5I21A

Y55w hfq from pseudomonas aeruginosa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVWKHAISTVVPSRPVRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein Hfq
publication title Y55W Hfq from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain pa7)
molecule tags Rna binding protein
total genus 14
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5i21A00
2DTOA 4A53A 3L1AA 5GMKi 4C8QG 4C92F 3V7SA 3JB9F 4M7AD 3HFOA 4HA8A 2I2LA 2RA2A 1LNXA 3JCMP 4OP0A 4M75D 5GAMd 5GAN8 1B34B 4C8QA 1I81A 4C8QE 4M75C 4Y91A 2EJ9A 3M4GA 1N9SA 5GAMh 1WPYA 4M77G 4DQ2A 4JLIA 2RB6A 1D3BB 4M78D 3V8LA 4JUVA 3JCMd 4F7UG 4M7DG 1JBMA 3HSBA 4A54A 5GAN2 5GAOl 3RESA 3AHUA 3JB9J 4PNOA 4HT9A 1Y96A 3RUXA 3JCMV 4M7AF 4EMGA 4M77E 1BIAA 1I8FA 3JCMh 4F7UA 5GAN6 4M7DA 2VXEA 4C8QB 4M75F 4RCBA 4F7UE 5GMKj 5GMKl 4JRKA 3JCMW 4PJOF 4M7DE 2E10A 3JB9G 3FIFA 4C92G 2DTIA 4V2SA 5I21A 4J6YA 1WQWA 3EFSA 4XQ3A 1U1SA 4M78F 4EMKC 1N9RA 4C92A 3JB9H 4X9CA 2DVEA 3FB9A 3L2ZA 1LJOA 1Y96B 3QUIA 3V8KA 4C92E 3JCMJ 4F7UB 5GAN3 4XU1A 3QSUA 4M7DB 4HT8A 4EMHA 2E65A 3JCMc 1HK9A 2DTHA 3BDUA 3SB2A 3BFMA 4M7AG 2FB7A 1BIBA 4XTUA 2QTXA 1HXDA 3JCMX 5GAOn 3PGGA 5GMKe 4M75G 4M77A 4C92B 5GAN4 4M7AA 5DY9A 4PJOG 4M7AE 3V7CA 3QHSA 4M75A 1I4K1 4PJOA 4N0AA 4M75E 5GAOq 3V8JA 5CAIA 4PJOE 4M78G 3RIRA 2DXTA 4JRIA 4M7DC 4X9DA 5GAOp 2DZ9A 4M78A 2DJZA 2DXUA 2DZCA 3JCMb 2E64A 4M77B 4RCCA 4M78E 5LJ5f 4M7AB 5GAOr 3RKYA 2YLBA 5GAMj 3EFRA 2EJFA 4NOYA 1I5LA 4M75B 5LJ5j 3SWNC 2JN0A 4J6WA 4PJOB 1H641 2VXFA 4XTZA 4XU3A 4XTYA 4QVCA 1KQ1A 3SWNA 4C8QD 5GANf 1M5Q1 3QO3A 4C92C 4EMKA 5LJ3f 2Y90A 3JCMQ 4J6XA 5GANj 4C8QC 4M78B 3V7RA 2DEQA 1YCYA 2K57A 5LJ3j 5GAMg 3RKWA 2E41A 1JRIA 4WF2A 5GMKh 5LJ5g 4M77D 3GIBA 2EWNA 4XTXA 4M7DD 1M8VA 5GAN5 2YHTA 2VC8A 3SWNB 3JCMg 4M77C 4C8QF 4EMKB 4M7AC 4MMLA 4XTVA 2CGHA 5GAMf 5GANg 3HFNA 5GAMe 4PJOD 2EAYA 2RM4A 3RKXA 3VU3C 5LJ5d 4XU0A 3RERA 4J5YA 5LJ3g 5LJ5e 2YLCA 4NL3A 4PJOC 4N0AC 3INZA 4NL2A 2HNIA 5GAN7 2FYKA 2DKGA 3JCMf 2EJGA 4C92D 5LJ5h 3JCMe 3JB9D 5GANd 4QVDA 1MGQA 4M77F 1WQ7A 5GANe 4M78C 1TH7A 1WNLA 4MMKA 5LJ3d 4F7UF 4M7DF 1B34A 2E1HA 1LOJA 3BY7A 3FJPA 5LJ3e 2RD1A 4XTWA 5GANh 5GAOm 1U1TA 4XU2A 1X01A 3BW1A 5LJ3h 1KQ2A 3JB9I 1D3BA 5GMKm 2ZGWA
chains in the Genus database with same CATH superfamily
2LQNA 3CCVQ 4X1VA 2ABLA 4KH1B 2IG0A 3VS0A 1VQMT 2BZ8A 2EYYA 5CR2A 1AZEA 1N9SA 1OX9A 3V8LA 4PJNA 1B7TA 4E7JA 1M3BA 2BZXA 2RQVA 4M77E 1YFNA 1QCFA 2SRCA 1WXUA 2A7YA 1VQ7T 3FIFA 1BI2A 4LE9A 1YI2T 1UE9A 2E65A 5KYWB 2E3HA 2YDLA 1YI2Q 2JTFA 4M77A 5FROA 1XQHA 3CMET 1RACB 5LL6S 1PG5B 3GLXA 3SEMA 4L6V5 4X9DA 2DZ9A 4MDWA 4DOWA 2KK4A 5FLXE 4R56A 4XTZA 1ZSZB 1GCQA 1KHCA 4RTYA 5DLQE 1VQ6A 3CQTA 2KYMA 3M53A 1Y57A 1YJWA 3RMSA 1P92A 1UECA 4LD9K 1KQSS 3GIBA 1D1CA 1EX4A 2KSSA 1PD1A 4PLIA 1QKXA 4DBFA 4LDXA 1C6VX 2LX9A 5FU6C 1RUWA 1QKWA 2LJ1A 3VRYA 1JJ2S 4QW2A 2XU8A 2A36A 1R0BG 4LUEA 1K73C 1QVPA 1U1TA 5KH6A 4MZMA 5KYNA 1ZHIA 1RI9A 4WTOB 4PL6A 4C8QG 4M7AD 4A4KA 2RHXA 2EVRA 2K3YA 2B8AA 1I1JA 2RH2A 3X24B 2F69A 1B34B 1QVGS 2OTJA 4ZGEB 2F2XA 1K9AA 3I5RA 3CCLT 1T0HA 4M78D 1Q7YR 4F7UG 2HAXA 1JBMA 4M7DG 4HCBA 2Y4YA 3KXTA 4EMGA 2VXEA 4JRKA 4A4GA 2M0YA 4DBHA 4V2SA 2DTIA 2EYWA 1Q86R 2RQTA 1QMCA 4OMOA 3OA6A 3VS5A 4KBMB 1Y96B 4C92E 3N5BB 1S72T 1MMDA 3LGFA 3EG3A 4EMHA 1HK9A 1SSFA 4GY5A 3BFMA 2F2WA 3EFOB 2F1LA 4RMOA 3UA7A 3FEOA 3OMCA 2BZYA 2A28A 2V26A 4M75E 1QCNA 1JO8A 3OBWA 5GAOp 2HMAA 3GNFB 3RKYA 1ABQA 1VIEA 3QDRB 3PT9A 1ZA1B 1YJWT 4XTYA 2CP3A 2QASA 1VQ6Q 2KEAA 3O8VA 2FL7A 2JMCA 4J6XA 1OQKA 4EPCA 2EFIA 3FDRA 5J3BA 3RDVA 1PKTA 5KYYB 2NUZA 2E5KA 3QYGB 1M90R 1XOVA 2M16A 2KI7A 4M7AC 5GAMe 5J39A 3CPFA 3L2RA 2KNBB 3EG1A 4PJOC 4BE0A 4RKUE 3JB9D 3MKDA 4M78C 1R8OB 4C5EA 1NM7A 1VA7A 1SG5A 2V8JA 2OTJT 2EGCA 3V7SA 1UUEA 2AKLA 4QT7A 5EC7A 3VJPA 3A8HB 2W0ZA 5CCAA 2KRNA 2RJDA 4J83A 3KFVA 2CP6A 1AHJB 1BIAA 1EZZB 5GAN6 3JCMW 4ATOA 2V8IA 5I21A 3P8BB 2RK1A 4XQ3A 5CKBA 1N9RA 4X9CA 2YUNA 4OMFB 5GAN3 1E7OA 3M57A 2EQIA 2G3RA 1V1CA 4ORZA 3S6WA 1VQ5T 4EIKA 3L2QA 1HXDA 2M02A 1IGUA 3VS2A 4F04B 2LNVA 1I5OB 1K9MC 3M0UA 2FZKB 2IIMA 1HD3A 4BD3A 4Z02A 2LJ3A 3OQ5A 4QQGA 1VQKA 3DB3A 3EFRA 3CBMA 3L2WA 5KE3A 1JXMA 3NGPA 1K8AC 4L59A 3VRZA 1KG1A 3CMAA 2HBWA 4WF2A 1NBEB 1UGVA 4ZNXA 2DL3A 2HKNA 4M77D 5GJVB 1ZX6A 3I55Q 1M1KC 4GLKA 3EGDA 2DPPB 3C95A 2HSPA 3X28B 2LRQA 4MMLA 3WVEB 2JNGA 5LJ5d 2YUOA 2VB6A 1VQPT 5KYUA 4AFQC 1JXOA 1ZSGA 3OS1A 3H41A 2V8KA 5FRMA 1W2BS 3G4SA 2LZ6B 3FJPA 2RHUA 3M59A 2FG0A 4J7IA 1IZ6A 4DBRA 3BW1A 3JB9I 5HK0A 1H3HA 5A0LA 2KE9A 2FVUA 2KRSA 1NLPC 2R5AA 1KC8U 1FYNA 4RTVA 5KE2A 2KBTA 2EJ9A 3M4GA 3H6ZA 2D8HA 3M0TA 3OMGA 4A4EA 2L0AA 2OX7A 5CKEA 2MCNA 4LDWA 2HL3A 2PZ1A 3S3NA 2C0IA 3M0QA 1XJWB 1IREB 3HRUA 2RI3A 4OMMA 4N4GA 2DLPA 2K79A 2GTOA 3JB9H 1YJ9T 1WHMA 1HYOA 2JUFA 1AOJA 1SF9A 3TCJA 4CC2A 4BB7A 1K73U 5CIUA 4J8OA 2PVDB 2FB7A 4XTUA 1ZQ1A 2KY9A 3L2VA 5GAN4 4ANJA 4J9EA 5DY9A 2LP5A 2RPNA 1G83A 1QP3A 1KD1R 4D8KA 4JZ4A 