5I1JH

Crystal structure of human germline antibody ighv5-51/igkv3-11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARYDGILDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
total genus 42
structure length 213
sequence length 222
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1jH01
1RUQL 3MUGB 4Z76A 5E5UB 4GG8A 2VDPL 4HIEA 3ZKQD 3PL6A 3TN0C 5IHZB 4WUUD 5ITBH 5IB2A 1BVLB 5MEQB 5KANG 5I8CA 2NY1C 1ZGLA 3G6JE 2OJZH 3V8CA 4DKAA 1S3KL 1KCSH 2UYLB 5FHAH 3O6FC 1TZHB 5KVGH 2FHBA 2YUWA 4QOKE 3R06B 4ONGH 3D3VD 5HGBB 1WV7T 4FXGA 2FYYB 3UTSD 1FL5A 4O2CB 1MCNA 1HHIA 1BQHA 1N64H 3GDBA 1I3VA 4WWID 3GMPA 12E8H 3O2VL 4O2EA 4CGTA 3WFHB 3TFKD 3O9WA 4FFWC 5HYJB 4TUOB 2OZ4H 3S4SB 3SE4A 3N1PC 5F9DC 3U0WH 3ECBB 1FIEA 5I8EA 1V3MA 2IAMB 3BH9B 3OR7B 2IBZX 4D9LH 2MPAH 4MA1C 2ZZUT 4MYWB 2NLJA 2A73B 5IW3A 4NC2B 1CCZA 1T1WB 2WINB 4DK3A 1CS6A 1S7UB 5BOPA 3VWKB 2DQUH 3TGXA 5KN5B 4Y2OA 2NW2A 2ZNWA 2P5WD 4WHYG 2R0WH 5KOMC 5F21B 4UTAL 4HDIB 5JORB 1NC2A 4X80L 4X4YB 5D71L 2MCG1 1JHTB 4Y7MA 4Y8DC 15C8H 1C12B 1P7KA 4PR5A 3OTTA 3LAFA 5SX4I 1CFTB 2APTA 3MLYL 5CBEB 5EUOA 2H1PL 2BOCB 5J3HD 1S9XA 2A6DB 1DLFL 2NY0D 4IRJC 4IDLA 3JWNC 2A6JA 5GJSH 1K2DB 4G8EB 4S2SA 3ZT7A 2X4OB 5CEZD 1NC2B 4DN3L 2Q8AH 2VJXA 3QEUA 2CLZA 1YEKL 3DYMA 2QQQA 4K9EC 5KBNC 5HHME 3QWOA 4ZYKA 1D5IH 1PAMA 2HN7A 2J12B 4P3CH 3QDGB 1A6TA 3HPLB 2F5AL 3IU4H 3HZKA 3QIWD 3HE6A 1N3NA 1QRNB 2NYYD 3MRCA 4Z7WB 5J4MA 4QOKA 4RFEB 3T77B 3BVNB 5T3XE 5I17A 4XX1E 3NIGF 5FCSH 2XPGA 5I1KH 4WGVB 1FFOA 2EH8H 4PJXB 1RZ7L 3FTGB 5I1EH 4LRNL 4ACPA 1MFCH 2PO6C 2ZSWA 1RJYA 1XR9B 1KEGL 1HQ4A 1RZ7H 1YMHA 3I2CL 2Z31A 1G9NH 1I8IB 5HHOE 3GMRA 4M7LH 2R0WL 4QXWA 4LVEA 1I7RB 4KV5E 4W68A 1OAXH 4NZDA 4NRXA 2CRIA 3PHSA 2V9RA 1Y6MR 3DECA 1CWVA 3TPUA 4XTRC 1NFIB 5FK9A 4P23C 4I0PB 3RZCC 3VXTA 3EJYC 1L9MA 3DSFL 5E7BA 1IZKA 4LHJB 5DD3L 1A3RL 2FIKA 1T0NA 3WUWB 5BQ7A 3S4SG 1DBML 1U3ZA 3WDHA 5E24E 4KXZH 1D5MA 5DWUL 2J2ZA 4L4TD 5TE6H 5DUPL 1PX3A 2WSKA 1Y0LB 3CUPA 3ZYIA 3SGEI 3EYVB 2QKIB 1NMBL 4RGNB 1ITBB 1VGKB 1KTDA 3GSNH 4J12A 5C0AA 5J7CC 5DJXB 3TO4C 2EEBA 3N50A 4TSAL 1FFNB 1UH4A 4L8CB 1AI1L 1C5DB 3CZFB 5I1HL 1HI6A 5HI5D 2PW1A 4K3HA 4Q2ZB 3C8HA 4JRYE 1RFDH 1D6VH 3B8SA 3ZKMC 1G6RL 5JXAL 5EFIB 4X98B 3C6LA 5JW5B 1WICA 1ADQL 3EOAB 5JIPA 4RA0C 1A7RH 3WFBL 4Q6IA 5T3ZD 1A1OA 3L3KB 5DR5H 3LZFL 3NABH 2XZZA 3SDAA 1JPTL 1DE4B 1DQQB 4ERSH 1Q9WA 3TT1L 4I2XA 2X4NA 2XQYG 3CVIL 4K8RC 5JQ6H 1I7TA 3DV4A 2IMNA 1OAQL 1U91B 4NQVA 4FTVE 5GRXG 1M05B 2PXYB 3QXAB 4LAQH 3EDDA 2JCCB 2JLLA 5CP7B 2AV1A 3BKJH 2I9TB 4JM2B 4LSRL 5F88B 3I3EA 1I85A 4S0TD 2N7BA 1ZA3A 2OS7A 5GXBB 1LP9F 1FLTX 4M61A 1I3UA 1KNOA 4M8QA 1CBVH 2J8UB 2FEDD 4KVCH 3O9WD 4TUOA 2WAHA 3O3BB 3RGVB 4TUKH 3UMTA 5IJVB 3D85D 1GCFA 4NM4L 1RUPL 4YBLB 2NNAB 2CK2A 4D0CA 1RVFL 1F3DJ 4PRPA 4XWGL 2X70B 4J3XA 5F7UA 5HPMB 1JRHH 4DOHB 4YDLB 3MRPA 2Q3ZA 4W4OA 3P4LA 1K4CB 3IFLL 3DHJA 1UJTA 3QR2A 3GMNB 5SV3A 1AI1H 4D8PA 4XCYA 3CSGA 2FHCA 4FFYL 3FT4A 1EO5A 3U4EB 4U1JA 2ADGA 2BSTB 4OLXH 1JI1A 3IFNL 4XMPH 4XRCB 3ZKND 4JRYD 3DURA 3DVNB 1Q1JH 2H2PD 5EBMB 1T5XB 2CD0A 4FZEL 1MLBB 4N8VA 5DFVD 5CP3H 3T0AA 1SJXA 1CL7I 4CNIA 4GRLC 4NN5B 3ILPB 4LIQE 3EHBD 5SV4A 4N8VB 1NLDL 3RHWF 2VDRL 3IJSB 2KKQA 3QAZC 3F62A 4YHNA 1VADA 2Z4QA 2VIRB 4WI9A 2OL3A 1CU4L 4NM8L 1WWCA 5TJWK 2C3WA 2X4PB 2CQVA 1MELA 5CD3A 4ZXBD 2VXVH 4PRAA 4O00A 4Q9RH 5C07A 2I07B 3QFJE 1LGVA 2NY3B 3MR9A 3WHE0 4DFIA 3A67L 1JHLH 2AXHA 3LN5B 4I3RL 3TEUA 3QEGL 4LF3B 4M7LL 3DOSA 2IH3A 5GGTL 2VE6A 4UQ2A 4P46A 4HCRL 1FC2D 5EOCJ 1AQKH 3VMPA 5FA3A 2HVKA 5HGDB 2P5WA 1NFDB 2CUMA 4GAFB 1OF2A 1S7XA 3QDMD 3TYGH 2K1MA 5ENWA 3S98A 4LKCB 1SQ2N 4K94C 5KW9L 3OWEA 1YYMH 2EDXA 3BGAA 3WIHL 5AWNL 4JFOB 4PD4J 5TF1L 2PR4H 5B39A 2UWEE 5C0RL 1S7SB 1JGDB 1T4KB 1HNFA 4JFZL 1L0XA 1P7QD 3C8DA 4N5EC 4R7DA 1P2CB 1I7UB 2X4UA 4HC1H 3VFTA 1VEOA 4AEEA 1IC1A 5FYLH 2BOBB 4EXKA 1BPVA 3U2SB 1UQSB 3I02A 4F8TA 1QSFA 5GPRA 1U8JA 3PGDB 4NHCL 4WU5B 3EJZD 4YXHH 2EH7L 5AD0B 3ZLQC 2P24B 4YC2B 3CPLB 3SCMD 4EZMA 1TJIL 4PJEB 4RMWA 1P84J 5I1EL 1ZLUK 3LB6C 2X7LB 4D94A 5CJOL 2A6KA 5JXEA 2AEIT 4JDTL 4P3CL 4XAWH 2VN7A 4S1RH 3CSYB 4F15C 4LPYA 4QHUA 4ZQKB 4QRPE 4AEIL 3BP7B 3KLAA 2KH2B 4L8SB 4Z7VE 1E6OH 2FATH 3C87A 4PJ8C 2X41A 2CXGA 4PJIE 2EE3A 5GS0H 2CIIB 3LN9A 2ESVE 4M7ZB 2NXZB 1A1MB 3FB6B 4JY4B 2Y23A 3QPQD 5F71A 1HINH 3RVTD 3QUZC 5FKPB 3MLTB 3STZB 2YSSB 1OD9A 1DANU 4MS8C 4WHTA 5HVHC 3VXSE 3WKML 4UV4H 5L6YL 3PP4L 4ZAKC 4GW1B 5FCUL 1OTUC 3I9GL 4RZCB 3P0GB 1U95B 4M1CD 4QXUL 4OLYL 5TF0A 1QA9B 3LV3A 4OT1H 5GRJL 2QLVB 4BFIB 3BPOB 4XB8A 1X4XA 1YEJL 1A6UH 5GRZA 2QBWA 3KAAA 4FQ1L 4B53A 3VD5A 15C8L 4JPVL 4G6FD 4DVBA 1INEH 2XA3A 1J0HA 3IKKA 2ZG1A 4O2CA 3VA2C 2A6IA 2W1NA 4XP6L 4YBQC 1H0DB 3Q6FB 4PJAE 1S7TB 5F9JB 4YUEH 3MV11 4XP4H 1FVDB 4PLKD 4LPWA 2VZVA 3FL7A 1P69B 4R0LA 3MZGB 3H3BC 4H26B 4NN6C 4G8FA 3D9AL 2Y4SA 4GKSA 3WL9A 9CGTA 3MRCB 3V95A 3NGBB 4GQ9L 4L4TB 4P5TA 5DK2A 2Q1EA 5HYSG 1I9IL 4EI6B 1KJ3H 5H35A 3IDUA 3KVQA 2HFFB 5MI0B 1QVOB 3C6LD 5C0DA 3MNZA 5A2FA 2NY4C 1H8NA 4MXWL 3VFRB 3P4NB 3BD3A 2VQUA 4XVSH 