4DZBA 2J3SA 1NFIB 1I4FB 1KOAA 5DD6B 3HZMB 3NIGE 2XY2A 1XZ0A 1IM9A 1FAIH 3GSRB 5HYIA 2Z8RA 1MFAL 4XP4H 1T20A 3VRLF 2WUCH 1IGJB 5E6IC 4XP6L 3EYUL 5D7IA 5KSBF 2VITA 4MD0B 3B9KC 4K2UH 2PYEA 1IQDA 3LN5A 4FZEL 3WJJA 1KSRA 1GL4B 1MWAH 5E6IB 2N7AA 5IB2A 3ARDC 3CMOL 3D3VA 1SJHB 5I1HL 4NCC2 4X0KB 2UWEA 5D9SB 2E6JA 4P2OC 4HC1L 3DRTB 5IMMA 2OTWB 3CC5A 2YRLA 2ZCHL 2V7NB 1QBLH 4RFNB 3MRNB 3MBEA 3K80A 1NC4D 1WFUA 2CD0A 4WFGE 1DVFB 1BVZA 2O5YH 1DQLL 4LAQL 2Q7NA 1PAMA 4MA7H 2FYYB 1NCDH 3BO8B 4FFYH 5TJWK 3VGDA 1U6AH 1P1ZB 2YPLE 1T03H 5KBNC 1MFEL 1D5IH 1RZ7L 5L0QB 3C5JA 4KJYB 3ZTJH 5T5NF 1MH5B 8CGTA 2F54B 3D6GA 1BP3B 2A6IB 3ZO0A 1QYGL 4ETYA 3TGXA 2PYED 2WUBL 1MAMH 4ODWA 3SO5A 3TIDB 3MRLA 4LQFL 1EPFA 5CJQL 1ZGLP 3FFCB 4RISL 2XPGA 5CUSL 1EHAA 4AIOA 1FFRA 3G5VA 4U3XA 1KACB 2DIBA 4TSAL 4GOSA 4AEFA 2APTA 3RX5A 2NY5C 4X80H 5IQ9A 5EIIA 4F8QA 2XFXA 5DT1L 2VDOL 1IKFH 4ZAKB 3OJDB 1LO4L 2XKNA 3DJ9A 3LKPA 4ZODA 4NBXB 2VZUA 2N1KA 4P4KA 1R5WA 4HUNB 1ZLVH 3MRRB 1YN6B 5FYLD 5GGSB 4MA8H 1ZA6B 3TNNB 3QDJB 5EBGA 4N0RA 4XVJL 4FXGB 5AAWA 5JO5A 4ONFH 4JKWA 2WIIA 3BGMA 4KQ4L 3MZGB 3Q1SL 4LRNL 2MQCA 4HWBH 4WFED 2BXZA 3O6MH 5I15L 4OB5L 4M8QA 1FIGL 1B90A 4NC2B 4QHMA 3U2SA 4JRWA 1XCQB 5GSVB 3TCXA 3MBEB 2LVCA 4NQCB 5C0FA 4GW1A 2BSTA 4P48A 5J3HC 3EDJA 4NRXA 2W65B 4UIMB 3TN0C 3BKCL 5IW1B 4R2GB 2AJYH 3RIAF 5EBMB 1IGML 3MJ8B 2H1PL 4HUWA 3U9UA 3BW9A 1CZ8H 3QDGD 1NC2A 3Q5TA 3OGOE 2VL5A 3MRBA 2DJSA 3GDBA 2NY6C 5KVFL 4LASH 3MLZH 5FKPA 5JQ6H 1FGVH 2VQ1B 3H9HA 3T4YB 5J8OA 3GHBH 2UVFA 3Q6FB 1YN6A 3EO0B 3VRIA 3KWWA 3QUML 1S7VB 4WTZA 3QXAB 3VFMB 3DX8A 4GAJH 3TM6A 3S5LG 3MBEC 3RVTC 3UO1H 1MRDL 4QXGL 2JB5H 3C5ZA 1W8OA 2FH6A 3AM8A 1A9EB 4MJ6B 2E7BA 5LCVH 3TVMC 1QR4A 4D94A 5ICYA 3S37H 4MJIB 1BIHA 4ZQKA 3GMMA 3WEXB 3O6ML 2MMXA 3FONB 3K0WA 1NBZA 2EXYC 2DQHL 3OAZK 5F7UA 3C6LD 3CLFH 1B6UA 1HNGA 3WJLC 3C08L 2GK2A 3RKDD 5KVGH 1UZ8B 3LZFH 4J2XA 1MCQA 3DUSB 2X4UB 1F11A 2XTJE 4JHAL 4F7CB 2YA2A 1YEHH 4J3VA 1Q9OB 5F1NA 