3V8JA 1UGPB 1VQKT 1Q95G 2CKKA 1NPPA 4JRIA 5LJ5f 3G71Q 1UEBA 3I9QA 4J6WA 4IUVA 5FU6B 2LVMA 4J9CA 5L8RE 3LW5E 4RTXA 3CMAQ 5GAMg 4RTUA 1JRIA 3E19A 2NWMA 3OYHA 1J3TA 3M9QA 2VC8A 4F14A 2ED0A 2CP2A 3CPWP 3RKXA 3VU3C 4IUUA 4XU0A 2CDTA 4OMQA 3BDLA 4RUGA 3DLLA 1D1AA 2X35A 3OYKA 2FYKA 2R5MA 4C92D 1X6BA 1DJ7B 1UTIA 2D0NA 3G4SQ 1Z9QA 1LOJA 3REAB 2D9TA 1MHNA 1VQLA 3C0CA 1TU0B 5FWBA 1X01A 1WX6A 2X3WD 2M9UA 3NHNA 1UJ0A 3SWNC 2DTOA 4C5HA 2BE7D 3L1AA 5HKCA 4PJLA 2XHCA 4FW2A 4TVRA 4M75D 4FSSA 4DA4A 2OJ2A 3AT1B 4C8QE 3ZL7C 2QQBA 3CXCS 5IAYA 1WHGA 3O5ZA 4PNOA 3JCMV 1U3OA 4D8DA 1T3LA 4F7UE 4M7DE 2HZYA 2DIGA 2KMTA 2GQIA 2LJ0A 4O6JA 3EFSA 1OOTA 1RLPC 3CCVA 3L2ZA 5KCOA 1QVFP 3VYGA 3L2UA 4HT8A 2HKQB 2OTLQ 4LD6A 1BI3A 5A0GA 2QTXA 2DRMA 4E47A 2JT4A 3OBYA 3OYMA 3F70A 4BDZA 2K2VA 1WLPB 2CP5A 1VQ9A 1MMNA 2XK0A 5IN1A 3FLGA 3EG9A 4X34A 2DIQA 3UA6A 2LTOA 4E7ZA 2E64A 2XDBA 3CC7Q 4M7AB 1YJNA 1Q7YC 1PRMC 4PJOB 1H8KA 1G3TA 1KQ1A 1NZ9A 2JOYA 3PMIA 4C92C 1OEBA 3JCMQ 3OYNA 4M78B 1IO6A 2DEQA 1YCYA 1Q86C 3EGXA 1TUCA 2BUDA 2P4RA 2J06A 3S3MA 1K0SA 1PRLC 5LJ5e 1SRLA 2YLCA 1ACMB 2KAFA 5GAN7 2QG9B 2XDPA 5HY6A 5LJ5h 5IH2A 5GANd 1VQLT 2BTTA 3TREA 3RMQA 5IHKA 1VQLQ 1W1FA 1K9MU 3CD6T 2E6ZA 5FWCA 2MIOA 2WSCE 2VVKA 2X51A 2FZGB 2EYXA 2ZPFB 4FT2A 5GAMd 4C0ZA 1K8AU 4JZ3A 4FCYA 3OYAA 1NEGA 4J9GA 2LQWA 4A54A 1H92A 3RESA 3AHUA 5CO7A 3J7AF 1M1KU 2DD5A 5L23A 4QQDA 3CCVT 1AWWA 3I5SA 5KYWA 3PIOA 3CCUQ 1M90C 2BKDN 4YTLA 3TSWA 1M2VB 1D0ZA 4CC7A 2YSQA 4N4HA 5DM7R 3QG1A 3EAEA 4LDUA 4RTWA 2IVWA 2L5QA 4OGEA 3VS4A 5GMKe 4C5IA 1X27A 1VQ9T 3V7CA 4BI8B 1VQ9Q 3A8OB 1YJNT 1ZSZA 3RBBB 1IHVA 1AZGB 4FYYB 1I07A 3CCEA 2EW3A 2YRCA 3LYIA 4K11A 2DXUA 1YJNQ 4RCCA 1BBZA 3TVTA 2O88A 4HKEA 4IKFA 5GANf 2Y4XA 4FU6A 3M56A 1X75C 3UWNA 3CXCA 3CPWA 1PSFA 4HVWA 1JJ2P 5GAMf 1G3WA 4Z8AA 1TWBA 1AT1B 2COWA 2NYSA 2L2PA 5I2MA 4NL3A 1NYGA 1FWZA 4A63B 5IXFA 3DLMA 1FMKA 4AFUC 2R57A 3E2UA 5LJ3d 1WNLA 1B34A 2RJEA 4C5GA 4JJCA 2D1XA 4BI4A 2XMFA 3ZBDA 4Y92A 1UHCA 2DL7A 1HSQA 4HA8A 4ME7A 4ZTFA 3M55A 4JPBW 1GBQA 2DL5A 1M8MA 1X69A 4OB3B 4JRPA 4KGVB 1FX7A 3UT1A 1TOVA 3CC2Q 4QQ6A 4XAXB 2CP0A 3OYGA 4M7AF 1Y96A 3VS7A 3QZ9B 2CP7A 1B3QA 4PJOF 2DF6A 1QVFA 2K4YA 3E9FA 3EFOA 1T3SA 2K5IA 4OB0B 4M78F 2L3PA 3EH2A 1VQ4Q 2ROTA 5DLOA 4BE2A 5GAOn 3UPUA 3GPLA 3CCET 3QHSA 2KQWA 4P5NA 4CI0C 1LPLA 2ZAEA 3CCEQ 1UGQB 1PC0A 3ASKA 1W70A 3WXMB 3CEYA 3C94A 3VV0A 5KYYA 2RQWA 4C8QD 3QO3A 5LJ3f 3CCSA 2KT1A 2CZ0B 2O2OA 1X2KA 1AWJA 2KGTA 4BI3A 1BI0A 2LCLA 5C6SA 5LJ5g 3OSVA 2KROA 2O01E 4M7DD 3SFMA 2KVQG 5GAN5 3SWNB 3HTRA 3SD4A 1BU1A 1QLYA 2RQRA 4JS5A 4PK4A 2NLUA 1VQ6T 3MP1A 1YITA 3JCMe 2PVOB 2JXBA 5GANe 5IHNA 2MWPA 5FW9A 5GANh 2ATCB 1KD1C 4HXJA 1RAGB 4J9HA 2YWWA 2HQXA 3JB9F 1Q7YU 2QQSA 3LWIA 3I55A 3JCMP 3LLRA 3SHWA 4LN2A 4BACA 1Q81R 2MPXC 5J26A 5GAMh 1NG2A 4GLMA 4ZN3A 1Q86U 4AFZC 2LT1A 4MZPA 3QIIA 4E7KA 2DBMA 3M5AA 2P0KA 1YWOA 3H8ZA 3VS1A 1WQWA 3LH0A 3ME9A 1K76A 4ELZC 3TU4K 4OMNA 2BIVA 3META 1SPKA 5IHIA 2NUTB 2DXBA 4WCIA 2P4TA 2K7AA 4C92B 1C0MA 2F2VA 1OZ3A 1CKBA 2FRYA 2ED1A 3MCAB 3URGA 3OW2S 2E12A 4QKUA 4IUTA 1X6OA 2G6FX 4M7DC 2E3IA 5ECAA 1KQSA 1FXXA 2VGMA 2F5TX 2EJFA 3A8GB 1I5LA 3DB4A 4M75B 5I11A 2JN0A 2EGEA 4DEXA 4MZTA 3CCSQ 1TXQA 3TEEA 1G5VA 1SSHA 1M90U 3V7RA 1JJ2A 2VWFA 4Z88A 2B86A 1CKAA 3HRTA 5I2SA 4B9WA 1QCOA 1QW1A 4C0DC 3PTAA 3H9NA 4N0AC 1YITQ 3G71A 1V29B 2JM8A 2FEIA 1WJSA 1QVGA 1UHFA 4M77F 1GRIA 2YT6A 5FU7B 3M0RA 3OYBA 2CSIA 1Q82R 2M51A 5LJ3e 3FJ5A 1KSWA 3I55T 5LJ3h 1KQ2A 1Y7XA 1TSFA 2IPOB 3P8DA 3CC4Q 4BDYA 3J81E 1VOMA 2LMJA 2XI9A 2XIDA 1X6GA 2MMPA 5CVIA 2AIRB 2X3XD 2QQ9A 3S3OA 2DL8A 4KT0E 3A98A 1HJDA 4J7FA 4JUVA 3H0IA 2LCSA 1NJIR 2C06A 2EBPA 4ZN1A 2YUQA 1BKBA 4OMLA 1O9SA 2E10A 1AWXA 3CCQQ 3FB9A 2LQ8A 1KFZA 3QSUA 2ZPHB 4E7HA 3E9GA 2DO3A 1YP5A 3D7SB 1M27C 2AZSA 4IUQA 1TUGB 2WSEE 3L42A 3NMZC 3HHTB 1GBRA 1MMGA 3MHXA 4OF1A 2PNIA 5HCKA 3HL8A 4KGXB 2BE9B 2O4XB 3EH1A 3JCMb 1NEBA 4KUIA 1H3ZA 2EYQA 5GAMj 3OYFA 1UGSB 1NE8A 4XU3A 4Y28E 1M3AA 3OS2A 2GTJA 2OTLA 4FYWB 1M2OA 3T9NA 2DAQA 2LX7A 3MP6A 4KGZB 3I56A 1VYVA 1ARKA 3JCMg 3G71T 4M77C 4EMKB 5GANg 3LH5A 3RERA 2L8DA 4J5YA 1PSEA 4LUDA 1RI0A 2XG8D 2JJ9A 3GF5A 2QQAA 3CC7A 2P0QA 4OB1B 3G6EA 3MEWA 3CMAT 2K9GA 2PU9B 3BY7A 2K5LA 2DE0X 2J05A 2ZPBB 3OYYA 2DFUA 4A53A 1GCQC 3CCMQ 4C92F 3HFOA 3CXCP 2LDMA 3C4SA 1ZUUA 2DXCA 3G4ST 4JLIA 1D3BB 3MEVA 2O9VA 4JRQA 1YIJQ 5CKDA 4HT9A 3VS3A 1Z9ZA 3RUXA 3M4YA 2CREA 4M75F 4PJJA 4AFSC 4LDVA 4MDXA 2H3EB 5GJWB 3GNGA 1SHGA 2DVEA 2KRMA 2DM1A 1V76A 4FYVB 1XNIA 2ESWA 2KDSA 4JDSA 1KD1U 3QPHA 1WZOA 1BIBA 2CH4W 4M7AA 2H8HA 1WGSA 1PKSA 4PJOA 2XKOC 3TQ7P 2NUPB 3CCUA 2JZ2A 3A5ZB 4M78A 4PJMA 2DZCA 1N6AA 2FRWA 4PFPA 3MP8A 2OTLT 4NOYA 1VQ8Q 2MYSA 2VXFA 2GGRA 1JQQA 2CUDA 2D0QB 1RABB 1WYXA 3RKWA 2E41A 3I56Q 5C0MA 1W2BA 2A3LA 2RJFA 4FL6A 2EWNA 4XTXA 3M54A 4B9XA 1N8RR 4AT1B 1UB4A 1M8VA 3CC7T 1VYUA 5D7UA 1OI1A 1WHHA 3UF4A 2AT1B 2EAYA 2RM4A 3G6ET 3RNJA 2RJCA 4HVVA 2QYZA 4LXCA 5LJ3g 3QKJA 