3RA7L 4S0SD 3O41A 4JVUA 1TVBA 4JFEE 1FJ1B 4OF0A 5JW5A 2XN9A 3GSVB 4RA3A 2OP4L 2FNBA 2DIAA 2X89D 4X6FB 1YEGH 1IRAY 1KTLA 3UO1L 4KHXH 1VFOA 3V4PL 4UBDC 3NZHL 3O3DA 5CMAB 1NANH 3QIBA 4BSJA 25C8L 3VRJB 4ZFGH 1FORH 4TTGA 5K59F 5EC1B 1T7ZA 3R8QA 2D4FA 1R5VB 3QNZA 1Q9KB 5HSFA 4X7SH 3LRSA 4RDQF 4GLRI 4XPHL 4ZFFA 3TF7C 5H37G 4OGYH 1WT5C 1K4DA 3HMWL 2GK0A 1LE9A 1SM3L 4L8BA 2R8SH 1D5ZB 5ALCH 5IFAL 5BMFL 4GRMA 5DUBA 5JTWA 1EFXB 3C6LC 4XP5H 5DI8B 4YHPB 3S36L 4F7CA 2F54D 2NY4D 4IIQB 1BHGA 2V5YA 3OF6D 5MENE 2DYPD 5ANMA 1IM3A 4KK9C 3THMH 5HHPB 4JFDD 2ARJA 1KIQA 2MFNA 2PR4L 3G04A 2UY7A 3ZT5A 3TBVB 1G6RH 5JXAH 3UTPE 5IKCB 1BZ9B 4HWBL 4GMTL 5F7LB 1CFQA 4FQ2L 2EDBA 2P8MB 3OAZK 3RL1B 4G3YH 4PV9B 5KJRH 4M43H 5FECB 3TP4A 1BOGB 4JRYA 4YDVB 2Z31B 1ZWIA 1II4E 1P4BH 3I50L 5D9SB 1JF6A 4WDIB 2QQKH 3NAAL 4PV8B 4WO4B 2QEJA 3SGJC 1S7WA 2O26U 3LKSB 4EQ2A 1V8HA 1U6AH 1F00I 4N68A 5I8OH 5I15H 4GRWF 3PWVB 4I8DA 1MCLA 3UZVB 5D7JC 1NH6A 5AEAA 4HZAA 4KPHH 2AJSL 3JZ7A 1SY6H 3VW3H 4PB0H 1NCCH 2R1YA 3ARPA 4JKMA 1NEUA 4JDZA 4JHBA 4TVPD 4WDIA 3SDCC 3QO0B 3MLWL 1PBYA 4K9EL 4WEMB 2VSCA 3OXRB 1S7QA 4OZHF 3SY0A 1TZGL 1H0DA 1GGUA 2K3TA 1QLRA 1K5NB 3FO2A 1UWEL 4KROB 3PDOA 1NGZA 5E0QA 1J0ZA 1S7VA 4PTTA 4LOUD 2DRUA 4DZ8B 4Y4FC 4OZHB 1KCRH 2X1PA 1MNUL 3DMMB 3KJ4B 4N90E 4BK4A 4C59B 1NEZG 1CFTA 1FLRH 3MLSH 3QIUD 2WBKA 1XGTB 3VFMA 1A6ZA 4HLZH 2E7BA 1FVEB 5DZLA 35C8L 2V7HB 4RBPK 5D93C 3MRFA 1ZA3B 1P84K 5IEKB 1DN0B 1EEYB 4XP5L 3QUYC 1QLEH 3IRZA 5KVDH 1NCUA 2NY5H 4AENA 5JLZB 2V2TA 2PYFA 3MOBH 3CFKB 5IK3B 2ZWLT 5DEGA 1A7OH 3TWCH 1KYOJ 2NLJB 5HXMA 5A2IH 1CXFA 2PNDA 3TH4T 3S96B 5JMOC 1L4IA 4HH9B 5DJCA 4XVJL 5JW3H 3UTZA 3IETA 3F58H 1F11B 4MHHI 4NQED 3GMLA 3I9GH 4KQ4H 1J0KA 5FO9A 3RDTD 1A7PL 1DQLL 1H3WM 1V7ML 4LOUC 4JRWA 5C08E 5IWLC 3SQOH 3DX8B 4LSQL 4M48L 4MDIA 5E03A 4G9FA 4LHUD 3RNQB 5HI3C 2AJ3A 3ULUH 3L7EA 5K9OA 1FDLL 3OAZH 1XR8A 2AJXH 2DQTL 2CDGB 4EUPH 1IC4L 4YHMH 3ARFC 5D2NE 3QCVL 3DHMA 1NCAL 2MOVA 5KSBE 4GH7B 1T0MA 3G5YA 5D1ZD 3TM6A 2AQ2A 4JY5H 3N9GH 4U6YB 4D0DA 3RZWA 1FNGB 2QSVA 2JJWA 5FM4A 5IMMA 1DUYA 4NO3B 3K4ZA 5GZNC 4N5ED 3IJYB 2IBBA 5DS8A 5J3HC 5ACLA 1MIEL 1CDIA 5SWSA 5T5NF 3BPNB 2XXMB 3WIHA 3Q1SL 2NXYD 2XZAH 3QEHA 4WIQA 3ARGD 3L5XL 4RCAA 4QHLA 3RUGF 3TCXA 1IKNC 3GI8H 1ZWIB 3QUMB 5HI3D 3V79C 5HDQH 2YMXL 4JLRB 3IF1A 1AXTL 5KAQF 1HKLL 2R2CA 5I19L 3U6RB 1SMAA 4Z5RA 1BVKA 1H3GA 1UM4H 1ZHBB 3D69A 5J13B 1OP5K 1XF2B 3VXMD 3MA9L 3CSPA 3HE7D 2ZUUA 4P2OC 3KPMB 5C0EA 2L4OA 5ISZB 4BQCA 1N5YL 4Q9QL 2R1WB 2I9LB 3GO1H 1I1YB 4ZXBC 3VXOA 1BD2B 3KS0J 2FWOA 1AC6A 4IHOA 4JFFE 1X5AA 1FFOB 1NCBH 1QSEB 3MUY1 4HBCL 1FZJA 4ZUVA 1EVUA 2FJHB 3UPAA 3PIQB 1MCOL 5KOVC 1LO2H 5F1KC 2E6QA 1SJVA 3MRJA 1R3JB 1KB5H 3KPRD 1AD9A 1RZKC 2VQTA 3GIZL 1FPTH 1AIFA 4A6YL 1GSMA 3BIBX 2XG5A 2H3NB 5FFLA 3G6AA 2OXGA 2QR0B 4H20L 1DSFH 4I2XE 4XPHH 3MJ6A 1G6VK 3U7AA 4KKLC 5D70H 2H32B 5DA0B 4X9BA 5T1LB 1KTLB 1I7ZB 4MAUH 5DVMA 1WZ1H 4G3YL 1T21A 3IGAA 5C08B 4X4ME 5FYKD 4XXCC 1DZBA 2CKBA 1UJ3C 1IE5A 1XF3A 4OBRA 3QH3A 4XCEB 2DJSA 4JKLA 3QA3B 3B8YA 5ESAB 2DWEA 2RHEA 5T3XD 4MAYD 1D9KA 1WQVT 3OKLA 5TDPB 3LEXB 4QRRD 1I3RB 4UILL 2CSPA 3IFPB 4TNVK 4UQ3B 3LQZB 2Q76B 4DQOH 4G6JL 5D2NC 3U7YL 3WNOA 4NCDA 2Q6WA 5C2UB 2J8UE 5BVJA 5DI8A 5EO1B 5IFAH 5L2JB 3U36B 3CDGB 1MFBH 2ZPKL 1I9IH 2FX9H 3IDNA 1U8HA 3WS3B 2I5YH 1F58L 4UINL 4XH2A 2VR5A 5HHOD 2F5BH 3KWWB 2UZYB 5GGVH 1LD9B 3S34H 4AL8L 3ARBC 5C0CE 2IQ9L 1RQ5A 4WU7B 4DOHE 4NGHH 5C70A 4JN2A 4XB7A 3HE6D 4X7TA 5JR1H 3CFEA 3E0GA 2LV4A 5HY9A 1HYRC 1L7IL 5I16A 3BDYH 3QUML 1QG3A 4YDLC 3QIUA 1MF2L 3HAEH 1T20A 1U3YA 4XGZA 5ITFA 1JGLL 2VZ3A 4H8WC 3IFNH 4ZDHB 5I1AA 4X5XA 3P11H 1FV1A 2IFFH 2V9QA 2F53A 2W92A 5L2KE 2FD6L 5DEZA 4G43B 4FZEH 4P2QA 4UT9H 4PRBB 4H1LG 2WZPD 2Z31D 4PJHB 4P2RD 3V6FA 4HMEA 1PLGH 5IIEB 1HXMB 1IZJA 2VLRB 3ARUA 1JZ5A 1NGXA 1XCTA 3UTQB 4HUXA 4GKZB 1AHWA 3FO9A 1T0PB 2VO5A 4FQJL 2EYRB 3AXLA 3P2TA 4P0DA 5E8EB 1Q9LA 4HIJA 1AHWB 3FO9B 4JPKL 4POYA 4LLYB 5DVNA 1SMOA 4X6CE 5HDBF 3F7YA 4P4RB 5DD0H 1RK1A 3LH2H 5CUSL 4BYHA 4QRRE 5E2WH 3CSYA 4XWOC 4V1DB 4XHQA 4M7LT 4ZS7L 5CEYB 5EOTB 3VI3E 5DLMH 2FIKB 25C8H 3MNVA 3AM8A 5DK3A 3VD4A 1U42A 5T3ZE 4U1HB 3GMNA 5SWZB 4FG6C 1RMFL 3ZE0E 1Y6NR 1BQSA 1NFDE 2OBGA 1YJDH 1KGCD 2YWZA 3SKNA 1BZ9A 1TJIH 1ZS8A 2MPAL 4XNUH 3TBWB 2A38A 3UXFA 3BKJL 4IBLT 4QCIA 3OQ3B 3HPJB 3PHOB 3V5DA 1DBKH 3X13B 3MRRB 3NPZB 2AJVH 2HJFB 3L3DB 4AIXA 4HJJL 4KJQC 4ZG1A 2VABA 3T0EA 3ARED 4XZUA 4OZGF 4WWKC 2RB8A 3C60B 3FT2A 1KJVB 2C9AA 3HI1B 4UT9L 1K4DB 1CXLA 4U3XA 4AK1A 2UWEF 2R0LH 3LRSB 5D6CA 5C09D 1ZT4A 5LGJB 3D39B 1TZGH 1UG9A 3S97C 3VFVB 3WFEL 4GKOA 4G7YH 3TCLA 1MAMH 3FRUA 3ABZA 1MF2H 1TQBB 3PGCA 2X6MA 5CCKL 4MMZC 4LSTL 4I0CC 3E1F1 1M7XA 2G60L 4WTZG 1OOAA 1EO7A 1NEZA 2VISA 4JDTH 4KPHL 3U4AA 5IFJB 1ZVSA 4YHOL 3HC4L 2XIDA 1CFNB 4CMMA 4PJDF 4DKFH 3T2OA 5IVZA 1PD6A 2DLTA 4TVPL 1DDHA 1HXYB 4QYOB 2EDOA 4KJQD 3HR6A 4OLWH 4F58H 4HWZB 3D85A 3MRHA 3KPRA 4WI7A 3MRIB 5I1IH 2VLLB 2B1HL 2V2WA 2IC2A 3IVKB 3QT2A 3DSFH 4E41D 3VA6A 3QZWB 1A4JA 1A7NL 3WFDL 4PLKC 2NXZC 2NY5C 2PTUA 