4XP9H 1OM3L 1I85A 2D7MA 2K3TA 2NXZB 1YEGL 1ZLWK 1MRCH 1JZ7A 2JJWA 5EUOE 4BH8B 2MHAA 3LN9A 3N06B 3REWB 4F58L 5FHBL 4OIBA 4LU5H 5C08B 3DROA 3KPOA 4MHHI 5FO7A 4F3FA 2Y36H 3DVFA 4MQ7B 3A67H 1LHZA 1S9VA 2AJVH 5ERWB 3UC0H 4JY6B 5F89B 1MHCB 2CRYA 1A9BA 2A0LC 2VDRL 3Q1SH 4LRNH 4QRSB 3DSFL 4GKZB 4Z7WE 2BVEA 2AJUL 4WDIA 5C0JB 4N8VG 1AFVH 1KTLB 5HHMB 3O8XB 2RCSH 3S36X 4FFWD 4XCEA 1Q9OA 2HWZH 1BM3H 3NIGF 1LWRA 2WBWB 3QUMH 3MPCA 1NAKL 2HKHL 3ZHKA 3S4SB 3IDXH 2AP2A 5JPMA 5BVPH 1Q0XH 1UACL 1OQXA 4YXKL 3M1BA 3ULUH 3P11L 1E6OH 3SJVD 1GHFH 2V5SA 1G7HB 1Q38A 4ZXBC 3VGGA 1RZ8A 2R1YB 2V7HA 2AK1H 5DO2C 2AGJH 2Y6SC 1QVOA 1YPZE 4C56A 3SDAB 1EBPA 4QO1A 1KXTB 1PSKL 3HE7B 3QNXB 3KPRE 4PGBB 4HUXA 5DF0A 1ZMYA 5FYLH 3B3IB 4FZ8H 3GUTB 4MLSA 5DWUL 5FGBA 2DLGA 5HSFA 2IBBA 4JFPA 4PBWD 2ZSVA 3ET9F 4U1MA 1OP3K 3ZKSD 2CIKB 4O2CB 2ZSWB 4HWUA 1J18A 2QV2A 5K93A 5M95B 1JPTL 3BDBA 5E8DL 5F97E 3U4BH 5GISL 4Z0BH 5I16A 1CL7L 1MFNA 5F7EL 2HVKB 5I15H 3LKSB 1DQQB 4LSDA 5A1AA 3MLVH 2E9BA 1HEZB 4BQCA 3DIFB 1QG3A 3ES6B 2DYPA 2MKWA 4R97B 5EUKB 3S36L 3QXDB 3KPNB 4XMPH 1HSBB 4YR6A 1JGUL 5E8NB 2UZYB 1NGZA 4LFHG 5FV2A 4HUXB 1HCFX 1B2WL 3BWUC 4KAQL 2QQQA 4IRZH 4GKSA 3UBXB 1YECH 3B5GA 2BC4A 4CL7A 3RA7L 3BEVB 4KUZH 3R4DA 1SMOA 1HYSC 2K7PA 4XNQB 5JW5A 1G7HA 3WKMH 1A21A 3B6SB 2QHRL 2NY2C 2VLME 1KG0A 1A3RL 4S1SH 3U0TB 4PB9H 4QYOA 1X6LA 3MNVB 4QRTA 3BEWB 1PZ5A 3JTTA 5CZXD 3SQOH 1WISA 4YDLB 5CD5C 2DM7A 4HJGA 3GGWA 5F9WB 3QAZB 2FX7L 4L5FH 1TLKA 1DN0B 3QJHA 2D0GA 4E0RB 1KLGA 5JUEL 5DHXB 1H5BC 2DBLH 1IEBB 3P0VH 4BSJA 4JRXE 4U1IB 5T1MA 4HT1L 4XB7A 1ZA6A 3GBMH 4PJ9D 1ES0B 3SJVA 4FQIL 4TYUA 2F54E 4PJDF 4HKBA 5E2VH 5FV1L 3PHQA 3RWJB 3MYJA 3QWQB 5I66B 3Q5YA 1WBZA 5IMOA 1PW3A 1IQWL 4PP1D 4JFOB 3IJSA 5M94B 4MCZA 3KS0H 1C8PA 4G42B 2XI9A 1RZKL 1CIUA 1FRGH 2E6QA 5J4MA 1NMCC 1R5IB 3MRCB 1G0YR 2Z31D 4DKFH 3HNSL 3O4LB 4F7CA 5E1AB 3CZJA 4PTTB 1REIA 2AW2A 4Y5VC 4NNYB 4EQ3A 5MERA 1EO5A 3RVWD 4S0SD 4C57C 4N0FB 3VFGH 1K4CB 1CDCA 4GW4B 