1ZUKA 2GNCA 2QDLA 3LWHA 3G6EQ 2E6NA 3MEUA 2FPFA 1RAHB 4MMKA 1KJWA 1W6XA 1Y71A 2L89A 3ZFJA 1MV3A 1PM3A 2D8JA 2K2MA 3ZEHA 2LQKA 1K4US 1M1FA 4JJBA 4J9FA 1VQ7A 4RG2A 4J9DA 4C0FA 4IIOA 3CCRA 4M75C 2RNAA 2QTVA 1KHIA 3NTKA 5HK3A 3JCMd 2RB6A 1M2VA 4BE1A 1YNZA 4J9BA 3JB9J 1GL5A 1AVZC 1I8FA 2DETA 4C8QB 4QVZA 4FT4A 2M0OA 2XDDA 1GFDA 2HBPA 1U1SA 1LJOA 4F7UB 2QA4Q 4M7DB 2AZVA 1BYMA 1VQOA 1WI7A 2DTHA 2J6OA 5FU7C 1TG0A 3SB2A 3FRNA 5KYXB 4FIBA 2DILA 4FSXA 3GOXA 1RAEB 3CC2A 2X4XA 1IHWA 4OB2B 1SHFA 1D09B 3CCUT 2DA9A 1WFWA 2HEQA 2JM9A 2JW4A 1OV3A 2DJZA 1Q81C 2HQEA 3PVLA 5GAOr 1ABOA 4C0DB 5CKHA 3GP8A 1VQ4A 2FPEA 2COZA 2CUBA 2K3BA 4M4ZA 4CC4B 5GMKh 3JRZA 2YRVA 1WIEA 3HFNA 3OYEA 4KULA 1M4ZA 1MUZA 4EDUA 3INZA 1VQMQ 3NTIA 1UGRB 3JCMf 3REBB 2CS7A 2CH4A 1WQ7A 1U06A 1KQSP 2E1HA 3CCLA 3ULRB 2GBQA 1ZA2B 2DYIA 4II1A 2A0FB 3QJYA 1N5ZA 4PLLA 1R0CB 1WA7A 1BK2A 1D0XA 3HRSA 1YBYA 5GMKi 2L3RA 3CCRT 1G3YA 2HCKA 4ZGJB 1VQ7Q 1RLQC 1U8RA 3CCRQ 1K0XA 3IQLA 1WHJA 3NFCA 5AYFA 2GQVA 4Y91A 2DRKA 4BY6C 3P8HA 2Z0WA 1S72A 3EHQA 2J6FA 2RQUA 1OU9A 2RK2A 1MNDA 2X4WA 4RCBA 2P0PA 1G2BA 3SDZA 2ECZA 1N27A 4PFZA 2M1HA 3CMEQ 1QVGP 3OB9A 3PMTA 4EMKC 7AT1B 3OSSC 1WHKA 1VQOT 4HCZA 4JS4A 1GCPA 2DYBA 1KC8C 1VQOQ 1Q82C 3CC2T 2EKOA 2KYBA 2X9HA 1D0YA 1NPRA 1C1AA 3QDFA 2X4JA 3OYJA 4M7AG 2RO0A 1B07A 1LVKA 2L3QA 4PJOG 2ZPEB 1W4SA 1BI1A 1QWEA 1I4K1 3QZ5B 1AEYA 5CAIA 4AMCA 2L3SA 2XICA 4M78G 1M30A 5AT1B 4OVAA 3OYLA 2CZ7B 2HL5C 4M77B 1VQ4T 1Y0MA 3MPUB 2KR3A 4VUBA 4JLGA 2A08A 2ROLA 5LJ5j 2WSFE 4RTTA 3QJ6A 4QVCA 1NJIC 3SWNA 1R77A 2CZ6B 1QQJA 1RAAB 1FMWA 4KRTA 3MEAA 2KXDA 2YUPA 1G8XA 2DK3A 2E4HA 8ATCB 1YN8A 4C8QF 1KIKA 2RI2A 4PJOD 4A4HA 2QGFB 4NL2A 1PCXA 1S1NA 3VUBA 1SKUB 2FZCB 2J7IA 3H0HA 2JS2A 3CCLQ 1TH7A 4F7UF 4M7DF 1GXIE 3GBQA 3LGLA 1UFFA 4XTWA 2QXFA 4XU2A 5EG2A 5GMKm 2O9SA 5KCHA 2I2LA 1OU8A 4LDYA 3JV3A 1I0CA 2HD0A 4FYXB 1S72Q 4DQ2A 5A0DA 8AT1B 3H0FA 4ZTJA 2X4YA 3A8LB 4AG1C 3CCJA 1BB9A 3JCMh 1JEGA 1VQ5A 5GMKj 5M9OA 5GMKl 3JB9G 3FC3A 2NUTA 2EKHA 5D6YA 4IIMA 3CC4A 4C92A 1X2QA 2JTMA 1OX8A 3JAME 2JMAA 2QGGA 3LX7A 2QK0A 2RN8A 4IURA 3OW2P 2SEMA 1OYXA 1RAFB 1YJWQ 3ER0A 1E6HA 5A2QE 2EGAA 1Y07A 2V1RA 4M75A 1QWFA 3HPWA 1LCKA 5IT9E 2AKKA 3RIRA 4GBQA 2FO0A 3CCQA 1RAIB 1VIFA 1ZBXA 2YLBA 3PVQA 3OY9A 4HCCA 2MOXA 1PNJA 1H641 2PTKA 1VQPA 3MJXA 2Y90A 1OULA 4C8QC 3PFSA 2K5FA 3M0PA 3NTHA 2EYZA 2OTJQ 4FM4B 2CZ1B 3OYDA 2ENMA 3QYHB 3C12A 2R58A 1PD0A 2DD4A 3CCST 2EIFA 3VUZA 2DKGA 2EJGA 4QVDA 1MGQA 4OGCA 4IUPA 2OAUA 2RD1A 3U23A 3JSCA 1UJYA 5IXBA 1PHTA 3TSZA 4B6MA 1Q81U 1NLOC 4HVUA 1ZLMA 3UATA 4LNPA 2RA2A 1LNXA 2J6KA 1YHQA 4OP0A 1YITT 2RMOA 5CKFA 3A1PA 4KUDK 1W2BP 3CCJT 1YJ9A 3HP9A 1AWOA 1WPYA 4M77G 5GAOq 3THKA 1KC8R 2MWOA 2VYTA 3CCJQ 4PKCC 4E7IA 3X20B 1VQ5Q 2PVGB 5CQXA 3X25B 1U5SA 3CC4T 4Q5WA 1N8RC 2DERA 2MF2A 4XK8E 3VYHB 3I35A 1IRXA 2CT3A 3R6OA 4E2FB 3CCMA 2ZPIB 3A8MB 3EG0A 2RHZA 4DOVA 4NS5A 1KK7A 1IB8A 3BDUA 3PIPA 2O4XA 1TTHB 3PGGA 1EFNA 2HDAA 2MAMA 1YIJA 1WJQA 1FMVA 2EQJA 2P84A 1TUDA 4JJNK 4PFOA 2E5QA 1K73R 2AHJB 2CSQA 3CCQT 1SRMA 1O75A 1WDXA 1T0JA 1A0NB 2ZCFB 4D6WA 2ZPGB 5D6WA 1VQPQ 2LC4A 6AT1B 2XD0A 2C0OA 1M5Q1 3Q1JA 4EMKA 1F1BB 5GANj 1ZUYA 2DEUA 2MI6A 2KXCA 1E6GA 4O5VA 4ELYC 2GCXA 2O31A 2DBKA 1GFCA 2VKNA 1Q82U 1K1ZA 4F16A 1YCSB 2RI5A 3R6NA 1MV0B 2LNHB 1NYFA 2WACA 1WXBA 1ZSZC 1BCOA 2EQMA 2FPDA 4BY6B 1VQ8A 1IXDA 3EGDB 2JTEA 2V1QA 3PE0A 5GAOm 2DVJA 1YHQT 3VS6A 5KYUB 1JU5C 1M1GA 1D3BA 2ZGWA 1YHQQ 3PNWC 3OYCA 2HQHA 2JS0A 3HKSA 4UC4A 1NJIU 1YJ9Q 5D6XA 3DKMA 1QP2A 1X43A 3HSBA 5GAN2 5GAOl 1YWPA 3QWYA 3CCMT 1VQNA 4C92G 2DL4A 2GFAA 4J6YA 4E6RA 2OI3A 2QQRA 3V8KA 3JCMJ 1VQKQ 3QUIA 3OW2A 4BUGA 1MNEA 4JJDA 2CYZB 1EIFA 2NUPA 1YIJT 5CQYA 2RHIA 4R55A 2HSEB 3JCMX 1OPLA 4M75G 3M0SA 1G3SA 2QEXA 4M7AE 2CT4A 2RHYA 3QWXX 4PJOE 2C0TA 4E7LA 2QDYB 3G1JA 3UDCA 2DMOA 4M78E 4DBQA 2AK5A 2QA4A 1M3CA 4HCKA 3X26B 1WHLA 1WJRA 2EQKA 4F17A 2PUKB 4RG8A 1VYTA 2K57A 5LJ3j 1MMAA 2FHDA 2A37A 3CD6A 3EGUA 3BE3A 2LT4A 4XTVA 2CGHA 1BCMA 2COYA 4AG2C 2VUBA 1VQ8T 2QAZA 3OS0A 2EPDA 3KBGA 3QBYA 2DX1A 2HNIA 2I0NA 3CPWS 3KUFA 1WXTA 2VGNA 2KT8A 4ZGDB 3I56T 2K3XA 4A4FA 4RTZA 5I22A 4KH0B 2W10A 3EHRA 4Z89A 4CC3A 1K9MR 1RADB 5GAN8 4C8QA 1ZBJA 4L5GA 1I81A 2LCCA 1AD5A 2QI2A 1JB0E 1VQMA 4R0KA 1VQNT 3RR6A 1OPKA 4F7UA 1K8AR 4M7DA 1RL2A 2GFUA 1VQNQ 1CSKA 4FW1A 1SEMA 5KYXA 3M58A 9ATCB 4OMPA 3CBPA 1M1KR 2YXYA 4XU1A 2PUOB 4DEYA 3JCMc 2QEXT 1QVFS 1YI2A 2D6FA 2QEXQ 5CK9A 3CBOA 2VV5A 3OYIA 4N0AA 2PQWA 2H3JA 3CMEA 2DXTA 2QA4T 3J80E 1OZ2A 3OS5A 2YRDA 3QXEB 3EG2A 3VKIA 4C0GA 1N8RU 1IGQA 2JVVA 2ZZDA 1PWTA 3EG9B 3WVDB 4CRIA 2GF7A 2K6DA 1TS9A 1XTDA 3CD6Q 3MO8A 2EQUA 1D1BA 2OAWA 2DNUA 2YHTA 1UDLA 5FRNA 2E70A 2RF0A 4ESRA 2MK5A 3NPFA 1M9SA 1VUBA 2DJQA 3EGXB 4J9IA 1UG1A 4E7SA 2F5KA 2VASA 4N4IA 3G7ZA 3E1SA
chains in the Genus database with same CATH topology