5E2VH 2B1HH 4H26A 4X7EC 2Y07L 2FZ3A 5BOZG 4NUJA 3TT3H 4LDOB 5LGHL 4OJFL 3MLZH 5I74B 3L9RB 1T1ZA 2ICCA 3QDJD 2DAVA 1JWSB 4OFKA 1WBXB 2LU3A 3PWJA 4RNRA 1GC1C 2VLKB 1YECL 3L6FB 3DUHA 1QFOA 4PLJC 5A16A 3IDXL 1JZ8A 4PJ7A 3GSQA 5I6XB 1NL0L 3D69B 4NZTH 1I1AA 4DWHA 1GIGH 4Z6AT 4JPWH 4JGUA 4QRRA 4F3FA 1ZEAL 4P59H 1KTKE 2VDLL 2BSSA 3UZQA 4BSVB 3BDXA 2BVOA 3SDXE 4M6AA 1KBGH 4BSWA 2AW2A 4S10A 2HTLC 5HGBA 3DRTB 4BSVA 4XNZC 3O6FB 4M8QB 3HMXL 4ZXBA 2XKNA 1M4KA 4F80A 3T1FA 3NCEB 3WO3B 4DN3H 2IBZY 5HHOA 1JVKA 4HBCH 3RWDB 4Z0BH 3N85L 4HV8B 2P5ED 4P4KA 4MVBD 3WN5A 2FL5A 2A1WL 4L8BB 1JNLH 1E4XL 4OKVB 1VEMA 1QSED 5ALCL 4CNIB 3WFEH 3B9DA 1R5IA 3FRPG 4BQBA 1IFHH 5BV7C 3KPRB 5L88H 1AJ7H 3PV7A 3QEQA 1DSFL 4E41E 5D6DC 3C6SB 4EUPA 1YNKL 5FOBB 4ZYKB 1HSAB 3BH8A 3O4LD 1IBGH 1AXTH 3CVHA 4R4ND 4GBXB 1T66D 1GXEA 4TVSa 5CZKA 2YD5A 4MAYA 4X8JA 4QRSB 3NABL 5L7XL 4OQTH 4GRWH 4QHMA 1K2DA 4G8EA 4O51B 2VZTA 1ZT7A 1JIBA 4Z7QF 3ZDXE 4AH2A 4WFHE 3QUXA 4NC1E 4HS8L 1OWRM 2XTJC 4OCMC 1J18A 3LKQA 4KAQL 2IANE 5INCB 2COQA 5I66A 4XNMA 2MCPL 5I1CH 2WIMA 4WJ5B 4Z8FL 3DX7B 2ESVD 5CD5D 2PN5A 2IANB 3VFSA 1I1CA 1C5CL 4JG1H 5TGBB 5JHDD 5ECJE 1U8NA 1IL1B 2Y7QB 4AT6B 3RWFB 4D9RD 1N0LA 3V4VL 2DN7A 2QSTA 2YPLA 3E3QC 3O3AA 1IJ9A 1R24A 2DLGA 5DD0L 4DFHA 4Z7NF 5GS0L 2GY5A 2NYYC 5BXFB 3IS1X 2CGRL 2O5XH 4HSQA 4ORGB 2DQIH 3VXTB 2XT1B 4XPGL 2P5EE 5DJYA 3CZJA 5EBLB 4HWEL 4G8IA 4QTIH 5GRUH 3WDJA 3F5WA 5AG9A 3RVUC 3MCKA 1HILB 5DGQA 1IL1A 3H9HA 4PLOB 1FP5A 5BCAA 2BDNH 5TE4H 1LVEA 3SKJH 4WEUD 2W0KA 4G6KL 5EBGA 4ZSOA 4BH7B 1KIRA 3MGOB 5EIIA 1CLCA 3VXUA 4Z5RB 1OQXA 3IJSA 2DIBA 2DB8A 2Y9RT 5CILL 1UB6B 4Y4FA 2AXFB 2W0PA 4M6NL 4QHNA 5FOJA 3S3SA 3QAZB 3OKEB 1E27A 2XFXA 3H0TA 1BAFH 4JQXC 4ODWB 5GSVB 3PWNA 3D18B 1Z9OA 1Z3GL 5DD5H 4HXAH 4PGJA 5B38B 2IQ9H 3QIBD 4KQ3H 1V05A 1M71A 1KCRL 4XXDA 5TF1H 3OB8A 2IFGA 4WW1B 5DWUH 4XC3L 4HG4J 1AQDA 5HJ3A 2MSPA 4CW1A 3BYTA 4WW2C 1OTSD 3PWNB 4GW4B 4NNXA 4DJMA 1DQJA 1Q9OB 4IMLB 2BERA 2IFFL 5HPOA 4HCRH 5HHXL 1YEKH 2LQRA 4L29A 3KHQA 1W2KT 3OKKA 2DBJA 5IKCA 1QYGL 4GFTB 3TYGL 1W72A 3NFSL 1A6WL 1G7QB 1NL0H 3WSQL 5CINH 2E7MA 4OUOA 4L3EB 5EWIL 4MD0A 4R96B 2GTWA 3RJDA 1AY1H 2JTDA 5FO8B 4MD4B 3HC3L 1CG9A 5C0RH 3ELAT 3EFFB 2B5IB 1BFVL 3B9KA 5JDSA 2XWTB 4FA8A 4Z7NE 4GW5A 2XA8H 1JCKA 3MUJA 1I4FA 3LS4H 2FO1A 4PJAF 3EO9H 4GMTH 3W2DH 1GH7A 2VAAA 3WXVH 5BO1L 1IAKA 1MPAH 1CIUA 5EULV 8CGTA 4ZAKD 2FGZA 3QZWG 1JGEB 2ATPA 3GNML 2AEPL 2X44D 4M1DL 4M1CC 5E70A 5GS1A 3HNVL 3W0WB 4LCIH 3X11B 5F7EH 4JO1L 4LEOB 1OAXL 5DJDA 5DK0A 1NBVH 3O45B 1N7MH 1TJGH 5TFSH 5C07B 1F45A 5E2JA 3SE8H 3MJ7B 4DKFL 1G7IA 3MJ9H 2HKHH 2VXVL 2VDKH 1U8MA 5GGSA 4AG4H 1OHQA 3VI3F 2ICEB 4EDXB 4TSCH 3KHOA 4YHNB 3ESUF 4LGRB 4J1UA 1EZVY 3EUUA 4LVNC 2W38A 4IMLA 3PJSB 1EHLH 3DXAD 4E5XA 4LLMB 3VWJA 3QXVA 2XN9B 2BHYA 3CFCL 4R4FL 4HKBB 2GSGA 3RWEB 5DJ0A 3UYOD 4CRPA 3MLZL 5F7KC 3PP3H 4S1QH 3ULUD 4HLJA 3QI9C 2ZOLB 3MROA 1WLHA 3QNYA 4U2ZA 1A14H 1YEFH 4L9LA 1N5AB 4FN0A 4JVWA 3UJTL 3VFPA 2W60A 5IP4A 2XRAH 1YEJH 3KXFE 4OF6A 3QUXD 1GHFH 4Y1AB 1FH5L 3EYSH 1DTUA 5CBAA 3LIZL 1QBAA 1S7WB 4XC1H 4YR6B 4KQ4L 4OB5L 1RHFA 2JIXD 4R0LC 2ESVA 1DUZB 4NQTA 4RMUA 2EEAA 1Q94A 3MV8D 2FX8H 3SHSA 4ZXBB 2AK1L 5T1MA 1AJ7L 5E94B 2QQLH 1WJ3A 3FONA 5GGUA 4NQEA 4NO2B 2GJ6D 3MLUL 5IFHH 5HYIA 4KDTC 2IPTL 1MWAH 4LEOA 2BC4A 3PL6C 3GKZA 5EOQL 2GIYA 3VXRE 1M7IA 1ZSDB 2VXUH 1H5BB 1T7XA 1T2JA 3OJDB 1CLYL 2EC8A 4G8IB 1Q0XL 3KJ6H 4ZPTB 1JGUL 1QRNA 5E4EB 1OM3H 3QQ9C 2E9BA 5C0AD 1T03H 4K3EH 2KBGA 1F02I 1E4WL 1W0WA 3CSBA 3FQUA 5IB4B 2OCFD 1HOCB 1G7PB 5D1ZA 5I1CL 4MQ7B 2FR4A 5FM8A 1U8QA 4KKBD 1A7OL 3RZCD 3CC5A 3O3EB 2R4SH 1F3RB 4N8CH 1LHZA 4HKXB 5ADOL 1X3DA 3UBXA 3VFGL 3RWCA 1LO0H 3D0LB 4M4RA 2HAZA 4JQVC 4IOIA 5C0CA 5ICXB 1MQKH 3VXUD 2D7OA 3CCHA 5CHNA 1WF5A 3BEVB 4ZD3L 3UJJL 2EKSB 1JNJA 1QSFB 32C2A 5JHDA 1YQ2A 3QG6B 4YHZL 4Z77B 5I1LB 3FFDB 5CBEA 1RZJH 1KJ2L 5EO9A 2XI9A 3VDAA 4HC1A 2BOBA 5C0GB 2C3XA 3HG1B 4G6MH 4PRBA 1CVSC 4O58H 3ZKNC 3AUVA 2YPLD 4WFGE 1T21B 3PWPE 3GSOB 4LQFL 1E28A 3I6KA 5I1DA 5DJAA 3BQUD 5AD0A 3HG1E 3FMGH 2UVEA 4PJFA 4RGMB 5BRZD 5LAXB 1NAML 3MGAA 4AL8H 4ZOBA 1T20B 4XBGA 5EH1A 4NN7B 3B3IB 5CP3A 2HFGH 4R6UA 4CADB 2MHAB 3B5TA 5D1ZB 2ZSVA 1RZFL 1Z0MA 3QFDB 1FZKB 1FGVH 3KPQA 4TYUA 5T5NG 1QFPA 3HMXH 4XAKE 4B7IA 3VDBA 4HK0A 1W0VA 1HH6B 2AJUL 5D2LB 4K2UH 3S4SA 1RIUH 1N59B 3P0VH 4PG9A 3VXME 4LLQB 3MRQA 1DLHA 2W65A 2R56L 4MSWA 1WWAX 3VD9A 5JNYA 4JGJA 4GAYB 4ZMAT 1IFHL 1L7TL 3ULUC 4K9EH 7FABH 2NX5D 5DURB 2CDEB 2H2SD 4Y4FD 4JFFD 1FNEA 3LQZA 4M1DH 3KPNA 4KC3B 3EFDH 3TLRA 3PV6A 4U1NA 3T4AB 1DVFA 3CH1B 4PJXE 4CVXA 3ULUE 4XT1C 5DMYA 2QL1A 1Z2KA 1TVHB 3QUXB 4JQIH 1R5WB 1K6QH 2NCMA 1BVLA 3HC3H 3N0PB 4J3VA 4JO2H 1OGTB 1OPGH 3SKUD 2IF7A 3HUJF 4MJIA 4QRQB 5D7LE 1F4YH 3AREC 4GRWE 4NYLB 4PRAB 1XAUA 4IOFD 4M62H 2CK0H 4OCRL 3HE7A 4KTDH 2YRZA 1JHKH 1HHJA 1CGYA 2P49B 2AEQH 3BGMA 1HHHB 4PGBA 5CKAA 2Y7QA 4AT6A 4HHAA 2VXQL 4JFXA 3MUHL 5EDXA 3WD5H 4V1DE 4PJFB 3NH7L 2KQMA 1Q9LB 1JZ4A 4QXTA 2PF6A 4CDGC 5JOFA 5IESH 5DC4B 3ZYJA 1MRDL 1JPGA 2ERJC 4LRIA 3V52H 4XAKD 2FBJL 