3P4NB 5J89A 2DM3A 3ZYIA 5IHUH 1HDMA 3KLHD 1J0YA 4CVXB 4K3DH 4TQEL 1CFTA 1OAYL 3WEXA 4PRPB 1D6EB 1BGXL 3FT2B 4L4VE 5TE7L 4ZG1A 1AJ7L 3KJ6L 4FQ2L 5D93B 5HY9B 1LK3L 2HVJA 3C5ZB 1L7IH 3RJDA 1U3JA 3L6FB 5GIRB 3L7EA 4L8SB 4Y5YB 2RQ8A 3I9GL 1JF5A 3T0ED 1YEFL 1CXFA 1U8HB 3E1F1 1N6UA 43C9B 2R4SH 3O6LL 1UWXK 4HPYH 4TULL 1HQ4B 3TWCH 4FTVA 4KTDH 3BZ4A 2SEBB 3PWLA 1NAMB 1DQDL 3S5LA 3D87B 3IFOB 2ICWI 1GAFH 3MUZ1 2NNAA 2C1PB 3UCRA 1P7KA 3M17B 2XXMB 1TTFA 5FKAA 4WHTB 1PY9A 1ZWIB 1K8DB 2ORBL 1E27B 3IFLH 4PB9L 2VLRD 4YBQC 4NHUB 2BY0A 3V0WH 5L2JB 4PRAB 1CICB 2ZCKH 5IB4A 2J5LC 1S3KH 3W9EA 4G8FB 2IADB 2AJSH 4X6DF 5I74B 3TFKC 1A2YB 4ZPTB 4JFDD 2HJLB 4JKMA 1IILE 3LSOB 1XR8B 1AGCA 1MIEH 1FYTE 2EEAA 3E2HC 4KAQH 3H3BC 4JQIL 4PJ7F 3F7YB 1DANU 2AJZB 3TZVC 1GCFA 2P46B 2GI7A 1KJ2L 3ULUD 3KPSE 5CP3A 4PG2C 3CDGA 2E5EA 3O2DA 3QO1A 5CSZB 1FL3A 1Q9KB 2O5ZH 4TNWK 2H8PB 2E7CA 2C9AA 3RL2B 1Q72H 1INDL 2BNQD 3JTSB 1E4XL 1FLRL 3ZKND 5BZWB 4TN9A 3EOTL 3UTQB 3HAEB 1F3RB 2VLRA 4UOW0 4FQHB 1FYTD 3QIUC 1J8HB 4XGZA 4KVCL 3DVNA 4M1DL 1CXEA 3I6KA 2G2RB 4EVNB 4QRSA 5CLWA 3S8WA 1JGLL 1PFCA 2DIJA 3WKML 2YZ8A 1CXHA 4POZC 1MLCB 4PJCB 2IADA 4G8FA 5CIPH 4M3JA 4I1NB 3VU2A 3OL2A 5IVXF 1CU4L 3FRPA 5AWNH 1T7XA 3E3QE 2Q76B 1XGPB 5LAXB 5LJYH 5E2WH 1G6VK 3BIKB 3M45A 5BJTB 1DE4A 2GHWB 4N0UB 3W39B 4P46D 1AKJB 4GKSB 3UBXA 1KELL 3RWCB 4YXLH 2VDRH 1ZTXL 5DD0L 1YY9D 1FZOB 1M1SA 1BVLA 1AD9A 3WDIA 1LQSR 5EO9A 3ZSTA 3ORJA 5EA0H 2OTWA 5HHOB 1ZLUK 3V6BR 2NY2D 3DHJA 4L1HA 3GI8H 3OV6A 3MCLL 2VMFA 1A7RL 3HRPA 2D4DA 5EC2A 1M6OA 1AR1C 1BFVH 4LGSB 4NQDD 1G0XA 1YEDA 2P24B 5INCB 3WIIL 1A6VH 3SDDD 2IF7A 4MVBC 3WXVL 2QJDA 4ONOA 1OM3H 4BUHA 2ITCA 1IGJA 1NEUA 1CGXA 3LPWA 3MNWA 2BNRE 5SX4I 3W0WA 4DOHB 4KTYA 1SEBB 2VR5A 3HUJF 1TNMA 3BP5B 4Y7MA 2LABA 4ZFOB 3S6CA 1HIMH 4P4KD 3I50H 3ZE0E 3RWDB 4OTXH 5IB5B 2G60L 5CJXA 3O6FC 2BC4B 2AABL 3J7HA 5JNYA 4LDOB 1NDGA 4NQEA 3CX2A 5FCUH 3KYMB 1GYAA 4YWGL 4OUUB 1IC7H 4M5YL 1I3GH 1R5IA 4NO2A 4Y5VA 