2DTOA 4C5HA 3J81E 3L1AA 2XI9A 5KCHA 2XIDA 5HKCA 2I2LA 2MMPA 2XHCA 4TVRA 4M75D 5CVIA 4DA4A 2IG0A 4LDYA 1VQMT 2QQ9A 4C8QE 3S3OA 2HD0A 5CR2A 4KT0E 1N9SA 2QQBA 1YHQA 4J7FA 3CXCS 4DQ2A 5IAYA 3V8LA 5A0DA 4JUVA 4E7JA 4ZTJA 2X4YA 3A8LB 4PNOA 3CCJA 3JCMV 4M77E 3JCMh 2C06A 1VQ5A 5GMKj 4F7UE 4M7DE 4ZN1A 5M9OA 5GMKl 2DIGA 1BKBA 2A7YA 2KMTA 1O9SA 2E10A 3FIFA 3JB9G 3FC3A 1VQ7T 4O6JA 3EFSA 5D6YA 3CC4A 4C92A 3CCVA 2JTMA 3JAME 3FB9A 3L2ZA 1BI2A 5KCOA 3VYGA 2LQ8A 3QSUA 2ZPHB 3L2UA 1YI2T 3LX7A 4E7HA 4HT8A 2E65A 3E9GA 2DO3A 4LD6A 1BI3A 4IURA 5A0GA 1OYXA 2QTXA 2JTFA 3ER0A 4M77A 5FROA 4E47A 5A2QE 4IUQA 1XQHA 2WSEE 3L42A 3CMET 3OBYA 3HHTB 1Y07A 5LL6S 4M75A 3HPWA 3MHXA 3OYMA 3F70A 3GLXA 4OF1A 4BDZA 5IT9E 2K2VA 1VQ9A 4L6V5 5IN1A 2XK0A 3RIRA 3FLGA 4X34A 2DIQA 3HL8A 4X9DA 2LTOA 2O4XB 2DZ9A 4MDWA 4DOWA 3JCMb 2E64A 2XDBA 3CCQA 1VIFA 4M7AB 4KUIA 1YJNA 1H3ZA 2EYQA 1ZBXA 2YLBA 5GAMj 1Q7YC 3OY9A 3OYFA 4HCCA 2KK4A 1UGSB 4PJOB 5FLXE 4R56A 1H641 1NE8A 4XTZA 1G3TA 4XU3A 4Y28E 1KQ1A 1NZ9A 2JOYA 3PMIA 3OS2A 4C92C 1VQPA 1KHCA 5DLQE 1VQ6A 2Y90A 2OTLA 3JCMQ 3OYNA 4C8QC 4M78B 2DEQA 3M53A 3PFSA 1YCYA 1YJWA 2K5FA 3T9NA 4BDYA 1Q86C 3RMSA 1P92A 4LD9K 2DAQA 1KQSS 3MP6A 3I56A 3GIBA 3NTHA 2KSSA 3JCMg 4PLIA 2BUDA 3G71T 4M77C 4EMKB 3S3MA 5GANg 4FM4B 2CZ1B 3OYDA 3QYHB 3RERA 2L8DA 3C12A 2R58A 4J5YA 1PSEA 2YLCA 5LJ5e 1RI0A 4LDXA 2XG8D 2DD4A 3GF5A 2QQAA 2LX9A 3CC7A 5FU6C 2EIFA 2KAFA 3CCST 3VUZA 5GAN7 2DKGA 2EJGA 2P0QA 2XDPA 4OB1B 5HY6A 5LJ5h 5GANd 4QVDA 3G6EA 1MGQA 3MEWA 4QW2A 3TREA 2XU8A 3CMAT 4OGCA 2PU9B 3BY7A 4IUPA 3RMQA 2OAUA 1K73C 1K9MU 2RD1A 2E6ZA 3CD6T 2K5LA 1QVPA 2ZPBB 1U1TA 3JSCA 3OYYA 5KH6A 2WSCE 4MZMA 1Q81U 1ZHIA 4A53A 2ZPFB 4FT2A 4PL6A 4C92F 4C8QG 4M7AD 3HFOA 2RA2A 1LNXA 2LDMA 2RHXA 2K3YA 2B8AA 4OP0A 2RH2A 3C4SA 3X24B 2F69A 4C0ZA 1B34B 5GAMd 5CKFA 1YITT 1QVGS 1K8AU 4KUDK 2OTJA 3OYAA 4ZGEB 3CCJT 2DXCA 1YJ9A 3G4ST 3HP9A 1WPYA 4M77G 5GAOq 4JLIA 3CCLT 1D3BB 3MEVA 4M78D 4JRQA 4F7UG 2HAXA 1JBMA 4M7DG 2MWOA 2VYTA 4A54A 4HCBA 3RESA 3AHUA 5CKDA 4HT9A 4PKCC 3RUXA 2Y4YA 3M4YA 5CO7A 3KXTA 3X20B 4EMGA 4E7IA 2PVGB 5CQXA 3X25B 3J7AF 1M1KU 2VXEA 4M75F 3CC4T 4JRKA 2DD5A 4A4GA 4Q5WA 4QQDA 3CCVT 1N8RC 4LDVA 3PIOA 4MDXA 1M90C 2BKDN 4YTLA 2MF2A 4V2SA 2DTIA 4XK8E 3VYHB 3GNGA 3OA6A 3R6OA 3CCMA 4KBMB 2DVEA 2ZPIB 1Y96B 3A8MB 4C92E 3N5BB 1S72T 2RHZA 4N4HA 3LGFA 1XNIA 4NS5A 4DOVA 5DM7R 3QG1A 4EMHA 1HK9A 2KDSA 1SSFA 4JDSA 3EAEA 3BDUA 3PIPA 1KD1U 4GY5A 3BFMA 4LDUA 3QPHA 1BIBA 2O4XA 2IVWA 2L5QA 3G7ZA 3PGGA 4OGEA 5GMKe 4C5IA 4RMOA 4M7AA 1VQ9T 2MAMA 1YIJA 1WJQA 2EQJA 3V7CA 3FEOA 3OMCA 4JJNK 1WGSA 2E5QA 4BI8B 4PJOA 2AHJB 2XKOC 4M75E 3A8OB 3CCQT 1YJNT 3CCUA 3CCEA 2JZ2A 1VQLT 1O75A 3A5ZB 3OBWA 3LYIA 4M78A 5GAOp 2DXUA 2DZCA 4RCCA 3GNFB 3RKYA 1N6AA 3MP8A 2OTLT 4NOYA 2ZCFB 4D6WA 2ZPGB 1VIEA 4HKEA 5D6WA 3QDRB 4IKFA 2LC4A 2VXFA 3PT9A 5GANf 4XTYA 1YJWT 2XD0A 1M5Q1 2Y4XA 4FU6A 3Q1JA 4EMKA 3M56A 3O8VA 1X75C 3UWNA 2D0QB 2FL7A 4J6XA 3CXCA 5GANj 2MI6A 3RKWA 1PSFA 3CPWA 4EPCA 2E41A 2EFIA 5C0MA 1W2BA 3FDRA 4O5VA 2A3LA 2RJFA 4FL6A 5J3BA 2EWNA 4XTXA 3M54A 2GCXA 4ELYC 4B9XA 1M8VA 1UB4A 3CC7T 3QYGB 1Q82U 1XOVA 1OI1A 2M16A 4M7AC 2RI5A 1G3WA 5GAMf 5GAMe 5J39A 2EAYA 2RM4A 3CPFA 3G6ET 2RJCA 5LJ3g 3L2RA 5I2MA 4NL3A 4PJOC 3QKJA 2WACA 3LWHA 1FWZA 2E6NA 4RKUE 4BE0A 3JB9D 2EQMA 3MEUA 4BY6B 3DLMA 1VQ8A 2R57A 4M78C 5LJ3d 1WNLA 4MMKA 1Y71A 1B34A 2RJEA 4C5GA 5GAOm 2L89A 1R8OB 3ZFJA 4C5EA 4BI4A 1YHQT 3ZEHA 3ZBDA 1M1GA 2LQKA 1D3BA 2V8JA 2ZGWA 1M1FA 2OTJT 3V7SA 4HA8A 3PNWC 4ME7A 4ZTFA 3OYCA 3M55A 1VQ7A 3HKSA 4RG2A 4UC4A 3VJPA 1NJIU 4C0FA 3A8HB 3CCRA 5D6XA 4M75C 4OB3B 5CCAA 4JRPA 1KHIA 2RJDA 3NTKA 4J83A 5HK3A 3DKMA 1QP2A 3JCMd 1FX7A 2RB6A 3UT1A 4BE1A 3HSBA 5GAN2 4QQ6A 4XAXB 5GAOl 3JB9J 3OYGA 4M7AF 1Y96A 1BIAA 1AHJB 1I8FA 5GAN6 3QZ9B 4C8QB 4QVZA 4FT4A 2M0OA 2XDDA 3JCMW 4PJOF 4ATOA 1QVFA 3CCMT 2V8IA 1VQNA 2K4YA 4C92G 3E9FA 2GFAA 3P8BB 5I21A 2RK1A 4J6YA 2HBPA 2K5IA 4OB0B 1U1SA 4M78F 2QQRA 4XQ3A 1N9RA 5CKBA 4X9CA 3V8KA 3JCMJ 1LJOA 3QUIA 4OMFB 3OW2A 4F7UB 5GAN3 4M7DB 3M57A 4BUGA 2G3RA 2CYZB 1BYMA 1VQOA 1EIFA 2DTHA 3S6WA 1YIJT 5FU7C 5CQYA 3FRNA 3SB2A 1VQ5T 2RHIA 4FIBA 5DLOA 3L2QA 4R55A 1HXDA 3JCMX 4FSXA 5GAOn 3GOXA 4BE2A 3GPLA 4M75G 3UPUA 3CC2A 2X4XA 4OB2B 3CCUT 1G3SA 3CCET 2QEXA 4M7AE 3QHSA 2KQWA 4P5NA 2LNVA 2RHYA 1K9MC 4PJOE 4CI0C 1UGQB 4E7LA 3ASKA 4BD3A 2QDYB 2DJZA 1Q81C 2HQEA 4Z02A 3UDCA 4M78E 3WXMB 5GAOr 3CEYA 3OQ5A 4QQGA 1VQKA 3DB3A 3EFRA 5CKHA 3CBMA 4C0DB 3C94A 3L2WA 2QA4A 3X26B 5KE3A 3VV0A 1WJRA 2EQKA 3GP8A 1VQ4A 1K8AC 4C8QD 3QO3A 4L59A 5LJ3f 3CCSA 2PUKB 1KG1A 2CZ0B 4RG8A 2K57A 5LJ3j 2FHDA 3CMAA 4BI3A 1BI0A 2LCLA 4WF2A 5C6SA 5GMKh 5LJ5g 3OSVA 3CD6A 4M77D 2O01E 3JRZA 2YRVA 1M1KC 4GLKA 4M7DD 2DPPB 3SFMA 2KVQG 2LT4A 5GAN5 3SWNB 3C95A 3X28B 2LRQA 3SD4A 4MMLA 4XTVA 2CGHA 3WVEB 3HFNA 1VQ8T 2VUBA 2JNGA 5LJ5d 3OYEA 4KULA 3OS0A 1M4ZA 1VQPT 4EDUA 4JS5A 3KBGA 3INZA 2NLUA 3NTIA 3QBYA 2HNIA 1UGRB 3MP1A 1YITA 3JCMf 3OS1A 1VQ6T 3JCMe 2CS7A 3KUFA 3CPWS 2PVOB 1WQ7A 5GANe 2V8KA 5FRMA 1W2BS 3G4SA 2VGNA 2E1HA 2MWPA 3FJPA 3CCLA 2RHUA 