3JWDC 2EECA 3W2DL 1TTFA 2FLBT 3DXAA 3AS3A 5AUMB 1LEKB 1LEIA 5MI0C 4KKLD 3BRDA 3DUUB 2DQTH 1G6RB 4Y88A 1ZGLM 4XVSL 5EZIL 1EK3A 4JB9L 3FFCD 2R0LL 4C4KO 2OZ4L 1KELH 1XF4B 5FYLE 1IKFL 4ONFL 1Z3GH 3LPFA 1KPVA 4LIQH 1A0QL 4M5YH 1UKSA 1KFAL 3C08L 5EBLA 3G08B 2AJUH 3WYRA 2BNQB 3RVTC 3EGSA 1AGFA 4J2XA 1Q9KA 1A7RL 3G9AB 5B38G 4G7VH 1IC7H 4YHPA 3O3AB 1P4IL 2PXYC 1A1NA 4G8GE 1A6VL 1FFPA 2F8OA 3HTLX 4QNPE 2AV1B 4ZUWB 2UVFA 4OD2B 3RVXD 4DEPC 1U8KB 4JFDB 4PRIA 2CUIA 3I6KB 3HLAA 4BZ2H 5I1DB 4MNQE 2VLLA 5JXED 3P4MA 4KFZC 4NO3A 5F1SA 3O2WL 1W72L 2CLVB 3I3DA 5I75B 1TMCB 1UM5H 1X7QA 1T0MB 2IMMA 4AEHH 4ZD3H 5DJ6B 1QRND 3FO0L 4XVUC 5BS0B 5C86A 1KIUA 1YUHB 1WFOA 2GEEA 2DL9A 2NY7H 3SDAC 4XNXL 3Q5YA 5DRZA 2AK4B 5I1JL 1KJ2B 3LN4A 3BEWA 4IRSC 1I7ZA 2J3SA 1XT5A 1GC1H 4JCLA 2R9HD 2X4TB 4LLUB 3RIAF 5KVMC 5T1DH 5FDWB 4P2RA 5ESVB 1ONQB 2JIXA 2NX5E 4HQQH 2WUBL 2R29H 5F89A 2GJZB 3N1MC 3ARFD 2BNRD 2GITA 5H2BB 5FYLD 1NGPH 1ZKAA 3T0ED 1UT9A 3TVMD 3QHZH 1T5XA 3TV3L 3LQMA 1MY7A 1U3HB 2XA8L 5IW1A 1UXSB 3RPIA 4NRXB 4XRCA 4JFYB 4Z78B 5MERA 3SDDA 3VU2A 2VLJD 4KK5C 4LHUG 4PRDA 4Y5XB 3WUWA 1QA9A 1IEAB 5DMKB 1IGYA 2E7CA 2APFA 3MOAH 5E1HB 1M6OA 2NW3A 3M8OH 2XWJB 4YEEA 2FCBA 4DAGL 4RWHA 4UNVA 5DMKA 2BRRL 1MFNA 1QZ1A 4AMKH 3WXWL 1A7BA 2PTTA 1SJEA 1MVUA 4MNHB 2AQ3A 4RQQB 3V6ZB 4ZUUB 2ICWJ 3ARGC 1BBDL 4PJIF 2NY3C 1UWEH 4HS6B 2XWBB 2YHGA 3S35H 5F7DA 1U95A 4ALAL 1X4YA 5DXWA 3S7GA 1IAOA 3B5HA 3D25A 4UILH 4KJYA 3L3HA 3MV7E 1CZ8L 5B4MC 4GG6A 1HYSC 1IILE 4HKJB 4Z0XB 1CXHA 2N56A 3FB6A 3HE7C 2RAMA 5GGSY 3SBWA 3U30B 5C0NC 1J12A 4NC1C 3C2AH 4YE4H 3AREA 5TGBA 1XGYL 2VABB 3RWHB 3QUYB 5LWYL 5KSUB 2P8PB 1GOFA 2VH5H 4OZIE 3IFOA 3MRMA 4HUXB 4E42A 1XGUB 3O2DA 1DVFC 5IBLC 3ZZ1A 1A7QH 4EKXA 3PL6D 2HN7B 2CXKA 5EO9B 5HHVL 3RTQA 3K80A 1UACH 2BNRE 1HWHB 3STLA 1NC2D 4MCYA 3QJHA 3MYJA 1X6NA 4JG0H 1BIIB 1YMMD 4QLRA 5GGQH 4J8RB 2P8PA 3RNQA 3GHBL 4P9HL 5D1QD 2P7TB 2F15A 1MCRA 5I71B 3QDJE 5D7JD 2C4FT 5D1XD 3UTSA 3LY6A 5TE7H 4P9HH 4IS6B 2CKBH 1NCCL 3Q6GH 2E9JA 4WUUE 1XGPB 4NQXA 3CFEB 3VXPB 2NMSA 4R8WL 4BH8B 1ZMYA 2RCSL 4FQIL 4WENB 2AEWA 3SOBL 5D6CB 1BBDH 2EE6A 5CEZE 1W8OA 1GZQA 5IVNA 3NCJH 4UU9B 2R4RL 3SE9H 2QADC 1PVHA 2PYFB 5C7XL 1DVFD 5CILH 3VRIB 4FG6D 4JHZA 4X80H 1QSEA 3QJFA 3C5ZB 3K2UH 2BZDA 1BFSA 1OF2B 1EGJA 2A73A 3J7HA 3MRKA 1PG7H 3UEZA 4HWUA 1MI5B 1SYVA 2ED7A 3KPMA 1G7QA 3QEQD 4JRXE 4LSUL 1XEDA 2ITCB 5ETUB 3QA3A 1Q94B 4OLZH 3VXRA 4QRUA 1JYWA 4UIKH 2VWEE 2HT3C 3U6RA 4PJ9A 3BPOC 3EJYD 3LV3B 3O6KL 3KG5A 2WNGA 4LLWA 4N0CD 3G6JA 4BUHA 5B8CC 3QNXA 1YPZF 4LARH 1I8KA 2BVUA 5FUZL 3ULSA 3IAQA 3C8KB 2OTWA 5FUCC 5DHVA 4PPTA 3MUGA 4R2GD 2XZCH 3E6HB 3RKPA 2ITDA 4HHAB 5KS9E 4DN4L 3KYNB 3F58L 4E0RA 4XH2B 1U3HA 4IRSA 1RAMA 3BPLB 4J6RH 1FIGH 1YMME 4PTUB 4TUJA 4JDVB 4WW2B 2BY3A 2ZP0T 1JI2A 4U6VH 3SGEH 1FG2A 4YX2L 3TN0B 3KXFA 1PY9A 2EC9U 1R3JA 4HKZA 3IVKA 4JCMA 4TQEH 1QO3B 4ZQKA 1SEQL 2EDDA 5IG7B 1SVZA 1NBZA 1BQLL 2Z91B 4F7TA 3OG4B 2FBJH 4BZ2L 1QQDB 4U6HB 4YXKH 4OIIH 1HIMH 3FZUD 4EVNB 1G84A 1BWWA 2F53B 1J1OL 3WV0A 2DQFA 4U3CA 5F3HA 5GS2H 1KCUL 2D03L 4X99A 1RJZA 1JWMA 4FP8L 4HWBA 4NQCB 4D0CB 4ZUSB 3MBXH 3DWTA 4W6XB 3AS1A 2H26A 3WFCL 4YAQA 2NY6D 3PF2A 3GJEB 3LCYA 3NVQA 12E8L 3O2VH 2IPKB 4GS7B 3VFNB 1QLFB 1F2QA 3H9SE 5IMKA 3D39A 4GOSA 4PS4H 4YQXH 4MA8L 3QXUA 3EGSB 4JO1H 3GEWB 4K3GA 5E9DB 4AG4L 3MRNB 3VCLB 3ULVL 3EYOB 5GGRB 5FM5O 4Y19D 2J5LB 5HYJE 4BELD 1OAUH 5TE6L 3VMNA 2DYPB 4F7MB 1P7HL 5MENB 4OCXL 4LASH 3GBLA 4JJHA 4URTB 2W9LA 4H8WH 2ID5A 5BW7C 3H9SA 4I0PD 2DQGL 5IEKA 4X7DC 4MNGB 4LEXL 3S36X 4FTVD 1ES0B 4P46B 3ESVF 2IH3B 4TTDD 1L7IH 1NBQA 3WLBA 4KRPD 3VXPA 3RAJH 1OGAD 4P23A 1G9MC 2Y6SC 4Q0XH 5JPNA 2XNAA 1MSPA 1ZANL 2Q7NA 2EXWC 3L3IA 2YN5A 3TNMB 3BP5A 1A47A 1KFAH 3C08H 4GAGH 3HB3D 4HC1L 1UFUA 1NCNA 4LRNH 1SBBA 5D72H 2LU4A 3ORJA 5I15L 5CJQH 2CRMA 5ICZB 1RHHA 2YS4A 2Z31C 3QI9B 5DFTA 1V7NH 5F7WC 4PJ7F 1FE8H 5HGAA 5GGVL 4Z7UA 3FOMB 5J0BA 1ZTXH 3H3PH 3ILPA 2BXYA 3GIVB 5F1OB 2YKLL 4NNPL 2R0ZL 4JRXD 5CZVL 5J1TC 1FO0A 4QHNB 1MH5B 3UROR 5IQ9B 1AP2B 3BGMB 2SEBB 4JFOA 1SY6A 1HQRB 1FHGA 3PQYB 4HIXL 4V2BA 2D0GA 4J4PC 3QO1A 2W07A 2MKWA 3STBA 2OXHA 1KEGH 2Q20A 1CIDA 1R3HA 2GFBB 3EO1B 4LCUA 1FORL 4PJBF 5I18L 4JN1L 5HPMA 3U48A 4J3WA 1U8PA 2EIDA 3W82A 4QNPF 2C1OA 2CO6B 4JM2D 3NPSC 4V2CB 5DRXB 5FF6B 3NFSH 4D2NA 43CAA 2D9CA 3VXRB 4K3JH 2OM5A 2FJGB 1NAMH 3QUMA 4NQCE 2QHRH 3RAJL 4PRPD 3U4BH 4HEPG 1QBBA 1T1XB 4Y2DA 4NHUA 4MCZB 1CU4H 3CIQA 5EORH 2APWA 3ZKXB 1Z9LA 1GGIH 5GISL 3H7LA 2DF3A 4XCCH 5KSVA 1MRFH 4YBQD 3ROLA 5HYQB 1T83C 3G5ZB 1HCVA 4JM4H 2DQUL 4RFNC 5FGBA 3WHE1 1URLA 5ANME 3IFPA 1O7SA 4WWKB 2QADD 2V5SA 1CDJA 5E6IA 5HYEA 1F6AB 4LLVA 1KN4H 3ZDZF 1UADC 4LNRB 5E99H 2ADJA 1UB5B 1J1PL 4NO5A 2OSLA 5AYQA 4NBXB 3EJZC 2ZUYA 2A6KB 3JBG7 5F9WC 5KSAA 3MREA 3B4NA 3FO2B 5CZXC 5FHAL 3PWPB 4NSKB 4N8PA 1UCBL 1AH1A 5D2LE 1CBVL 1JFQH 3MJ8A 5D1ZC 5BS0A 5GS1B 3HFMH 4PGEB 3F7YB 2WWMD 3FQRA 4IOFC 4NBYB 3KXFD 3G04B 3RY5A 3FB8A 4ODUB 5CUSH 1H9VA 3BZFA 1QVOA 4ORZC 3TH3T 2HJKA 2JCCE 1S8DA 5IG7A 3RRQA 3SCMA 1YY9D 1C7TA 1Q72H 3IU3A 