5FO9B 2Z35B 1QACA 4QXTB 2W9DL 4HIIA 2D7TH 1YN7B 3HB3C 1E0OB 3PGCB 4KRLB 4I48A 5DJ6A 1RUAL 3OJMB 1TVHB 3QXUA 4APQB 2JIXB 4JHBA 2BHYA 5BS0E 5ESAA 2UZIL 3EAKA 4PRID 4PJAF 1RUKL 4LCWA 1ES0A 3VXNB 3KPRA 2M8XA 3E6HB 5E9DB 5AYUH 4JFZL 1QBAA 4RGNC 3ZE1F 1N8ZA 4R0LC 3MRLB 2HTLC 2LU7A 4FABL 5J1TC 1HHGA 1MELA 3MGTA 4JDVA 4PUBH 4PJXF 4UDUA 2R0LH 5TF0A 4HXBL 1JMXA 3SDAA 1QQDA 5SWQA 1YJDH 4WW2A 5HGAA 5F21B 4DVBA 4XMKL 2HJLA 4OCWL 3U6RB 2G9HB 3DO7A 3HI5H 3QRGL 2E6PA 4LSPL 1BVKB 5A2JH 1BWWA 3VXSA 1O0VA 1P84J 3MYZA 1U8LA 4H0HB 3OKLB 1A7RH 1HOCB 3BMWA 3BP4B 5JHDE 1OTTC 5EN2B 1XF4B 5GRVK 4B7LA 3MJ6A 1V3LA 1VEMA 1OAQH 4HUVB 4JPVH 3RWFA 3BN9C 3UZVB 4NUGH 4S1RL 1I3GL 1RZIA 1V05A 2YC1A 2VN7A 2PF6A 2X70A 4OUOA 5L0QC 2DLIA 4MDJB 1HSBA 4J3SA 3PWVA 3WFEH 3ES6A 5K9OA 1PZUB 1BZ7A 4HS3B 4G5ZH 4YPGB 3UBXI 1URLA 4AEHL 5ADOL 35C8H 2FZ3A 3SGDH 2FD6L 3QUZC 4KROB 3WL9A 1R5VA 3D2UD 4I2XA 3V5KB 1NUFA 2XN9A 2BVQA 2DQIL 1A7NH 9CGTA 2X4TA 2HAZA 5EO0B 5MEPB 2YD3A 2CDEB 4MA3B 2R4RL 3RNQB 2BNRD 1KJMA 2AERT 4OGAD 2WLYA 4K7PX 1EAJA 4LVNC 4Y5XC 3WV0A 1BD2B 2HJFA 4R4FL 2VH5L 2DKUA 1MVFA 2WP3T 2LAGB 2ADFL 1FFPA 3NIDF 4Y19A 1NUDA 2ICEA 4NO5B 4X7TA 5F96H 3EOTH 2OYPA 1U2CA 3CH1A 4NJ9H 4G43B 4YHOL 2E8YA 5EUOA 1F02I 1TPXB 2WUBH 2X4UA 4WW2C 4XBPA 3MXWL 5D7LD 1M7DA 5F70A 2ZWLT 4LPCA 4QEGA 5DHYA 5D2NB 4LP4A 1AHWB 4YDJA 5C09D 3TWCL 4X99B 3U4AA 2DBJA 2FR4A 4QWWD 2ITDA 2FIKB 4EBQH 4JN1H 4N0CC 4NO0B 3H2WA 1JCKA 5MEOB 5D2LA 5C71A 1Z5LA 3K1DA 1EFXD 5H37G 4XZUA 3KYKH 1BBJB 3QSKB 5JIHA 3SDCC 3VE0B 4TTDD 15C8H 4TUJB 4BZ2L 2W9EH 1T4KA 3OG4B 4U1SA 4XC3L 4ZPVB 3GUTA 1KYOJ 1I3UA 1P4IL 4WI5A 4PGCB 1U58A 1H3UA 2J8UB 3LH2H 2O26U 5DK3A 2L7UA 2VC2L 1OGTB 3LOWA 4F57H 3H9SA 1U8NA 1RFDH 5I9QB 5BXFB 2P43B 4NIKB 5DMYA 5JA9A 3PQYA 3QCVL 2ICWA 4L9LC 3NABH 3HA0A 5CJXC 4P9HC 5ISZD 4LIQL 4P5KA 3NFPA 3KPQA 3MRHB 5E56A 4J1UB 2DB8A 5HYSA 3DV6B 1UWEH 4FFVC 5AZEL 2X4OB 4NKDB 3R0MA 1Q1JL 4XP4L 1NCNA 5C0AE 4IDLA 2Q8BL 4HAFA 4HKXA 4PLNC 