4ZGDB 2K3XA 4A4FA 3I56T 5GANh 3M59A 1KD1C 4II1A 4J7IA 1IZ6A 3QJYA 3BW1A 3JB9I 4PLLA 5HK0A 5A0LA 2HQXA 2FVUA 3HRSA 1YBYA 5GMKi 2L3RA 3CCRT 1G3YA 2QQSA 1Q7YU 3JB9F 2R5AA 4ZGJB 3LWIA 1KC8U 3I55A 3JCMP 1U8RA 3LLRA 5GAN8 4C8QA 4L5GA 1I81A 5KE2A 2LCCA 4BACA 3NFCA 5AYFA 2GQVA 2EJ9A 3M4GA 4Y91A 2QI2A 3H6ZA 4BY6C 3P8HA 5J26A 5GAMh 3OMGA 1S72A 1JB0E 1VQMA 4A4EA 4ZN3A 1Q86U 5CKEA 1VQNT 2LT1A 2RK2A 4LDWA 4MZPA 3S3NA 4F7UA 4M7DA 1RL2A 2X4WA 4RCBA 2GFUA 3QIIA 2P0PA 3SDZA 1IREB 4E7KA 3HRUA 1N27A 2RI3A 2M1HA 3M5AA 2P0KA 3OB9A 4N4GA 3H8ZA 3M58A 1WQWA 3PMTA 4EMKC 3OSSC 3LH0A 1VQOT 3CBPA 1YJ9T 3JB9H 4HCZA 4JS4A 4XU1A 3ME9A 2JUFA 1KC8C 2PUOB 5EG2A 4ELZC 3TU4K 1Q82C 3TCJA 3CC2T 2EKOA 3JCMc 4BB7A 1K73U 5CIUA 2BIVA 3META 4J8OA 2QEXT 1NPRA 3OYJA 2X4JA 2PVDB 1QVFS 2RO0A 2FB7A 4XTUA 1ZQ1A 4M7AG 2DXBA 1YI2A 1JJ2S 2KY9A 2P4TA 3L2VA 4C92B 5GAN4 2D6FA 5DY9A 4PJOG 5CK9A 2ZPEB 1W4SA 1BI1A 1OZ3A 3CBOA 1I4K1 2VV5A 3MCAB 3OYIA 3URGA 1QP3A 3QZ5B 4N0AA 2E12A 2PQWA 3OW2S 3V8JA 5CAIA 4M78G 2XICA 1UGPB 4IUTA 1VQKT 2CKKA 2H3JA 3CMEA 1NPPA 2DXTA 2QA4T 4JRIA 1X6OA 4OVAA 3J80E 4M7DC 3OYLA 1KQSA 2CZ7B 1FXXA 1OZ2A 4M77B 5LJ5f 3OS5A 1VQ4T 2VGMA 1UEBA 4VUBA 2F5TX 4JLGA 2EJFA 3QXEB 3A8GB 1I5LA 3DB4A 4M75B 5LJ5j 2WSFE 2JN0A 4J6WA 4IUVA 3QJ6A 4QVCA 5FU6B 1NJIC 2LVMA 3VKIA 3SWNA 4MZTA 5L8RE 4C0GA 2CZ6B 3TEEA 1N8RU 2JVVA 2ZZDA 1G5VA 1M90U 3LW5E 3V7RA 3MEAA 3WVDB 4CRIA 1JJ2A 2GF7A 5GAMg 1XTDA 1JRIA 4A4KA 3MO8A 2EQUA 3E19A 3OYHA 2DK3A 3M9QA 3HRTA 2YHTA 2VC8A 4C8QF 4B9WA 5I2SA 2RI2A 5FRNA 4PJOD 4A4HA 2E70A 1QW1A 3RKXA 3VU3C 4C0DC 4IUUA 4XU0A 3PTAA 4N0AC 3BDLA 3DLLA 4NL2A 3G71A 1M9SA 1VUBA 2X35A 3VUBA 2FYKA 1V29B 2R5MA 4C92D 3OYKA 1WJSA 1DJ7B 1QVGA 4M77F 5FU7B 3OYBA 1TH7A 4F7UF 4M7DF 1GXIE 1LOJA 5LJ3e 3LGLA 2D9TA 4XTWA 1MHNA 1VQLA 2QXFA 4XU2A 2F5KA 1X01A 3I55T 5LJ3h 4N4IA 1KQ2A 1Y7XA 2M9UA 3P8DA 3E1SA 5GMKm 3SWNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  4A53 A;  3L1A A;  5GMK i;  4C8Q G;  4C92 F;  3V7S A;  3JB9 F;  4M7A D;  3HFO A;  4HA8 A;  2I2L A;  2RA2 A;  1LNX A;  3JCM P;  4OP0 A;  4M75 D;  5GAM d;  5GAN 8;  1B34 B;  4C8Q A;  1I81 A;  4C8Q E;  4M75 C;  4Y91 A;  2EJ9 A;  3M4G A;  1N9S A;  5GAM h;  1WPY A;  4M77 G;  4DQ2 A;  4JLI A;  2RB6 A;  1D3B B;  4M78 D;  3V8L A;  4JUV A;  3JCM d;  4F7U G;  4M7D G;  1JBM A;  3HSB A;  4A54 A;  5GAN 2;  5GAO l;  3RES A;  3AHU A;  3JB9 J;  4PNO A;  4HT9 A;  1Y96 A;  3RUX A;  3JCM V;  4M7A F;  4EMG A;  4M77 E;  1BIA A;  1I8F A;  3JCM h;  4F7U A;  5GAN 6;  4M7D A;  2VXE A;  4C8Q B;  4M75 F;  4RCB A;  4F7U E;  5GMK j;  5GMK l;  4JRK A;  3JCM W;  4PJO F;  4M7D E;  2E10 A;  3JB9 G;  3FIF A;  4C92 G;  2DTI A;  4V2S A;  5I21 A;  4J6Y A;  1WQW A;  3EFS A;  4XQ3 A;  1U1S A;  4M78 F;  4EMK C;  1N9R A;  4C92 A;  3JB9 H;  4X9C A;  2DVE A;  3FB9 A;  3L2Z A;  1LJO A;  1Y96 B;  3QUI A;  3V8K A;  4C92 E;  3JCM J;  4F7U B;  5GAN 3;  4XU1 A;  3QSU A;  4M7D B;  4HT8 A;  4EMH A;  2E65 A;  3JCM c;  1HK9 A;  2DTH A;  3BDU A;  3SB2 A;  3BFM A;  4M7A G;  2FB7 A;  1BIB A;  4XTU A;  2QTX A;  1HXD A;  3JCM X;  5GAO n;  3PGG A;  5GMK e;  4M75 G;  4M77 A;  4C92 B;  5GAN 4;  4M7A A;  5DY9 A;  4PJO G;  4M7A E;  3V7C A;  3QHS A;  4M75 A;  1I4K 1;  4PJO A;  4N0A A;  4M75 E;  5GAO q;  3V8J A;  5CAI A;  4PJO E;  4M78 G;  3RIR A;  2DXT A;  4JRI A;  4M7D C;  4X9D A;  5GAO p;  2DZ9 A;  4M78 A;  2DJZ A;  2DXU A;  2DZC A;  3JCM b;  2E64 A;  4M77 B;  4RCC A;  4M78 E;  5LJ5 f;  4M7A B;  5GAO r;  3RKY A;  2YLB A;  5GAM j;  3EFR A;  2EJF A;  4NOY A;  1I5L A;  4M75 B;  5LJ5 j;  3SWN C;  2JN0 A;  4J6W A;  4PJO B;  1H64 1;  2VXF A;  4XTZ A;  4XU3 A;  4XTY A;  4QVC A;  1KQ1 A;  3SWN A;  4C8Q D;  5GAN f;  1M5Q 1;  3QO3 A;  4C92 C;  4EMK A;  5LJ3 f;  2Y90 A;  3JCM Q;  4J6X A;  5GAN j;  4C8Q C;  4M78 B;  3V7R A;  2DEQ A;  1YCY A;  2K57 A;  5LJ3 j;  5GAM g;  3RKW A;  2E41 A;  1JRI A;  4WF2 A;  5GMK h;  5LJ5 g;  4M77 D;  3GIB A;  2EWN A;  4XTX A;  4M7D D;  1M8V A;  5GAN 5;  2YHT A;  2VC8 A;  3SWN B;  3JCM g;  4M77 C;  4C8Q F;  4EMK B;  4M7A C;  4MML A;  4XTV A;  2CGH A;  5GAM f;  5GAN g;  3HFN A;  5GAM e;  4PJO D;  2EAY A;  2RM4 A;  3RKX A;  3VU3 C;  5LJ5 d;  4XU0 A;  3RER A;  4J5Y A;  5LJ3 g;  5LJ5 e;  2YLC A;  4NL3 A;  4PJO C;  4N0A C;  3INZ A;  4NL2 A;  2HNI A;  5GAN 7;  2FYK A;  2DKG A;  3JCM f;  2EJG A;  4C92 D;  5LJ5 h;  3JCM e;  3JB9 D;  5GAN d;  4QVD A;  1MGQ A;  4M77 F;  1WQ7 A;  5GAN e;  4M78 C;  1TH7 A;  1WNL A;  4MMK A;  5LJ3 d;  4F7U F;  4M7D F;  1B34 A;  2E1H A;  1LOJ A;  3BY7 A;  3FJP A;  5LJ3 e;  2RD1 A;  4XTW A;  5GAN h;  5GAO m;  1U1T A;  4XU2 A;  1X01 A;  3BW1 A;  5LJ3 h;  1KQ2 A;  3JB9 I;  1D3B A;  5GMK m;  2ZGW A; 
#chains in the Genus database with same CATH topology