4X6DE 5IMOB 3O11B 4RSVA 2VL5A 1S9YA 5IBLD 5J1AA 4LVHC 4D9LL 3VWJD 3VI4E 5L6YH 4PV8A 1HOCA 4HGKC 3F6IA 1DN0A 1D5BA 1J1XL 4P57B 4OT1L 1NC4B 3HMXA 3L5WB 1QBMH 4PJ9D 4FNLH 1T89A 3F7RA 4P2QD 2BVQA 2A6IB 5JIHA 4XC1L 5IB5A 3ARRA 1KJMA 3MUZ1 1GJIA 1T80A 3QUXC 5D1XC 1RVFH 1P7QA 2BSSB 2Z92A 5ID0B 2WP3O 4XPTL 3O6KH 3V6BR 5I1GL 1U3HD 1JMXA 3MTRA 1NCWH 2EE2A 1NPUA 1J05B 3UBXI 5IESL 2Q7YB 5F9OL 3RVUD 4U1HA 4XCCL 4GSDL 1OLZA 4QTHB 1WFUA 5DT1H 2VDPH 3V52L 1XIWC 4U0RB 1LEIB 1JWUA 3D48R 4OUUB 4XMKH 4WEBL 2SEBA 3VWJC 3RDTC 5I9QC 4LLDB 1D5XB 2P46B 1S9YB 3GSNB 3H42L 3BKYH 1JPGB 1INQA 1XGRB 2FZ3B 1MLCA 3AS2A 3CMOL 3HNSH 4QF1B 3EDFA 4L4VD 3HZKB 1XGRA 1MLBA 1QD0A 2MJWA 4LCWE 1ZK9A 4LIQL 5IV2B 4LCIL 5JHLH 1EAPB 1G7JA 2VLRA 3BP4B 4NFBA 5DC9B 4WGWB 4U33A 5IJKC 1GGBH 1KBGL 4H1LH 2O61A 3TNNA 2GI7A 2V6HA 4S1SH 4XCYB 5SX5H 1S9WA 3T08A 1I1AC 1L9NA 2K7QA 1TLKA 2MQ0A 4WUKL 2EICA 5D70L 5FO9B 4OLUH 4Y19A 4ELMF 5E00B 1U2CA 3GSWB 4R90L 2W9EH 3T2NL 2VAAB 4HZLA 5L8LB 2E7HA 3QXDB 4Y5YC 1FBIL 3HZMA 3UC0L 4U1MB 5DJDB 4ZNCD 2C5DC 5DSCB 3TO2A 3W0WA 3X11A 1KCVH 3QHTC 1FG9C 1EEZA 1INDL 3L7FA 3V0VA 4XTRD 3FQWA 5EU7C 1NGPL 5MEPB 1MHCA 5CSZB 1BGXL 4JHWL 4P23D 5T33L 5JO5A 5J57B 5L2JA 2HVJB 2JCCA 2R1WA 3Q6FA 4PFEA 4PB9H 2H9GA 1CQKA 4Z7WA 1CGSH 4ISVB 2JK5B 4NQVB 5I75C 4PJCB 4KDVA 3RA7H 1NSNH 2E27H 2MWCA 3ZYOA 2ZSVB 3FB8B 4P5TD 1TCMA 2AAVA 5ICYB 4PGEA 2YKLH 2AKRB 5IMLA 3QHFL 3RVVC 2X10A 4NBZB 4HWEH 1SM3H 1MCIA 4FQ2H 5JHLL 4NO0B 5C0FA 3MR9B 4LSSL 2LFGA 2C7UB 1QFWM 4ODXB 3SJVE 1HEZB 4HGMA 3MRRA 1SYSB 4MDJB 1N8ZA 2D3VA 1C8PA 2D31B 1UENA 2R2BB 3CX5J 2XN9D 5T3XL 4UIMA 1KIPB 1D3CA 3WEXB 2B39A 3BKYL 3SJVB 4JDZB 1UWXH 1ZHNB 5EIVA 5BVPL 1QFWI 4WHDA 4M6NH 5MEOA 4ONOA 3HNSL 1F6AA 2VXUL 3SDDC 5CSGA 3WS6C 4K7FA 2MTPA 1PKQE 3IDJB 3H0TB 1AQDB 1U3HC 3JV4A 4JPVH 2F5AH 3IU4L 4MWFB 3ZSSA 4C56E 4PUBH 2DWDB 4LMQE 1OM3L 3AAZA 1P4IH 5E1AB 4R2GC 1HXMA 5HVHB 4P4RA 3KDMA 2ITDB 5DVKA 2VKWA 3QFJB 2CDGA 4C83A 2DI7A 3E8UH 4YJZL 3UJJH 2IPTH 4H88L 3HB3C 4PGDA 1OAUL 3U7WH 1IC5L 1KJ2H 2GKIA 3RHWK 5L9DH 3ULVH 1OAKH 5IQ7H 1QHPA 1KPUB 3BAEL 3QIUB 1VHPA 4U6XB 3MLVL 1KLUA 3NIFE 1J8HB 1TCRB 2XYCA 3AM8C 4NCC2 1E4WH 5C6PB 4PRID 1AO7D 2DKSA 1QPXA 4PJCA 4ENEC 4AIZA 4HUWB 3VD7A 3K8KA 1S5HA 3FOLB 3QEHB 3KPTA 3B2VH 4NFCA 2DD8H 4MMXC 2ZKHL 4OCNC 4XP6H 1UXSA 5E6ID 5F44A 5T3ZL 2WUCH 3MCKB 3VJ6A 3LKPA 4JFHD 4Z18A 3AAZB 4X0KB 3GJFB 4PB9L 4MNQD 1OSZA 1ACYL 4F33B 2X5PA 2QSQA 4M5ZL 1YPZB 1JZ7A 1MJ8L 1M05A 2PXYA 4UQ3A 1DBAH 3UTSE 3FQTB 5ESQA 3VFNA 3RY6A 5FA3B 5HGDA 1O5DT 3VMOA 1FGNH 1C1EH 1U8NB 3BI9X 1DANT 4Y16A 2FD6H 1BEYH 3GRWA 4Y19B 3RQ3A 4UDUA 3FN3A 3NIDE 4O51A 1CE1H 1RHHB 3QI9A 4OF8A 2LAAA 2BNRA 5TE7L 5C0BE 3CPLA 1AE6L 2WBJC 1QEWA 2YWYA 4I4WA 4LSQH 3QQ4B 4WU5A 2JJUA 1FJ1A 4LGPB 3F6LA 5BRZB 5CZVH 3BH8B 3TNMA 4LSPL 4Y5YA 2BFVH 3NFNB 2ZUVA 5JPNB 3IYLW 4PJEE 4NKDA 5FGCE 4M00A 7CGTA 2VLME 3T2PA 2P47B 3HRZB 3HCVB 5T1KB 4KJWC 4P5TB 1R3KA 1LNUA 1C7SA 4LBEA 5D5MF 2NX5B 2YEZA 3PNWA 3KS0H 2BJML 4JM4L 1HDMB 3H7BA 4U2YA 1AGBB 1KT2A 4OLZL 2AEPH 3GNMH 4FQLH 5B39G 5IVXA 4OI7A 4IIQC 1BFOB 4S1QL 3HI6L 3BWAA 4MZ3A 4BA8A 5GIRA 1ND0A 4U0QB 3JTSB 5IJKA 1JNHB 1MREH 1S7UA 3MFFA 4TNVF 3FT4B 3U9UA 2EDFA 2YPKB 3QWRA 3RU8H 5GQBA 3BW9B 2VMFA 4JFHE 2F8XC 3Q3GB 4ALAH 4NQDA 1UJ3A 4LQ1A 3SE3A 3FHQA 2OQJB 2J88H 1LO4L 3TBVA 1U93A 2NTFB 4KHTH 4NQCA 5E08H 4EI5C 3RDTA 3U9PL 3MA9H 4LCYB 2EXYC 2I9LA 5B22A 1FL6A 1H3PL 1UZ6E 2BVOB 2G2RA 5E08L 3EO9L 2GJ6B 2VQ1A 1KYOK 5FYKU 1RZIA 4K23L 5I2IB 1K85A 1AE6H 3KDMB 3HAEG 3IDGB 2N1KA 4OM0H 4WI2A 4U31A 4UV7H 3P77B 3OXSB 4L5FL 5F7NC 4P2YA 3UAJC 4IJ3B 1MQ8A 1KTDB 4NQEE 2GK0B 1S9VB 5ADPL 3REWB 3OJ2C 5HHVH 5D1XA 4UDTA 1WIPA 4I77L 2R0KL 2VITB 4TULH 2Y36L 1VERA 4FQCH 4WW2A 5E4EC 1BQUA 2F74B 3QDGA 5ID1B 2QSCH 3BIKB 4OAWB 3EJJX 5EOCH 3U4EA 3GO1L 1N0XH 3DYOA 5TH2A 1AO7E 3KR3L 5SWSD 1WCBB 2R2BA 3MJ8B 3EZ8A 4MJIE 4X6BA 4Y5VB 4BUGA 5D7IA 2X42A 4KI5D 4CVZA 1DBJH 4JQXA 4JZOB 3JV5A 4HS3B 4QT5B 5C0IB 3FJTA 4F7PB 4Z77A 2HFFA 1ERNA 4YGVA 2X4UB 4XPBL 2XTJB 3WLBB 2ZUXA 1MFEH 1YMHB 1C12A 2D7MA 3OKDA 3FN0H 2ZCLL 2ZSWB 4XNYL 1PFCA 4P57A 3KPLA 3WHXB 5KZCB 5CZXD 1NLBH 2D0FA 5CIPB 4U05A 1U8OB 1FH5H 3O2DL 4A2LA 4JJ5A 5GRUL 4BJLA 1D9KD 4FQXB 1B90A 1ZLUH 1S7TA 3CXHJ 4XCFH 3O11A 1T0NB 2YBRA 4IOSD 3B2VL 1LE9B 1ED3B 2HFGL 2OX5A 4X9FA 3IU3B 1VENA 5C8JA 1HHKB 2O5YH 4G80A 3D2UA 3EOBB 3OKDB 4RMVA 1GGCH 2JB5H 3V4VH 1BBJB 5DJ8A 3F65A 1CDHA 5EZJA 1YEEH 4QEGA 2XKSA 4RISL 3V9FA 2Q86B 3CH8A 3RKDD 3VGGA 3G5XA 2ADIA 4JZJA 3GSVA 4OM1L 1B0GA 4G5ZH 4LCCA 2Z4QB 4LHQB 4HEME 1ZLSH 1RK1B 1G7MA 2EKJA 2G75B 1AGCA 2FX7H 4HUNB 5C9JA 4ZS6C 4NKQB 4NWTH 1FZMB 1WGOA 4QOKB 3LPWA 4OLVH 3LKRB 2IADB 1D6EB 3ARVA 4HUVB 3DTXA 3S3JA 2FSEB 3FOMA 3UPRA 1FCGA 3T0DA 2VXQH 1FYTB 2VLJB 5KG9A 4NKMB 1YEIH 4M7KH 4IRSD 1AC0A 2WANA 2BSED 1ORSA 5DLML 1SEQH 2GJ6A 3N1QC 4UTBH 2VN4A 3W39B 4K3JL 1CR9L 2I60L 1GGIL 2I26N 4YDIH 5GISH 3QG7L 4ZFOL 4J3SA 3H8NA 1MRDH 2DQJL 1VCAA 2B4CH 4YFEA 2VR4A 1VFUA 5DO2D 1I7RA 1X5HA 4AYFA 2WP3T 5DRWB 1CLZL 3WLWC 1WAAE 1A3RH 1NJ9A 1F4WL 4X5WB 1U58B 