1R0AL 4K94C 5CIPA 4MB5A 5E2UL 4AL8L 4EXKA 3C60C 5CZVL 4M1GL 3I9GH 1DSFL 3QDMD 4XAWL 2ED8A 5JW5B 1FO0A 3DBXA 1GVIA 3O6FD 1JYVA 2GJJA 1IC5L 5C09B 4GRWB 5L6YL 3ULVL 4BZ1H 4X7TB 3V79C 4X7SH 4UU9B 3QR2A 5C2UB 2BCKB 2RBLA 4JVWA 2X7LB 1NGZB 7FABH 4WEMB 4IS6A 4HIXL 2W91A 5KVEL 3L3OA 1OAUL 3PQYD 4OBRA 2SEBA 1J0IA 3HPLB 5HVGB 2BNQE 5T1LD 5IB3A 2Q3AA 1RHFA 3HZVA 3AFLA 3H9SE 5GGTL 2V9TA 3MRMB 1RU9L 5F7LB 2XTJB 4OLXH 4U1JB 5IF0A 3DYOA 2EDXA 3NFPB 4WI4A 4MB3A 3O81A 4NWTH 3ZT5A 5CEXB 4RAHA 5E2TL 2AEWA 4DTGH 4R7DA 4Q0XL 2QHLA 5IW1A 1J0ZA 4Z7NE 1A64A 2YBRA 3QIBD 5HYQB 3EO9L 3SPVA 3MV7E 2X1QA 2B4CC 5BS0B 3NH7L 4UI2A 3NA4A 3F12B 4AL8H 5D5ME 1QRND 1L7IL 4JG1H 4HFUH 5CEYA 4I5BA 5TE4H 1E4WH 1T66C 2OXHA 1CXLA 2XZAL 1BQLH 3UTOA 3STBA 3WO3B 3GB7B 2VR4A 5I8KH 4YHLL 4G6FD 4POYA 1IZJA 4KDTC 4F7TA 1AY1L 1H3XA 5BVJB 3PWNA 2FHCA 1U8IB 5AG9A 2W38A 1CLZL 3TN0D 3M8OH 4CUCA 1C12A 5D8JL 4BK5A 4HUUA 5ETUA 2EC9U 4Y1AB 5B3NA 4PJXA 5GGSA 4WY7L 1CCZA 5IKCA 5EORH 3DYPA 4JFOA 4MXQD 3PGCA 2J7LA 5KSBE 3MUGB 2M26A 4MNHA 3KPRD 4KHXH 2IEPA 4PRIB 2DTML 4HDIA 4ETQB 3TESA 1OSZA 3DVGB 3GIZH 3MFFB 4HIJB 2O61A 4P3WA 5GGRB 3GFUA 4D9LL 2B4CH 1EJOH 35C8L 4PJHF 5BVPL 3VFVA 5I1JL 2FIRT 4E41A 5T3XL 3ALPA 4PP2A 3HHRB 4Q9RH 2LVEA 1I1CA 4U1HA 3S5LB 3PL6B 2A9NL 3TIEA 4WHDA 3EJZD 3O3DA 4MCYA 1CL7H 4HIHB 3VMOA 4UNUA 3DSFH 3QH3B 2WANA 5SWQB 3FQWA 4WI9A 1OAXL 2APBA 4MZ2A 3QNZB 5IESH 1T2XA 1QBML 4L4VB 5GHWL 1ZVSA 4OCNC 3ULVD 1T3FB 3T0XA 4G6FB 1RK1A 1YEDB 4FZ8L 5HY9A 5FHBH 1WQVT 2KPNA 5IJKC 3I2CL 1FNEA 2X9YA 4LHUB 3X3FH 4P2RB 2R0WL 7CGTA 5E08H 3VW3L 4PJIA 5TF1L 4LK4A 2EKSA 3VFTB 3RGVC 2R4RH 4X7EC 2V2XA 2XWBB 4MJ5A 3P77B 3QQ3A 1ZT7B 4NQDB 4ZUTA 3LRSA 3MX0A 4X0KA 1UVQB 2B0SH 3QHTC 4HMCA 3ARFB 1TTUA 1NGWA 3TO4C 1A7OL 4BFIA 2FD6H 5KSBA 1F97A 1KENL 3DMMC 2XTJD 5HHOD 4DZ8B 5EZOH 4UIKL 1OT2A 2R56H 1YEJL 3MRFA 4P4KC 3T09A 5A16B 3ZSSA 3L5XH 3HN3A 2ENYA 2EH7L 1KGCD 3PGFL 5HHPB 1N7ML 3ROOB 4EQ2A 2VAAB 1R6VA 4N1CA 3V4UL 4PJ5B 4OQTA 