 2LQN A;  3CCV Q;  4X1V A;  2ABL A;  4KH1 B;  2IG0 A;  3VS0 A;  1VQM T;  2BZ8 A;  2EYY A;  5CR2 A;  1AZE A;  1N9S A;  1OX9 A;  3V8L A;  4PJN A;  1B7T A;  4E7J A;  1M3B A;  2BZX A;  2RQV A;  4M77 E;  1YFN A;  1QCF A;  2SRC A;  1WXU A;  2A7Y A;  1VQ7 T;  3FIF A;  1BI2 A;  4LE9 A;  1YI2 T;  1UE9 A;  2E65 A;  5KYW B;  2E3H A;  2YDL A;  1YI2 Q;  2JTF A;  4M77 A;  5FRO A;  1XQH A;  3CME T;  1RAC B;  5LL6 S;  1PG5 B;  3GLX A;  3SEM A;  4L6V 5;  4X9D A;  2DZ9 A;  4MDW A;  4DOW A;  2KK4 A;  5FLX E;  4R56 A;  4XTZ A;  1ZSZ B;  1GCQ A;  1KHC A;  4RTY A;  5DLQ E;  1VQ6 A;  3CQT A;  2KYM A;  3M53 A;  1Y57 A;  1YJW A;  3RMS A;  1P92 A;  1UEC A;  4LD9 K;  1KQS S;  3GIB A;  1D1C A;  1EX4 A;  2KSS A;  1PD1 A;  4PLI A;  1QKX A;  4DBF A;  4LDX A;  1C6V X;  2LX9 A;  5FU6 C;  1RUW A;  1QKW A;  2LJ1 A;  3VRY A;  1JJ2 S;  4QW2 A;  2XU8 A;  2A36 A;  1R0B G;  4LUE A;  1K73 C;  1QVP A;  1U1T A;  5KH6 A;  4MZM A;  5KYN A;  1ZHI A;  1RI9 A;  4WTO B;  4PL6 A;  4C8Q G;  4M7A D;  4A4K A;  2RHX A;  2EVR A;  2K3Y A;  2B8A A;  1I1J A;  2RH2 A;  3X24 B;  2F69 A;  1B34 B;  1QVG S;  2OTJ A;  4ZGE B;  2F2X A;  1K9A A;  3I5R A;  3CCL T;  1T0H A;  4M78 D;  1Q7Y R;  4F7U G;  2HAX A;  1JBM A;  4M7D G;  4HCB A;  2Y4Y A;  3KXT A;  4EMG A;  2VXE A;  4JRK A;  4A4G A;  2M0Y A;  4DBH A;  4V2S A;  2DTI A;  2EYW A;  1Q86 R;  2RQT A;  1QMC A;  4OMO A;  3OA6 A;  3VS5 A;  4KBM B;  1Y96 B;  4C92 E;  3N5B B;  1S72 T;  1MMD A;  3LGF A;  3EG3 A;  4EMH A;  1HK9 A;  1SSF A;  4GY5 A;  3BFM A;  2F2W A;  3EFO B;  2F1L A;  4RMO A;  3UA7 A;  3FEO A;  3OMC A;  2BZY A;  2A28 A;  2V26 A;  4M75 E;  1QCN A;  1JO8 A;  3OBW A;  5GAO p;  2HMA A;  3GNF B;  3RKY A;  1ABQ A;  1VIE A;  3QDR B;  3PT9 A;  1ZA1 B;  1YJW T;  4XTY A;  2CP3 A;  2QAS A;  1VQ6 Q;  2KEA A;  3O8V A;  2FL7 A;  2JMC A;  4J6X A;  1OQK A;  4EPC A;  2EFI A;  3FDR A;  5J3B A;  3RDV A;  1PKT A;  5KYY B;  2NUZ A;  2E5K A;  3QYG B;  1M90 R;  1XOV A;  2M16 A;  2KI7 A;  4M7A C;  5GAM e;  5J39 A;  3CPF A;  3L2R A;  2KNB B;  3EG1 A;  4PJO C;  4BE0 A;  4RKU E;  3JB9 D;  3MKD A;  4M78 C;  1R8O B;  4C5E A;  1NM7 A;  1VA7 A;  1SG5 A;  2V8J A;  2OTJ T;  2EGC A;  3V7S A;  1UUE A;  2AKL A;  4QT7 A;  5EC7 A;  3VJP A;  3A8H B;  2W0Z A;  5CCA A;  2KRN A;  2RJD A;  4J83 A;  3KFV A;  2CP6 A;  1AHJ B;  1BIA A;  1EZZ B;  5GAN 6;  3JCM W;  4ATO A;  2V8I A;  5I21 A;  3P8B B;  2RK1 A;  4XQ3 A;  5CKB A;  1N9R A;  4X9C A;  2YUN A;  4OMF B;  5GAN 3;  1E7O A;  3M57 A;  2EQI A;  2G3R A;  1V1C A;  4ORZ A;  3S6W A;  1VQ5 T;  4EIK A;  3L2Q A;  1HXD A;  2M02 A;  1IGU A;  3VS2 A;  4F04 B;  2LNV A;  1I5O B;  1K9M C;  3M0U A;  2FZK B;  2IIM A;  1HD3 A;  4BD3 A;  4Z02 A;  2LJ3 A;  3OQ5 A;  4QQG A;  1VQK A;  3DB3 A;  3EFR A;  3CBM A;  3L2W A;  5KE3 A;  1JXM A;  3NGP A;  1K8A C;  4L59 A;  3VRZ A;  1KG1 A;  3CMA A;  2HBW A;  4WF2 A;  1NBE B;  1UGV A;  4ZNX A;  2DL3 A;  2HKN A;  4M77 D;  5GJV B;  1ZX6 A;  3I55 Q;  1M1K C;  4GLK A;  3EGD A;  2DPP B;  3C95 A;  2HSP A;  3X28 B;  2LRQ A;  4MML A;  3WVE B;  2JNG A;  5LJ5 d;  2YUO A;  2VB6 A;  1VQP T;  5KYU A;  4AFQ C;  1JXO A;  1ZSG A;  3OS1 A;  3H41 A;  2V8K A;  5FRM A;  1W2B S;  3G4S A;  2LZ6 B;  3FJP A;  2RHU A;  3M59 A;  2FG0 A;  4J7I A;  1IZ6 A;  4DBR A;  3BW1 A;  3JB9 I;  5HK0 A;  1H3H A;  5A0L A;  2KE9 A;  2FVU A;  2KRS A;  1NLP C;  2R5A A;  1KC8 U;  1FYN A;  4RTV A;  5KE2 A;  2KBT A;  2EJ9 A;  3M4G A;  3H6Z A;  2D8H A;  3M0T A;  3OMG A;  4A4E A;  2L0A A;  2OX7 A;  5CKE A;  2MCN A;  4LDW A;  2HL3 A;  2PZ1 A;  3S3N A;  2C0I A;  3M0Q A;  1XJW B;  1IRE B;  3HRU A;  2RI3 A;  4OMM A;  4N4G A;  2DLP A;  2K79 A;  2GTO A;  3JB9 H;  1YJ9 T;  1WHM A;  1HYO A;  2JUF A;  1AOJ A;  1SF9 A;  3TCJ A;  4CC2 A;  4BB7 A;  1K73 U;  5CIU A;  4J8O A;  2PVD B;  2FB7 A;  4XTU A;  1ZQ1 A;  2KY9 A;  3L2V A;  5GAN 4;  4ANJ A;  4J9E A;  5DY9 A;  2LP5 A;  2RPN A;  1G83 A;  1QP3 A;  1KD1 R;  4D8K A;  4JZ4 A;  3V8J A;  1UGP B;  1VQK T;  1Q95 G;  2CKK A;  1NPP A;  4JRI A;  5LJ5 f;  3G71 Q;  1UEB A;  3I9Q A;  4J6W A;  4IUV A;  5FU6 B;  2LVM A;  4J9C A;  5L8R E;  3LW5 E;  4RTX A;  3CMA Q;  5GAM g;  4RTU A;  1JRI A;  3E19 A;  2NWM A;  3OYH A;  1J3T A;  3M9Q A;  2VC8 A;  4F14 A;  2ED0 A;  2CP2 A;  3CPW P;  3RKX A;  3VU3 C;  4IUU A;  4XU0 A;  2CDT A;  4OMQ A;  3BDL A;  4RUG A;  3DLL A;  1D1A A;  2X35 A;  3OYK A;  2FYK A;  2R5M A;  4C92 D;  1X6B A;  1DJ7 B;  1UTI A;  2D0N A;  3G4S Q;  1Z9Q A;  1LOJ A;  3REA B;  2D9T A;  1MHN A;  1VQL A;  3C0C A;  1TU0 B;  5FWB A;  1X01 A;  1WX6 A;  2X3W D;  2M9U A;  3NHN A;  1UJ0 A;  3SWN C;  2DTO A;  4C5H A;  2BE7 D;  3L1A A;  5HKC A;  4PJL A;  2XHC A;  4FW2 A;  4TVR A;  4M75 D;  4FSS A;  4DA4 A;  2OJ2 A;  3AT1 B;  4C8Q E;  3ZL7 C;  2QQB A;  3CXC S;  5IAY A;  1WHG A;  3O5Z A;  4PNO A;  3JCM V;  1U3O A;  4D8D A;  1T3L A;  4F7U E;  4M7D E;  2HZY A;  2DIG A;  2KMT A;  2GQI A;  2LJ0 A;  4O6J A;  3EFS A;  1OOT A;  1RLP C;  3CCV A;  3L2Z A;  5KCO A;  1QVF P;  3VYG A;  3L2U A;  4HT8 A;  2HKQ B;  2OTL Q;  4LD6 A;  1BI3 A;  5A0G A;  2QTX A;  2DRM A;  4E47 A;  2JT4 A;  3OBY A;  