2CK0L 4OCRH 1QR4A 3KNBA 1MHHA 3RNKB 3WCYA 3LIZH 3L1OL 4DKEH 4Q7DA 3IDXH 4UOJA 3SKMA 4LCYA 3VG9B 1EGJL 3MLSL 3DIFB 1IGIL 4PP2B 1E4XH 3BKMH 1GIGL 4KH2A 5JW4R 4MJ6B 4PJXA 1YQVH 1H3PH 5K9QG 1MPAL 1A22B 1IQWL 5MEQA 3BKML 3BP6B 4YHKL 3JUZA 2DICA 2CIIA 1VACB 2BFVL 2RCSH 3BXNB 2F54B 2NY4B 2CMRH 2XY1A 4PY8J 4NJAL 3ARTA 3TBSB 1LO5A 1RI8A 4ODUA 5JOPE 3HC4H 2XWTA 5DVLA 3DJ9A 4MAUL 3DGGB 3HUJB 3N1GC 3GMPB 4MHHG 3JWOL 1IGJB 4TVPH 5BRZA 3KGRA 4OD1L 4WUUA 4YHIB 4MDIB 1D9KB 3OKLB 2NPLX 1MCCA 3OX8A 5ADOH 1MREL 4OZIA 1T7WA 3QQ3A 4K94H 5EU7E 2X4SB 1CFBA 1EUUA 5DT1L 1P1ZA 2B20A 4Q9RL 4R4BA 5D2NB 4OCLC 1QFUH 4C57C 3WNMA 2BJMH 5E8NA 4XHJC 4LSVH 4CU6A 5JLZA 4WFFE 4G8FB 1WCBA 2DL2A 3W11C 2Y06L 4XNXH 3JXAA 2C3GA 2DQEL 3E6FA 3OKNB 3VJ6B 4LKXB 2JB6A 3QDMB 2AJXL 3BFOA 3TCLB 4LKCA 1YQVL 2BMKB 2XXCB 3BD5A 1RD6A 4NYLA 3K8LA 1YPZA 4OGZA 5E6ZA 4GW5B 4ODVL 1KB5A 1FRGL 2VE6B 1PG7X 1UVQA 3ARYA 1CTNA 5GJSL 5MP6H 3MMEB 1KPVB 1T2XA 3PDGA 3B5GA 3PV6B 4U1NB 2YRLA 1BD2E 1HHIB 5ISZA 3P3YA 4AY0A 3DI2B 2HT2D 2B1AL 4FP8H 3TIEA 3DX9B 1CLYH 1TTUA 2CR3A 1WITA 3CFDB 1XF5B 3OXRA 5CJ5A 4C83B 1WSST 2W65B 2OI9C 5FB8A 4C56B 1FO0L 2OL3B 1G9EA 3VWKD 4XPFL 4Y4HC 5IUSA 4JM2A 3V0AC 1Q38A 4JY4A 4Z95L 1IQDA 3QBTB 5FHBL 4UV4L 4ETQB 4M1GL 5CKGA 1PW3A 1N6QH 1PLGL 4L9LC 4RFEA 5D7SL 1PX4A 5FO7A 3QXWA 4JPKH 3HE6B 3RY4A 1S8DB 1ETZA 4KUCD 4I0PC 1JWSA 3RZCB 3CU7A 3KLAB 1NUDA 2HWZH 2P5EA 4P4KD 2V2XB 4R4NC 4MA3A 4PP1D 2NY6B 3DTXB 2ZCLH 2HKHL 4HKBA 2ZOKB 4XWOD 2Y06H 5JW4Q 1YEDA 1OL0A 3QDJA 4MX7B 2X05A 1F8TL 2OK0H 5DRZB 1HI6B 4Y4FB 4KAQH 5JZ7C 1BIIA 1VEPA 2XZQH 4GS7C 1HK6A 3QJHB 1MEXH 5IR1A 2OJEA 32C2B 1R5WA 1YJDL 5KVDL 3EYUH 3V6FB 5MEND 3ULVC 1JUFB 4Q6YA 4JG0L 1XH3B 3L7EB 3BQUB 4U1LB 2HP4A 2ZJSL 3MOBL 1Z9MA 1JPST 3P30H 5B3NA 2G5RA 2VUOA 3DARA 1ZA6B 3LEYH 1U8KA 4FXKA 4ODHL 4QO1A 43C9A 3DVGA 5JOPD 1G7HA 4YHLL 3GFUA 2HKFH 1NLBL 1RZ8B 1RU9L 2H45A 4Z7VA 4PYGA 3NIGE 4M93B 3QP3A 3MXWL 1GZPB 1HILA 5CS7A 4PJ8A 2R0KH 5I30L 1AD0B 4HK3J 5JW4N 5BZWB 1CGWA 2EE9A 1FNFA 5CFHA 3D2UB 3EOBA 3SOBH 1KELL 4U1SB 5EWIH 2C1PA 2A83A 5C8JB 5DUPH 5I0DA 1XGTA 4LVOB 4M02A 1J5OH 4C54A 3OJDA 4F9PC 3X3FL 4JO3L 1U3JA 2F19H 3MFGB 3QUKB 3ARBA 3EO0A 3GSWA 3LKPB 1N4XL 4ZUUA 3GHEH 5C6WH 3AY4C 1IC7L 1I8IA 3LSOB 5F3HB 3BDBA 3MLRH 2XOTA 3KPOA 3OGOE 3C6LB 1S7XB 3BN3B 5D7IE 4OZGB 1M6OB 1FFRA 1ZLVK 4F3FB 3BPCB 3MNZB 4TVPE 5FEBA 5DUML 3PXHA 3SDDB 5AG8A 4B5EA 2R8SL 5SWQA 4N9GB 2LABA 5FV2A 3M1BA 3OPZH 1KPRA 2VNCA 3PWJB 4R2GB 4JRXB 4RNRB 1S7QB 3I84A 4JPIB 5AYUL 3JVGC 2VLJA 2JIXB 5KG9B 5A43C 3HR5B 3SDAD 1R0AL 2ZPKH 2GT9A 2KZ1B 1QBLH 2HLFD 3UTPD 3BESR 4JR9L 1ORQA 3SGKA 4KROD 4N90D 1XGQB 3PWLB 1JWUB 4F7EB 5AZEH 1BECA 3F7QA 2APXA 5I6XC 1WAAF 1PGRB 2BSRA 3M1BB 5J6GB 5I8KH 5EU4B 5FA4A 2C4FU 1GGBL 4XMLH 4L4VA 3L5XH 2BOCA 1ZHNA 4OF7A 2DM7A 4P5KA 2NNAA 4OCSL 5JUEL 1MHPL 1UH3A 5LXGH 3BKCH 5TQ2L 5JIKA 4C4KT 4M4PA 2YD4A 3V6OC 4HDIA 3CVHH 3BJLA 1KB5L 5ANMB 1YN7B 2E8ZA 2OMNA 2YSSA 4RGNE 4KU1A 4XBPB 3EYQC 4GAYA 4KKCC 4IIQA 3RBSA 1TPXC 2DTMH 1ZE3C 3JV6A 4HPYH 2XQBH 3FCTB 1RIUL 1JHLL 1DFBL 5IVXB 1KTRL 5FYJL 1KLGA 1RZKH 5TDOB 4FQPA 2VC2H 3HI6H 4XPFH 2GJZA 4RIRB 3MV9B 4M7KL 5IGXL 1FVCB 2H2PC 4WO4D 1RUQH 5D4QA 1KJVA 3HI1A 3ISWA 2KPNA 3LB6D 1EBAA 3MROB 3V5HA 1BZQK 3IKCA 3UPRB 3JV6B 2AJVL 3QWOB 3H2WA 5HDLA 1AGBA 1KT2B 2E9IA 5DDHA 3LRHA 5DS8B 5D96B 1G7HB 5FYJD 5C0BB 5T1KA 2BVPB 4MCYB 1DUYB 2J6EH 1B4RA 3R1GH 2Y6SD 4P5TC 1X5ZA 4DN4H 5GSRA 4HXBH 2XACC 4OZ4B 5I8CB 5E2UL 1ODAA 3L5JA 3NCYP 3QG7H 4EDWL 4E42B 2UUDK 1B0GB 4GSDH 3WL9B 5AZ2L 3CFBB 3ULUF 1GOHA 1NEZB 1IAIM 1TFHA 3QULB 2HLAA 5DQDH 3A6OA 3GB7A 5FOBA 1BQLH 3ARBB 1JN6B 3EO0B 4Y0GA 4OF3A 3ZE1F 1RIHH 1JL8A 5E6IB 4LRIC 1F6FB 1AGFB 1FDLH 2QQNL 1CTOA 1PEWA 2OTWB 4IRZH 4W4NA 4P4KC 4ERSL 2P4AB 1F58H 1H3XA 1I9RH 5HGGS 3R8BB 3FT2B 4U7KA 5DEGB 3IAGC 4A6YA 1PZ5A 1D5MB 4FQIH 2FECI 1VDGA 2AXGB 4EI5B 3P9LA 5HVFB 3SO3B 3V6OA 4BFIA 4ZAKA 5DRXA 5FF6A 1OAYL 3OAYH 1IGTB 1VESA 2I07A 5JW3L 2EZ0C 3Q5OA 2HFTA 4NQEB 4OFPA 5L9DL 5EC2B 2NW3B 3T4YB 1J05A 3TO4A 4WCYL 3JWDH 3KPOB 3P9MA 1V7MH 3QJFB 1ZS8B 3DO3A 3TBWA 4PJBB 1PJ9A 1U8IB 4JFYA 4Z78A 3U1SL 4N0UA 4OGXL 4PD4K 1EHLL 2GAZB 2VC2L 4OD1H 2A74B 3NPSB 4LP4A 1N59A 4MLSA 3HKFA 4QXGH 3IDJA 4HXBL 1KENL 3RVXC 3KR3H 1BX2A 4JKKA 5JXEC 1ZEAH 4NFDA 4P59L 2EO9A 3VGBA 2VZSA 3OR6A 3TPKA 1IGFH 1QLEL 4RMQA 3BZEA 3ROOA 1J0JA 3HR5A 4K94L 5D7LA 1EJOH 1KN2H 2EIEA 1F4XH 2AXJA 3FN0L 3LN4B 3T8XA 3U30C 1MFDH 2BNUA 3FFCB 4HWBH 3RWJA 4BZYA 4MNQA 3RVVD 2Q76A 3BN9D 1FZMA 4NN6B 4GLRH 4B50A 1UM6L 5D2NA 2PYEB 4YE4L 5EN2A 4H0HB 1FNGA 3LKQB 4EIZC 2R9HC 4YO0B 3D39D 4PREA 1EFXD 1WVZA 4KRLB 4F37K 1XGUA 4PJDA 1U41A 5C0CD 4KK6C 1WCQA 3MRMB 3KPRE 1INDH 4MNGA 2HVJA 4YPGB 4JHAL 3FZUC 2F54E 5MEPA 1F3JA 1DLHB 1IEBA 4FOMA 1YEHL 1MQKL 1K8IA 2QR0A 5GGQL 3K4DA 5FYJE 1KSRA 3I75B 5D2LA 1P7KB 4FQLL 1Z0NA 3ILQD 2YPLE 1NAMB 1PY4A 5TDOA 5CLTA 1BMGA 3FQNA 3MV01 1KF9B 3ZO0A 4X7SL 5ALBL 4RAHA 3WDIA 3MRJB 3EYFB 4HS6A 1F4AA 2L7UA 1LDPH 4HH8A 4QRTA 2DDQH 4L3ED 2CPCA 3IS0X 1MI5E 3I6GB 1RSFA 5GGUB 5GRYA 1T1XA 5IF0A 4GXVH 4Q58C 