4XP1L 3T2OA 2JCCF 1QPPA 4KRPC 4XNUL 3H7BA 3L7EB 3OKKA 3TYGL 4NQSA 4YIQA 3L1OL 4NJ9L 4AG4L 2XA8L 1AE6L 1IGTB 2YD9A 3BH8B 4G43A 4HZLB 4RX4D 1Q9LB 5LQBL 4D2NA 3TV3H 1RULL 1AP2B 5DGQA 2OR9L 4JR9H 4Y16C 2RHEA 3KPQB 2OJEA 3O6FB 1GGYA 1MLBA 2NXYC 3V6FA 4M7KL 3JWDH 4I0KA 5A16A 4ZFGH 2X09A 1J8HD 2CLRB 4OLEA 2I9TA 5IBLC 1Q94A 2OR8A 3DX6A 5HGDA 3PP4H 1CYGA 4QHKJ 4RFNC 1P2CB 3EKCA 4Q97A 2R2CA 4PJDE 4OLUL 2W0FA 4PV8B 2AQ1A 4PGDA 4NUGL 3VXRB 1J05B 2B8OT 1DDHA 4ODTH 1TVBA 1RPQA 5LCVL 3FQUA 5DD0H 4Y4KB 3QDME 2Q7YA 2H2PC 4QXWA 1V7ML 3MV7A 4OD2A 2QSQA 3D39E 2QSVA 2BDNL 1WICA 4DEPB 4XVUC 4JY4A 4OCWH 5F1IB 4C4KT 5ICZA 1R3IL 1W72L 2H9GB 2X89D 3MRDB 2RAMA 4U6YB 4PJGE 3MLSH 5DJYB 4YZFF 5KTEH 2BMKA 5LGHL 1OTSD 5J06A 4NQDE 4G7YL 4PJCF 5K9JL 4FRWA 3UTZB 1WEJH 2VLRB 4LF3A 1DFBL 2HFFB 2ZSWA 2BHUA 3BO8A 5D1XD 4M4PA 1T80A 2WWMD 1YNKH 4N5EC 4TSAH 4Y4FC 3PDGA 5ILTL 2RFXB 4PGBA 4UV7H 5D7LB 2PYEE 2XA3A 1IT9H 1KIPB 4MD5B 1QBMH 3CFBA 1GC1L 1TMCB 1UC6A 4XNMA 3HG1B 4H1LB 3VFMA 1RK0B 4ZOBA 1J87A 4AEIH 4Y0GA 3AB0C 1OHQA 2UYLB 2MCPH 1JPGA 4L8BA 5AZ2L 3O3EA 3B9DA 3FHAA 4Q6IA 4QXGH 4ONFL 3OB8A 4ZXBB 2XZCH 3RWGB 5JXEA 5IB1A 2Y7QB 1IC4H 4GBXB 2FGWH 2H3NA 1CVRA 2ZUQB 3MREB 5IB5A 3CFJA 1CICA 3KPSB 5C0ND 1RJLB 1JK8B 2IQ9H 1LE9B 2B4CL 1I3RA 3FQRB 4J8RB 1F3DJ 4D8PA 2EICA 3I6GB 1FSKC 5E2JA 2I07A 4Y4FD 1ZHBB 3D2UA 2NQCA 4YFEA 1BZ9B 5CEZL 2B1AL 3BKCH 1OGAB 3MGTB 2VZOA 4DVRL 1QFPA 2HRPH 1JGDB 4M8QB 1MQKH 4F37F 1FFOB 5C07A 3HFMH 5C2BH 1NUNB 4U1GC 3C6SA 3MCLH 3U7WH 3G5XB 4G9FE 5D7JB 5IB2B 1QLFB 1PY4A 3QEQB 3JWOL 1DBML 3IJYB 2FLBT 3VH8B 3EYFA 4WV1A 5HYEA 3C5ZC 2AK4D 1JTTA 1QYGH 4KK8D 5IBTH 3VMNA 3HRZB 1XR9A 4MAYB 4OBSA 4JZNB 1X5LA 3L3GA 5D7JC 1R3HB 5AYQA 3CVHA 1F6LL 1B0WA 3SY0B 2VDML 3BW9B 3SGEI 4WU5A 4LAQH 4PJGF 1T1XB 3CD4A 3N85L 1NLDH 2AXFB 2F5BL 4JM4L 2CKBB 5DD1H 5ANMA 4JM2D 5DJ2B 3VXQA 1V8HA 4JPKH 4H20L 4NBZB 1PBYA 3HCVB 2FJFB 4JAMA 5BMFH 1HINH 4WJ5A 1LO5A 5C3TA 5D7SL 1N64L 4X4XB 4RGOL 1F58L 3LPGA 