3OYM A;  3F70 A;  4BDZ A;  2K2V A;  1WLP B;  2CP5 A;  1VQ9 A;  1MMN A;  2XK0 A;  5IN1 A;  3FLG A;  3EG9 A;  4X34 A;  2DIQ A;  3UA6 A;  2LTO A;  4E7Z A;  2E64 A;  2XDB A;  3CC7 Q;  4M7A B;  1YJN A;  1Q7Y C;  1PRM C;  4PJO B;  1H8K A;  1G3T A;  1KQ1 A;  1NZ9 A;  2JOY A;  3PMI A;  4C92 C;  1OEB A;  3JCM Q;  3OYN A;  4M78 B;  1IO6 A;  2DEQ A;  1YCY A;  1Q86 C;  3EGX A;  1TUC A;  2BUD A;  2P4R A;  2J06 A;  3S3M A;  1K0S A;  1PRL C;  5LJ5 e;  1SRL A;  2YLC A;  1ACM B;  2KAF A;  5GAN 7;  2QG9 B;  2XDP A;  5HY6 A;  5LJ5 h;  5IH2 A;  5GAN d;  1VQL T;  2BTT A;  3TRE A;  3RMQ A;  5IHK A;  1VQL Q;  1W1F A;  1K9M U;  3CD6 T;  2E6Z A;  5FWC A;  2MIO A;  2WSC E;  2VVK A;  2X51 A;  2FZG B;  2EYX A;  2ZPF B;  4FT2 A;  5GAM d;  4C0Z A;  1K8A U;  4JZ3 A;  4FCY A;  3OYA A;  1NEG A;  4J9G A;  2LQW A;  4A54 A;  1H92 A;  3RES A;  3AHU A;  5CO7 A;  3J7A F;  1M1K U;  2DD5 A;  5L23 A;  4QQD A;  3CCV T;  1AWW A;  3I5S A;  5KYW A;  3PIO A;  3CCU Q;  1M90 C;  2BKD N;  4YTL A;  3TSW A;  1M2V B;  1D0Z A;  4CC7 A;  2YSQ A;  4N4H A;  5DM7 R;  3QG1 A;  3EAE A;  4LDU A;  4RTW A;  2IVW A;  2L5Q A;  4OGE A;  3VS4 A;  5GMK e;  4C5I A;  1X27 A;  1VQ9 T;  3V7C A;  4BI8 B;  1VQ9 Q;  3A8O B;  1YJN T;  1ZSZ A;  3RBB B;  1IHV A;  1AZG B;  4FYY B;  1I07 A;  3CCE A;  2EW3 A;  2YRC A;  3LYI A;  4K11 A;  2DXU A;  1YJN Q;  4RCC A;  1BBZ A;  3TVT A;  2O88 A;  4HKE A;  4IKF A;  5GAN f;  2Y4X A;  4FU6 A;  3M56 A;  1X75 C;  3UWN A;  3CXC A;  3CPW A;  1PSF A;  4HVW A;  1JJ2 P;  5GAM f;  1G3W A;  4Z8A A;  1TWB A;  1AT1 B;  2COW A;  2NYS A;  2L2P A;  5I2M A;  4NL3 A;  1NYG A;  1FWZ A;  4A63 B;  5IXF A;  3DLM A;  1FMK A;  4AFU C;  2R57 A;  3E2U A;  5LJ3 d;  1WNL A;  1B34 A;  2RJE A;  4C5G A;  4JJC A;  2D1X A;  4BI4 A;  2XMF A;  3ZBD A;  4Y92 A;  1UHC A;  2DL7 A;  1HSQ A;  4HA8 A;  4ME7 A;  4ZTF A;  3M55 A;  4JPB W;  1GBQ A;  2DL5 A;  1M8M A;  1X69 A;  4OB3 B;  4JRP A;  4KGV B;  1FX7 A;  3UT1 A;  1TOV A;  3CC2 Q;  4QQ6 A;  4XAX B;  2CP0 A;  3OYG A;  4M7A F;  1Y96 A;  3VS7 A;  3QZ9 B;  2CP7 A;  1B3Q A;  4PJO F;  2DF6 A;  1QVF A;  2K4Y A;  3E9F A;  3EFO A;  1T3S A;  2K5I A;  4OB0 B;  4M78 F;  2L3P A;  3EH2 A;  1VQ4 Q;  2ROT A;  5DLO A;  4BE2 A;  5GAO n;  3UPU A;  3GPL A;  3CCE T;  3QHS A;  2KQW A;  4P5N A;  4CI0 C;  1LPL A;  2ZAE A;  3CCE Q;  1UGQ B;  1PC0 A;  3ASK A;  1W70 A;  3WXM B;  3CEY A;  3C94 A;  3VV0 A;  5KYY A;  2RQW A;  4C8Q D;  3QO3 A;  5LJ3 f;  3CCS A;  2KT1 A;  2CZ0 B;  2O2O A;  1X2K A;  1AWJ A;  2KGT A;  4BI3 A;  1BI0 A;  2LCL A;  5C6S A;  5LJ5 g;  3OSV A;  2KRO A;  2O01 E;  4M7D D;  3SFM A;  2KVQ G;  5GAN 5;  3SWN B;  3HTR A;  3SD4 A;  1BU1 A;  1QLY A;  2RQR A;  4JS5 A;  4PK4 A;  2NLU A;  1VQ6 T;  3MP1 A;  1YIT A;  3JCM e;  2PVO B;  2JXB A;  5GAN e;  5IHN A;  2MWP A;  5FW9 A;  5GAN h;  2ATC B;  1KD1 C;  4HXJ A;  1RAG B;  4J9H A;  2YWW A;  2HQX A;  3JB9 F;  1Q7Y U;  2QQS A;  3LWI A;  3I55 A;  3JCM P;  3LLR A;  3SHW A;  4LN2 A;  4BAC A;  1Q81 R;  2MPX C;  5J26 A;  5GAM h;  1NG2 A;  4GLM A;  4ZN3 A;  1Q86 U;  4AFZ C;  2LT1 A;  4MZP A;  3QII A;  4E7K A;  2DBM A;  3M5A A;  2P0K A;  1YWO A;  3H8Z A;  3VS1 A;  1WQW A;  3LH0 A;  3ME9 A;  1K76 A;  4ELZ C;  3TU4 K;  4OMN A;  2BIV A;  3MET A;  1SPK A;  5IHI A;  2NUT B;  2DXB A;  4WCI A;  2P4T A;  2K7A A;  4C92 B;  1C0M A;  2F2V A;  1OZ3 A;  1CKB A;  2FRY A;  2ED1 A;  3MCA B;  3URG A;  3OW2 S;  2E12 A;  4QKU A;  4IUT A;  1X6O A;  2G6F X;  4M7D C;  2E3I A;  5ECA A;  1KQS A;  1FXX A;  2VGM A;  2F5T X;  2EJF A;  3A8G B;  1I5L A;  3DB4 A;  4M75 B;  5I11 A;  2JN0 A;  2EGE A;  4DEX A;  4MZT A;  3CCS Q;  1TXQ A;  3TEE A;  1G5V A;  1SSH A;  1M90 U;  3V7R A;  1JJ2 A;  2VWF A;  4Z88 A;  2B86 A;  1CKA A;  3HRT A;  5I2S A;  4B9W A;  1QCO A;  1QW1 A;  4C0D C;  3PTA A;  3H9N A;  4N0A C;  1YIT Q;  3G71 A;  1V29 B;  2JM8 A;  2FEI A;  1WJS A;  1QVG A;  1UHF A;  4M77 F;  1GRI A;  2YT6 A;  5FU7 B;  3M0R A;  3OYB A;  2CSI A;  1Q82 R;  2M51 A;  5LJ3 e;  3FJ5 A;  1KSW A;  3I55 T;  5LJ3 h;  1KQ2 A;  1Y7X A;  1TSF A;  2IPO B;  3P8D A;  3CC4 Q;  4BDY A;  3J81 E;  1VOM A;  2LMJ A;  2XI9 A;  2XID A;  1X6G A;  2MMP A;  5CVI A;  2AIR B;  2X3X D;  2QQ9 A;  3S3O A;  2DL8 A;  4KT0 E;  3A98 A;  1HJD A;  4J7F A;  4JUV A;  3H0I A;  2LCS A;  1NJI R;  2C06 A;  2EBP A;  4ZN1 A;  2YUQ A;  1BKB A;  4OML A;  1O9S A;  2E10 A;  1AWX A;  3CCQ Q;  3FB9 A;  2LQ8 A;  1KFZ A;  3QSU A;  2ZPH B;  4E7H A;  3E9G A;  2DO3 A;  1YP5 A;  3D7S B;  1M27 C;  2AZS A;  4IUQ A;  1TUG B;  2WSE E;  3L42 A;  3NMZ C;  3HHT B;  1GBR A;  1MMG A;  3MHX A;  4OF1 A;  2PNI A;  5HCK A;  3HL8 A;  4KGX B;  2BE9 B;  2O4X B;  3EH1 A;  3JCM b;  1NEB A;  4KUI A;  1H3Z A;  2EYQ A;  5GAM j;  3OYF A;  1UGS B;  1NE8 A;  4XU3 A;  4Y28 E;  1M3A A;  3OS2 A;  2GTJ A;  2OTL A;  4FYW B;  1M2O A;  3T9N A;  2DAQ A;  2LX7 A;  3MP6 A;  4KGZ B;  3I56 A;  1VYV A;  1ARK A;  3JCM g;  3G71 T;  4M77 