4G6AD 2OP4H 1R5VA 1LO4H 4L8CA 4PJHF 5E00A 5HD8D 4M6MH 1KUMA 4NRYA 1JPSH 4GRLA 3B2UC 4U1GC 2CKBB 3BE1L 1G1CA 4PJGF 4TTDC 4LPXA 4OI8A 3VG0H 1FYTE 1E6JL 3L95A 3QIBC 2DKMA 5ICXA 2BX5A 3W5NA 5I74C 4KMLB 4OFIA 1C16B 2ZOKA 3NN8A 4MQXD 3KYOA 1TZHA 1JYXA 1NGYB 4UAOC 2H6PB 2Z35B 3QO0A 5AAMA 4OCWL 4QY8B 5TE4L 1T6VN 2A9MH 4MJID 4HXAL 2B4CC 1MH5A 4RWYH 4U0RC 3AB0B 3BPLC 3LQAC 1ACYH 5E8NB 2EYTB 4PJCF 4TN9A 1A21A 1OTTC 4ETQA 3OKEA 1UA6L 3BP6A 1S9VA 1GGCL 3OB0K 4YDKH 1K9TA 5IEHA 3K7UA 4M7JL 3QUYD 4XNYH 3GI9L 1XCQA 1FYHB 2VXSH 5I76B 4Y2DD 3QDGD 1LDSA 1B0WA 3X17A 4JFDA 4PRIB 5SX5K 4N1EA 3O2DH 1HQ4B 3WMSA 2VXSL 5TDNA 4PRHD 5CIPH 4LCCC 4M61B 1JF1B 1PYWB 3SGDI 1CD0A 3WKMH 2JJSA 2D7PA 1H5BC 3GM0A 4BQ9A 4L3EE 5AAWA 2AABL 2PKDA 2IGFL 1I1AB 2F53E 5L2KA 4JE4B 5CGMA 3OAYK 1DBAL 3CVIH 5JQ6L 2ITCA 1F11A 3MGTB 4AQOA 2H2SC 4HH9A 1HN1A 3KJ4C 4FZ8L 3KLSA 3SCMB 1A9BB 1INEL 4OV5A 1MHCB 5EIQA 1S5IL 4F7CB 2YA2A 5CGTA 4AENB 4HS8H 1J9CT 1I9JL 1D9KC 3JWOC 3INUH 4N0CC 4X98A 2JB5L 1MCHA 3OGCB 3ALPA 2V5TA 4Z7WE 4YPGA 5MP6L 3HPJA 1A4JB 3C60C 5EO0B 2A2QT 5LCVL 3V5KB 2V2WB 5IB3B 2IPKA 1R3IL 3R1GL 1TQCB 3HRZA 1NDMB 1FLRL 1FN4B 1XGPA 4GKNA 3MACH 4NP4L 4F7PA 3VG0L 1SJHA 2R1XB 5KSBB 4S1DD 3LHPH 4OQTL 1P6FA 5E95B 4B7LA 3WSQH 3B9KC 4JREB 4O2FB 1WK0A 4X6FA 2XG4A 3J8F7 5E99L 2CKBL 4LAJH 4KK8D 4P3DB 3U46B 3IXAB 3NA4A 4NZUL 2WIIA 3KLDA 3O45A 4WV1C 1MCOH 2FRGP 1VPOL 3S9DB 5T1LD 2JKXA 1HZHH 3HNTL 3WNKA 3PGCB 4LU5H 1D6VL 5C07E 3TZVA 1W0WB 5IB4A 5IHUH 3BZ4A 1KB9J 2JE8A 1X5GA 1GGTA 1N5YH 3VXMB 3FQTA 3GHBH 4K3DL 1BREA 1YYLL 4X8XA 2UWEA 5L2KB 4KHTL 5FM5M 3LRGA 2D7TL 4DKDC 4O2EB 4OGYL 5BQ7B 4KTDL 5C09B 3BZDA 5M94B 1WEJL 1FSKC 1CFVH 4EUPG 4FXGB 3VXQB 1CT8A 1HWGB 1IGFL 2ADIB 3TVMA 1MAML 3T4YA 1NUNB 5JPMB 3CXHK 3RVWC 4JKWA 5GJTH 2OLDA 3TBTA 1DUZA 4K07A 4DVBB 2ZJSH 3OKKB 2E5EA 3MMEA 3JSSA 1G7LB 3SN6N 2ENYA 4DQOL 1IKNA 4HGWA 4MA7L 4W70A 2P43B 3D1MC 4WW2F 2VLJE 3ZTNL 1RJLB 1YECH 2EYTA 1HH9B 3GBML 3T77A 3KYKH 3EO1A 4LCUB 4CU8A 3C5SB 5J13C 5F72S 2P1YA 4EN3B 3DO7B 1MJ7H 3X3GH 2VDQH 4P5MA 5GS2D 4U1KB 1U9KA 4I48B 4NQDE 4POUB 2L7JA 5E2TL 4JKPL 1JN6A 5IOPB 2M26A 1HNGA 5DEFA 3WFDH 2BY1A 3KLHD 3QPQC 4JFFB 3SPVA 4PRHE 2R23B 4ODWA 4Q0XL 5GSVA 3GM8A 2VH5L 1YDPB 4XMPL 3P30L 3ARFA 4WJ5A 5EBMA 1CGXA 4GAGL 2B2XH 2FB4H 4YGVB 2RFXA 1BEYL 1T5WB 5HYFA 5JHDB 4HJ0D 2HG5A 5SWZE 2E6PA 2EDLA 5K9KB 1H15B 3W5MA 1UA6H 4ZSOB 3GB7B 1DDHB 1HXYA 3CXDL 1JF5A 1U8LA 4NM4H 3MBXL 2X4OA 1IC4H 4YHOH 3W0WD 2Q7YA 1A9EA 1I8LC 2OTUA 3RWCB 5FECA 2E6JA 1A5FH 1U8JB 1WZLA 1CFQB 4E9LA 5LGKA 2OSLB 3FMGL 1UJ3B 5ICYA 4JO3H 4P2CG 2R2EB 1T1WA 2WINA 3RGVA 5HY9B 3FQNB 4OBSA 4JN2B 2VDNH 4RAUA 4ZPTA 3MFFB 4I3SL 2NY7L 2BNQA 3BE1H 3QUYA 4YNYB 3U7WL 5C2BL 4NKOB 4DVRL 5GGTA 2HWZL 1AD0A 4OD3L 2NY3D 5JA9A 5T5FH 3U82B 4XP9L 3BGFC 2VL5B 4PRHA 2YA1A 5D6DA 3MO1B 4GRLD 5ACZA 1Y18B 2C3VB 4XNQB 4Z9KB 3L3DA 2R4SL 3DX7A 3EHBC 4D9QD 1QLFA 4Z7OF 1CFSA 4ENED 5TDPA 1OARL 2IBGA 4LPTA 4LVNB 5HDBE 3DETC 4DCQB 3BZFB 4YBHA 3KYMA 4GRWB 5EU5B 3IF1B 1C08A 1KPUA 2NY2B 2FB4L 2CJUH 3D87B 2FYYA 2DTML 2IGFH 4PJ7E 4QTIL 3EDEA 5ISZD 4U1IA 1QKZH 3A6CL 3U7YH 3MNVB 1I3GL 4PTUA 4TUJB 1I75A 4V1DA 2YD8A 1RPQA 3ME0A 4FFZL 3GSNL 5D7JA 4N9OB 5IW1B 4K23H 2H3NA 2HTKD 3NCBB 3BWUC 2DLFH 2ZCKL 3SE9L 1FAIL 3SGJA 3U83A 3UCRA 3V7AG 3BRGC 2EYRA 1S3KH 3AXLB 4F33A 3MODL 4ESKA 2FEDC 4R0LB 2A74A 5DMGD 4JVPA 4YDKL 3LZFH 4HV8A 3BUYA 1IQDB 5EOCL 4N1HB 3D85B 3T0VA 4HJGA 3B9EA 3VXUB 5FYJH 3ROLB 1ADQH 2Y5EA 4PJBE 2ZUWA 5FV1L 4EN3A 3DO7A 3A6BL 5JW4M 5F9AC 1SYSA 3C5SA 4FS0A 3NCMA 1XGYH 1QEWB 1TCRA 3TPUB 3LQAH 4XP1H 4DGYH 4UV7L 2IALB 4DGIH 3H3KA 2VZOA 1RIVL 5IBTL 3F5WB 4UT7L 4EJ1C 3FKUS 2PXYD 5GGVY 1UEMA 4G8GB 1KJMB 4P3WA 5INDB 5E4IA 4KRNA 4R7DB 2Y36H 3GHEL 3NCYS 1BZ7A 6CGTA 1LK2A 3TA3B 4DW2L 4Y16D 3LKNB 4UINH 5KJRL 4FQXA 4NT6A 4NPYB 4NQXB 3W81A 2UY6A 5A2JH 5LKNA 3S36H 1JTOA 4OLEA 1FFPB 1PSKH 3L7FB 4NJ9L 4WY7L 3O6FD 5ELIA 2HLAB 1T66C 1VPOH 4KKAD 1UKTA 2B5IC 1AY1L 3M17A 4X6EA 1GAFL 4ZUTA 2BP3A 4F9PA 1U91A 4PJIB 4LU5L 5LCVH 3QFDA 4MA8H 5DURD 4LK4A 3GIZH 5DF0A 4MB3A 4IDJH 1IM9B 4NO0D 5HGAB 2NTSP 3LHPL 3QDAA 3RIAK 5HYJD 1LEGA 1RJZB 1FL3A 1DEDA 2GTZB 4YLQT 2HH0H 4MQTB 3A67H 4NN7C 3E3QE 4FTVA 1WFTA 2G60H 4FXKB 5C08A 3U46A 1F4WH 4IOIB 5HJ3B 2RGSA 4ETYA 5IM7B 1JV5A 1OGAA 2VLKE 3NCCB 3ZDZE 1KEML 3AU1B 1T2QH 4PLNC 1Q72L 3ES6A 5I1LA 4Z0XA 2FIRT 3QG6A 4HUVA 2DOCA 4LNRA 1FAIH 2AERT 3WIIH 4LLVB 1FPTL 2LVEA 3P40A 4H1LA 2XQYK 4WNQA 3UTTE 3L3GB 4BKLA 4HUKB 3ZTJH 2VDOL 1WBZA 4LPUA 3C5ZC 3D9AH 3TYFA 1TTGA 1KC5H 2ILLA 5HVGB 5F9JA 4QHKJ 2B7DT 4OLVL 4R97C 3VFWA 2NY0B 5CJQL 2ADGB 2XKNB 2EC9T 1LK2B 3TA3A 4U1MA 5IROA 1KIPA 1GC1L 4K71B 2Z8WC 1N2RB 5KSBF 4I18A 1I8KB 2H8PB 1TDQA 3CLEH 3GK8L 5L0QB 3ETBF 3H9SD 4I0PA 1MHHB 1MY5A 4NNYA 1YN6A 5ABDE 4Z8FH 1I9JH 3HMWH 3BT2L 2A9NL 3TBYA 2PTTB 1EIBA 3V4UH 1YN6B 4JO4L 3BRFA 1KIQB 3PDOB 2YPVL 4HAFA 1QFWH 4ORGA 2Z8SA 2JK5A 1BJ1J 5TDNB 2CH8A 3PHQB 5AZ2H 1IGCH 4D0BA 5B3JF 5C6TL 1MJUH 1MJ8H 3WBDA 3V0WL 1IAIL 2DQHH 2AXGA 3BWAB 3BUYB 5I1JH 1DN2A 4N0FA 4YR6A 4XPGH 1RK0A 1S7RB 