2XICA 5GJTH 2XN9E 3TBWB 1HH6A 2JK5B 2R1WB 3V0WL 1BLNA 1FYHB 5E9DE 3GIVB 4P49A 4TNVF 4E41D 1AI1H 2O5XL 3OKYA 4HKZB 4XNYH 1F6FB 1NQBA 3PHOA 1A6ZB 3FO0L 2H6PA 4JN2B 1K8IB 3WD5L 4QT5B 2BNRA 2AJ3B 3EDDA 1N5AA 1IL1A 4Z7WB 2VUYA 1ZT4B 1CK0H 4H5SA 2NR6C 3MLYH 3MMEB 3WHXB 3NMEA 4U6HB 2ZUTA 1H3PH 5DEGB 2GK0B 5FAAA 2EE3A 1JZ5A 4Y4KA 1DBKL 3QG6B 3D85A 3TA3D 3ARSA 3W2DH 3T4AB 2HFTA 1JNJA 4WWKB 2JCCE 1DBJL 2BVPB 1RJZB 2XIDA 3QZWA 4P2CG 1DL7H 1E4KC 2ZPKH 1AXTH 1YEIL 1M05B 2D2OA 1D5ZB 5AZEH 4R6UA 3GB7A 5DS8B 3BIKA 3AY4A 3QIUB 3S37X 2XWJB 4Z7VA 1G9NL 4YE4H 3VDAA 3KPSD 2F19L 4LIQH 3U4EB 3UYRH 3ULVF 3SE4C 3MLPA 5HYSG 4ODHL 5C6PB 4F15C 2FZ3B 1X9QA 3UXFA 1TETH 3AROA 3TC9A 1W8NA 3O6KL 2JJUA 4XRCB 3M8OL 2ADGA 1D5MA 5C0IB 3BPLC 2A77H 4WDIB 1RZJH 4YDIL 2HP4A 1WCBA 5EBMA 1Y6MR 5FF6A 3SGEH 1WUNT 4PJEF 3QJHB 5F7FA 1FQ9C 4K3JL 4QHUA 3ISWA 4R7NB 1UM6L 1OPGL 2Z8SA 3ULVH 2X05A 2YN5A 2YD8A 3QNYA 1KPRB 3LB6D 2FH8A 3CC5B 4PJ9C 5CBAA 5CMAB 4GKNB 3ZHLA 1I9EA 2ADIA 3C5SB 4I0CC 2OX5A 2KBGA 1XFPA 4WU7B 5E2UH 5DSCB 5C0AA 3GSNA 1EGJL 4JHWL 4LLYB 2IMNA 1A0QH 2DI9A 1YEKL 4LF3B 4MCYB 1CFVL 4XWOD 2EH8H 3ARDA 2F15A 5TH2A 3KPMA 2ADJB 2KL6A 5IFHL 2IANB 1CE6A 4PJIE 2W0KA 3A6OA 4HKJB 4XCFL 4KROC 1XR8A 3MRDA 1L7TH 5JUEH 4H88H 5EOQH 3QG7L 1KJ3H 5CINL 1F6AA 1NFIA 3MLXL 5DUPL 4JGMA 1RFDL 3T3MF 5DJ8A 5HI4D 1MCFA 3FT3A 3OKMB 1SVCP 4NNYA 5D1QB 5I2IB 1NJ9B 4HCRL 3MCKA 3RGVD 2BSRA 3LB6C 1D5ZA 5B22A 1AGFB 1RURH 5ADOH 4ODBD 5B3JF 2DQUL 4NQTA 5I1IH 4FQLH 2O93L 3EIFA 4GRLA 2P48B 1CDHA 3WSQL 5DJAB 3PWNB 3GJFK 4YFLF 3QCUL 3BEVA 5CZVH 4P57B 1DQJB 3KPOB 5SWZD 4JVPA 1MCLA 3NACH 2HT3D 2DWDA 2CKBA 1NBQA 4I5BB 3WDJA 3UC0L 5J57B 1WWAX 5DFVD 3NCBB 3DGCR 1N5YL 4ZO6A 3WYRA 1XGQA 3HUJA 4V1DD 3DVIA 2VH5H 4X9BA 2PXYD 4KK6D 3L5IA 4F58H 2BJMH 5GGRA 3S88L 4X5XB 3RDTB 4I77L 1UA6L 4CVXA 2FCBA 2NY3D 3QEQA 4DKDC 2AK1L 2CUIA 2W65A 4PJCE 2VKXA 1SJVA 4OFYD 1MEXH 3BQUA 1KEMH 4KV5F 4OZFB 4DW2H 2IAMB 3DTXA 2BX5A 5KSAA 2LV4A 3UPRA 3W11C 4GAGL 2Z91A 3B3IA 1A6UH 2XY1A 3RWIB 1AC0A 4MNGB 3H9YA 4U3HA 3HE6D 4MQXC 3WFEL 3K4DA 5MEQB 3KYKL 4XMPL 1X5AA 3TV3L 4XCYB 1BEYH 3V7AE 2AVGA 4OLYH 4PV8A 2YPKA 3B2VH 1QUNA 2CH8A 4KDVA 5DEGA 5FM4A 3U79A 1PDKA 1KT2B 5TE6H 1G7JA 3GJFA 5DVLA 3L3GB 4Z8FH 2MCPL 2PTUA 4IRSC 4N68A 3TNNA 3OB0K 3DUSA 2VZSA 3ZL4L 3OAYK 1LEGB 4P2RD 2E9WA 5DZNA 5JQHC 4CADA 1KXQE 3ZYZA 5FYJD 4F33A 5F7MC 5I71B 4Q9QH 3MLRH 5LBSL 4K71C 1EUTA 1ZT7A 4NQDA 4ZUTB 5E6IA 3GSOA 4ZMAT 3UDWC 1YEGH 5FEBA 3VXTA 1FGVL 4EKXA 1F4YL 4Y4KD 5H94A 4DUWA 1G9NC 4FQHA 4XGZB 2MWCA 2LAAA 1QKZL 1Q8MA 3L95A 3ARFC 1JNLL 1YMME 4R90L 5HVHC 4UINH 1MJ7H 4GH7B 4JHAH 4GUPB 3RIFK 4CMMA 5GGRY 1BAFH 5C8JA 5E9DD 3UAJC 4E42B 3P0YL 1CD1A 4XMLH 1JGEB 3G08A 1J5OH 4W4OA 4D0BA 4U1NB 5LQBH 4X83A 1FL3B 1Q9KA 2ZCLL 5D2NC 43CAB 2GTZA 4GMTH 3BZ4B 3MRBB 5J1SC 4XCEB 2X4PA 4PJFB 5GHWH 2FB4H 3TBSA 4HF5L 1UXWA 1CXKA 5IGXH 4H26B 5FM8A 3O3AB 1MCPH 4P23D 4OZFA 4UV4H 2DQEL 3H42H 4P23A 4JY6A 4XBEH 3CCHA 4DUVA 3NCFB 4HGMA 4OF8A 4RGNE 2FHFA 5I66A 4OGYH 5E7FA 1D3CA 4ZAKC 2NY4D 2KQNA 5DR5H 1FFNA 1QTYT 5KVDH 1QFWL 1I7TA 1QSED 2P44B 5C08E 2P8LB 1MRCL 4QGTA 1HIML 4NWUL 4RRPA 3QPQD 1NFDA 4HXAH 4JFPB 3L3OB 4MVBD 2QQLL 3ZTNH 2FECI 3WHE0 3U36B 5F7DB 4PJFA 1I9RL 1P7QD 1M71A 4YXHH 4R4BA 4XRCA 2YXFA 4LSVH 2XTLA 2YS4A 4C55A 1ORQA 1MRFL 3C5JB 4KJYA 3OTTA 1E4KA 1JGEA 4LSSH 1KLFA 1JUFA 5DHVA 1TZIA 2GCYB 2ZG2A 5TGBA 4FFZH 2DYPD 4PJXE 1JWSA 4I3SH 3P9LB 4LCCB 4Y4HD 1X5KA 3OJDA 5JPMB 1UZ6F 1R5VB 3HB3D 4I2XB 4KH2A 2JCCB 2VDLL 3MGOB 5DJDB 1RZFH 5F93C 1RZGA 2VLKD 1IEAB 4HS6B 3EYSH 4J3OC 1TFHA 5B4MC 4J7RA 4M5YH 4Z95H 3QHZH 5GGSY 5ICXA 4LHUD 3EFFA 1RUPH 3T77A 3G6AB 3ME0A 4JG1L 3BKMH 1TJIL 2OM5A 4OM1L 5KANI 5KS9E 4U1JA 3V4VL 5FYKH 1FORL 1UCBH 4Y2DC 1D6VH 4D9LH 1JHTB 2L4OA 3WN5A 5C0DA 5IUSA 4G6KL 4K3EH 1NFKA 1AGDA 1QLRB 1I8LC 4GAYB 1DN0A 1VFBB 5HTSA 1QKZH 5INDA 3ULVE 4Z0XB 4O58L 3VXME 5GS1A 4LCWE 4U1LB 5FB8B 1T83A 4Z78B 4Y8AA 2IALB 2R0WH 1JMZA 4KKLC 2ZJSL 1E28A 2GFBB 4RWHA