2FJFB 3PL6B 5IHZA 1EXUB 3Q5TA 3HZMB 3QRGL 2IAND 4HK3N 2MQCA 3TN0A 3O8XC 4YXLL 1CICD 3FQXA 3GZKA 4IM8A 4PRNA 3BQUC 3IFLH 2PCPB 4AEFA 1DQLH 4WO4A 4HBQA 5LJYH 2CDFB 1LE5B 2DMKA 1XF3B 1RUKL 4X5XB 3RGVD 2VAJA 1WISA 1AFVL 4WUUB 4YHIA 2DMCA 4S2SB 4RISH 4AEIH 5DDHB 3DX8A 3G6JB 2B1AH 1FZOB 3ZSTA 1NKOA 5GRVL 1I1RA 3N9GL 2PCPA 4QHKI 3HFML 4GMSL 5H35B 1EAPA 1G7JB 3ARSA 3D2UD 5JZ7D 3BN9C 1R5IB 3MLUH 3PG2A 1VGEL 2MCPH 4LSRH 3KYAA 5L88L 1VGKA 3MJ7A 1VSCA 1A0QH 3OJVC 4M5YL 4GXUN 5TQ0H 5BS0D 3LS5L 4PGCA 1SHMA 2YBRB 2YUVA 3O4OB 1MNUH 2BXZA 5EBWB 1UWGL 4HKJA 1FZJB 4TSBH 4G6FB 1JGEA 4ZUVB 4NPYA 3WIHH 3L3HB 4XBEL 1G7PA 4NCC1 2Q8BL 1EEYA 1F2XK 1NFDA 3ZTNH 4WFGD 2X2YA 1JPFB 2XRAL 3VFUB 4XX1G 5C0EB 2EDKA 2ARJQ 2EYSA 1I4FB 1RJLA 5BRZE 1AQKL 4Y2DC 4P9HC 3SDAB 5I8KL 4HCRA 1IGIH 3O4LA 4L3CA 4XCEA 5C0IA 4LSUH 3EOAA 2AJYL 3EYQD 4P49A 4V1DD 1FZOA 4POZD 4JEGB 4JLRA 3LEVL 3UTTD 3QUMH 1QRKA 5BVPH 4WHTB 4H20H 2J88L 1WAAA 3JTSA 3RP1A 3K46A 1FNSL 1MFDL 3VFWB 1LE5A 1TNNA 2ESVB 4FFZH 4X83A 2YXFA 3L1OH 4XMKL 2GT9B 3UZEA 2A77H 2IG2H 2UZIL 3MV7B 3F12A 1LQSR 3OZ9L 2YEZB 3K1KC 2YK1H 3MODH 2EDTA 2NY1B 3FFCE 4L1DA 4U7SA 2DI9A 4CW1B 1OQOA 4NM8H 3PIQA 2Y5TA 4YZFE 4RMSA 2WUBH 4NKDB 5F7HA 3B2UD 3HE6C 2BDNL 4WW1A 3H9ZA 4QYOA 4QRPA 4JFZH 1K3ZA 4ZOAA 1B4JH 3BMVA 4OZGA 1RZIB 4YHYB 1W0YT 5D7LD 4TSBL 3OAUH 4LLMA 3OG6B 2NY6C 3C5JA 3KLHC 5JNYB 2Q8BH 4O2FA 1CK0H 4XP9H 3BP5B 3GRWL 4WFEE 5DMIH 5CGYD 3MCLL 5IB1A 2GAZA 5EUOB 2IAMC 3T4AA 4DZBA 5KAQG 3VXSA 3NCFB 4MA1B 5ETUA 3C9NA 4LHUB 3V5KA 5IW6A 1H8OA 4K7PY 2XZAL 1P4LA 3TZVC 5LWYH 1LD9A 1B9ZA 3CDYA 4WEBH 4YXKL 4U1SA 4YQXL 3C09B 4QOKD 1OP3K 3I6LE 5DK0B 5MHSD 3MSPA 4Y4KB 3LEYL 4ODHH 4OZFG 3TA3D 5D8JH 5KN5A 3IRPX 2I9TA 5ENWB 2Q6WB 4XCNA 3EYOA 3RBGA 5DJAB 3OJMB 2YOCA 5EU6D 5DVOA 3C5ZD 1FVEA 2OR7A 4K8RD 2G5BA 1P4LB 1U92B 4IMKA 4YK4C 1MEXL 2ZG2A 5HVWA 1ZVYA 1R3KB 1QR1A 4L3AA 3Q2CA 2WUCL 4LQFH 3B6SB 2FJGA 4ZFZB 1N64L 3G5YB 5JQHC 2J8HA 1U0QA 3AFLA 5F8RC 2EIBA 4OQTA 2Z93A 3OX8B 1IKFH 4ONFH 3KPLB 1EO8L 3WHXA 4X99B 1QSFE 2JJTA 1Z9SA 1JGVL 3GSXB 5HHMB 2VWEC 4WRLA 3B83A 5J6HA 1IVLA 1A6PA 4L3EA 1JYNA 4X4MA 1JGVH 1JZ6A 1M7DA 2KDGA 4MXVE 5I66B 1IGCL 4PY7A 2UYLA 5IBUB 3EDKA 3HAEB 3B6SA 1KJ3L 4PR5B 1I9RL 4RAVB 2J8OA 5IB2B 4OM1H 2XQBL 3VRLE 3B9AA 3MV8B 4FHBD 4QGTA 5GRVK 3D0LA 4X6CF 3GIVA 1CD1A 1MCWM 5DYOB 2BY2A 5C0JB 2ARWA 4F7MA 3PABB 3VRLF 3QDGE 2ATKB 4R4FH 4IRSB 3TIDA 3MJ9L 4KRMB 1G9NL 2YD6A 3FONB 4KJYB 2LAGB 5L7XH 1C16A 3S8WA 2WW8A 5FO7B 3CLEL 3GK8H 5C7XH 5I8EB 4JY6A 4ZFOB 1BM3H 2YR3A 5B8CB 4K7PL 3G08A 4PRPB 2FEEI 2A9NH 5E2TH 5DJZB 4DZ8A 1NMBH 8FABB 4NRYB 3S88H 5B8CA 4R7NB 3O4LB 4L3CB 3GMOA 1SBSL 4X7TB 4OB5H 4OIAA 5ERWB 1CD9B 5I73B 1XR9A 5JUEH 1NMAL 3NA9H 4Y5XC 5KS9F 4O9HH 4S1SL 3CFCH 4I18C 3VG9C 2X1WL 1ZGLB 1V5JA 5EZLA 3P11L 3U9PH 4WI8A 4YNYA 3CFIC 4I13B 3VXUE 1ZLVH 2I25N 4UU9A 4KUZL 3QXAA 3MRNA 3SE3C 2DJ4A 1HSBB 4JANA 3LEXA 3F12B 4WNQB 1ZV5A 5DZOA 1S78D 3SDYL 5IMKB 3SJVD 2G75A 4OCSH 3TZVD 3U4BL 3PWPD 5J12C 3SDYH 1XFPA 5FYKL 4W81A 2JJVA 1WZKA 3OKMB 5ILTH 3FB7A 3VXNA 3V2AR 2EH8L 3AGVA 1G0YR 3QZWA 1FCCA 1LNUB 3V8OA 2PW2B 3OHXB 1FFNA 1JJUA 2HG5B 4MXQD 3S37L 4NZRH 5EZJB 3JWDL 4RGOL 4JGMA 1QBLL 1EHXA 1BBJA 5DJ8B 1T04B 3MRLA 4YHZH 4CVWA 2QHRL 3MRGB 2VDML 4GQPH 3TJEH 1MI5A 5K93A 3MLYH 3MX0A 3P4MB 3VFVA 3HLAB 5HDQL 5AZEL 1H3VA 5JORA 1HZHL 4KVNH 3NOIA 4CMHC 2IPUG 4FRWA 4Z7UF 3MO1A 4U7MA 5ACZB 1UZ8B 1FG2B 5EA0L 2BNQE 2OR8A 5EBWA 1C5BH 2WBJA 4X6DB 5F3BB 1ZGLP 3QEQB 4XBEH 4P5MB 1TENA 5I71C 1UYWL 4PP2A 5F6IC 4LFHG 1BM3L 1ZANH 4HQQL 3FOLA 1RJCA 4KGLA 4APQC 2D7TH 5HHXH 4YZFF 4DZBB 3QNXB 3GI9H 2XWBA 3QIBB 2X4QA 5CJ8A 4D3CH 1SBSH 3ALWA 1CG9B 2YZ8A 1Z6JT 3RWDA 4OGAD 1RZJL 4PJBA 1BQHB 3X3FH 4NNYB 4KZDH 4UAOB 1RULL 1UXWA 4HFWB 1J11A 2HT4D 1NC4A 3N1FC 4NQDD 3U0WL 3ULUL 3ZE2F 4PJHE 1EO8H 3UTOA 3AB0C 1OT2A 4PRDB 3DGCR 2BY0A 1DR9A 5DQJA 3ARZA 5D1QB 3T3ME 3KPPB 4Y4HB 4ZPVB 5HHQB 1EERB 1JP5A 2MKLC 1BJ1H 5JOFB 5A40E 2GITB 1MLCB 3CDCA 5C0BD 5C3TA 5DHVH 5HHQA 5D7LB 3DVNA 4WWKD 4M1GH 4MQSB 1T1YA 3VGAC 2I60H 1RURH 3C60D 4YDIL 5DJ2A 3ES6B 3E8UL 3KPSE 2BSTA 4LCCB 4RFOL 4KI5F 4ZSOE 4EDWH 1EUTA 2HYMA 4G9FB 2BNQD 2B2XL 3DVIA 4L8DB 3CFBA 1GYAA 4ODXA 2CRYA 3QWRD 3BAEH 3GMMA 3L3IB 1NGXB 2IWGA 5L8KB 1FIGL 1CXKA 1UH2A 1LMKA 3I02B 1CICC 2IH1B 3MBEB 4FZ8H 4KWUA 2Z92B 1REIA 4TULL 4HT1H 3ARDA 2LE9A 3WEXA 3G5XB 5HHPA 5SWSE 4NO2A 5F6HJ 3HZYB 3CLFL 5CAYB 1RJYB 1QOKA 1FNLA 1NANI 3C5ZA 1JRHL 1X5JA 5EU6B 3TWCL 1NGQL 1QPPA 5MERB 1RULH 3QPXL 5CSZA 1A14L 1KN4L 1YEFL 1OAZL 3QFJD 3V0VB 4JFEB 3SO5A 4M93C 1GZQB 1J1OH 4E41B 4PG9B 5DC0A 3V7MA 1E6OL 1UKQA 4Y4KD 1HDMA 3MQIA 4DK6A 2GHWB 3WD5L 1WIOA 2H32H 1BGXH 3V7AE 4L8SA 3FT3A 1K8DA 4F9LC 3OMZA 3TFKC 1N5AA 5E56A 2HJKB 5JO5B 5F8QC 4DTGL 3B9KB 5JDSB 3BX7C 5FDYA 4R9HA 3WFHA 1A6TB 3QDME 3HPLA 1JFQL 4TSAH 3IJHB 1L7TH 3E6FB 4OF5A 3WIIL 4FABH 3UC0H 3AMKA 5C3LD 1MVUB 3CDGA 3ET9F 2X4RB 1RZ8A 2AK4A 1RFDL 3BT2H 3GJFH 4PLJD 1X5IA 3NMEA 5E6YA 2V7NB 4JQIL 3FB7B 2E7LA 3CVHB 2DKUA 1TJGL 5TFSL 4CAGA 4ONHB 4Y19E 5EZOL 4P46C 2Z91A 1WWBX 3GBMH 2WWKO 4PP1C