C;  4EMK B;  5GAN g;  3LH5 A;  3RER A;  2L8D A;  4J5Y A;  1PSE A;  4LUD A;  1RI0 A;  2XG8 D;  2JJ9 A;  3GF5 A;  2QQA A;  3CC7 A;  2P0Q A;  4OB1 B;  3G6E A;  3MEW A;  3CMA T;  2K9G A;  2PU9 B;  3BY7 A;  2K5L A;  2DE0 X;  2J05 A;  2ZPB B;  3OYY A;  2DFU A;  4A53 A;  1GCQ C;  3CCM Q;  4C92 F;  3HFO A;  3CXC P;  2LDM A;  3C4S A;  1ZUU A;  2DXC A;  3G4S T;  4JLI A;  1D3B B;  3MEV A;  2O9V A;  4JRQ A;  1YIJ Q;  5CKD A;  4HT9 A;  3VS3 A;  1Z9Z A;  3RUX A;  3M4Y A;  2CRE A;  4M75 F;  4PJJ A;  4AFS C;  4LDV A;  4MDX A;  2H3E B;  5GJW B;  3GNG A;  1SHG A;  2DVE A;  2KRM A;  2DM1 A;  1V76 A;  4FYV B;  1XNI A;  2ESW A;  2KDS A;  4JDS A;  1KD1 U;  3QPH A;  1WZO A;  1BIB A;  2CH4 W;  4M7A A;  2H8H A;  1WGS A;  1PKS A;  4PJO A;  2XKO C;  3TQ7 P;  2NUP B;  3CCU A;  2JZ2 A;  3A5Z B;  4M78 A;  4PJM A;  2DZC A;  1N6A A;  2FRW A;  4PFP A;  3MP8 A;  2OTL T;  4NOY A;  1VQ8 Q;  2MYS A;  2VXF A;  2GGR A;  1JQQ A;  2CUD A;  2D0Q B;  1RAB B;  1WYX A;  3RKW A;  2E41 A;  3I56 Q;  5C0M A;  1W2B A;  2A3L A;  2RJF A;  4FL6 A;  2EWN A;  4XTX A;  3M54 A;  4B9X A;  1N8R R;  4AT1 B;  1UB4 A;  1M8V A;  3CC7 T;  1VYU A;  5D7U A;  1OI1 A;  1WHH A;  3UF4 A;  2AT1 B;  2EAY A;  2RM4 A;  3G6E T;  3RNJ A;  2RJC A;  4HVV A;  2QYZ A;  4LXC A;  5LJ3 g;  3QKJ A;  1ZUK A;  2GNC A;  2QDL A;  3LWH A;  3G6E Q;  2E6N A;  3MEU A;  2FPF A;  1RAH B;  4MMK A;  1KJW A;  1W6X A;  1Y71 A;  2L89 A;  3ZFJ A;  1MV3 A;  1PM3 A;  2D8J A;  2K2M A;  3ZEH A;  2LQK A;  1K4U S;  1M1F A;  4JJB A;  4J9F A;  1VQ7 A;  4RG2 A;  4J9D A;  4C0F A;  4IIO A;  3CCR A;  4M75 C;  2RNA A;  2QTV A;  1KHI A;  3NTK A;  5HK3 A;  3JCM d;  2RB6 A;  1M2V A;  4BE1 A;  1YNZ A;  4J9B A;  3JB9 J;  1GL5 A;  1AVZ C;  1I8F A;  2DET A;  4C8Q B;  4QVZ A;  4FT4 A;  2M0O A;  2XDD A;  1GFD A;  2HBP A;  1U1S A;  1LJO A;  4F7U B;  2QA4 Q;  4M7D B;  2AZV A;  1BYM A;  1VQO A;  1WI7 A;  2DTH A;  2J6O A;  5FU7 C;  1TG0 A;  3SB2 A;  3FRN A;  5KYX B;  4FIB A;  2DIL A;  4FSX A;  3GOX A;  1RAE B;  3CC2 A;  2X4X A;  1IHW A;  4OB2 B;  1SHF A;  1D09 B;  3CCU T;  2DA9 A;  1WFW A;  2HEQ A;  2JM9 A;  2JW4 A;  1OV3 A;  2DJZ A;  1Q81 C;  2HQE A;  3PVL A;  5GAO r;  1ABO A;  4C0D B;  5CKH A;  3GP8 A;  1VQ4 A;  2FPE A;  2COZ A;  2CUB A;  2K3B A;  4M4Z A;  4CC4 B;  5GMK h;  3JRZ A;  2YRV A;  1WIE A;  3HFN A;  3OYE A;  4KUL A;  1M4Z A;  1MUZ A;  4EDU A;  3INZ A;  1VQM Q;  3NTI A;  1UGR B;  3JCM f;  3REB B;  2CS7 A;  2CH4 A;  1WQ7 A;  1U06 A;  1KQS P;  2E1H A;  3CCL A;  3ULR B;  2GBQ A;  1ZA2 B;  2DYI A;  4II1 A;  2A0F B;  3QJY A;  1N5Z A;  4PLL A;  1R0C B;  1WA7 A;  1BK2 A;  1D0X A;  3HRS A;  1YBY A;  5GMK i;  2L3R A;  3CCR T;  1G3Y A;  2HCK A;  4ZGJ B;  1VQ7 Q;  1RLQ C;  1U8R A;  3CCR Q;  1K0X A;  3IQL A;  1WHJ A;  3NFC A;  5AYF A;  2GQV A;  4Y91 A;  2DRK A;  4BY6 C;  3P8H A;  2Z0W A;  1S72 A;  3EHQ A;  2J6F A;  2RQU A;  1OU9 A;  2RK2 A;  1MND A;  2X4W A;  4RCB A;  2P0P A;  1G2B A;  3SDZ A;  2ECZ A;  1N27 A;  4PFZ A;  2M1H A;  3CME Q;  1QVG P;  3OB9 A;  3PMT A;  4EMK C;  7AT1 B;  3OSS C;  1WHK A;  1VQO T;  4HCZ A;  4JS4 A;  1GCP A;  2DYB A;  1KC8 C;  1VQO Q;  1Q82 C;  3CC2 T;  2EKO A;  2KYB A;  2X9H A;  1D0Y A;  1NPR A;  1C1A A;  3QDF A;  2X4J A;  3OYJ A;  4M7A G;  2RO0 A;  1B07 A;  1LVK A;  2L3Q A;  4PJO G;  2ZPE B;  1W4S A;  1BI1 A;  1QWE A;  1I4K 1;  3QZ5 B;  1AEY A;  5CAI A;  4AMC A;  2L3S A;  2XIC A;  4M78 G;  1M30 A;  5AT1 B;  4OVA A;  3OYL A;  2CZ7 B;  2HL5 C;  4M77 B;  1VQ4 T;  1Y0M A;  3MPU B;  2KR3 A;  4VUB A;  4JLG A;  2A08 A;  2ROL A;  5LJ5 j;  2WSF E;  4RTT A;  3QJ6 A;  4QVC A;  1NJI C;  3SWN A;  1R77 A;  2CZ6 B;  1QQJ A;  1RAA B;  1FMW A;  4KRT A;  3MEA A;  2KXD A;  2YUP A;  1G8X A;  2DK3 A;  2E4H A;  8ATC B;  1YN8 A;  4C8Q F;  1KIK A;  2RI2 A;  4PJO D;  4A4H A;  2QGF B;  4NL2 A;  1PCX A;  1S1N A;  3VUB A;  1SKU B;  2FZC B;  2J7I A;  3H0H A;  2JS2 A;  3CCL Q;  1TH7 A;  4F7U F;  4M7D F;  1GXI E;  3GBQ A;  3LGL A;  1UFF A;  4XTW A;  2QXF A;  4XU2 A;  5EG2 A;  5GMK m;  2O9S A;  5KCH A;  2I2L A;  1OU8 A;  4LDY A;  3JV3 A;  1I0C A;  2HD0 A;  4FYX B;  1S72 Q;  4DQ2 A;  5A0D A;  8AT1 B;  3H0F A;  4ZTJ A;  2X4Y A;  3A8L B;  4AG1 C;  3CCJ A;  1BB9 A;  3JCM h;  1JEG A;  1VQ5 A;  5GMK j;  5M9O A;  5GMK l;  3JB9 G;  3FC3 A;  2NUT A;  2EKH A;  5D6Y A;  4IIM A;  3CC4 A;  4C92 A;  1X2Q A;  2JTM A;  1OX8 A;  3JAM E;  2JMA A;  2QGG A;  3LX7 A;  2QK0 A;  2RN8 A;  4IUR A;  3OW2 P;  2SEM A;  1OYX A;  1RAF B;  1YJW Q;  3ER0 A;  1E6H A;  5A2Q E;  2EGA A;  1Y07 A;  2V1R A;  4M75 A;  1QWF A;  3HPW A;  1LCK A;  5IT9 E;  2AKK A;  3RIR A;  4GBQ A;  2FO0 A;  3CCQ A;  1RAI B;  1VIF A;  1ZBX A;  2YLB A;  3PVQ A;  3OY9 A;  4HCC A;  2MOX A;  1PNJ A;  1H64 1;  2PTK A;  1VQP A;  3MJX A;  2Y90 A;  1OUL A;  4C8Q C;  3PFS A;  2K5F A;  3M0P A;  3NTH A;  2EYZ A;  2OTJ Q;  4FM4 B;  2CZ1 B;  3OYD A;  2ENM A;  3QYH B;  3C12 A;  2R58 A;  1PD0 A;  2DD4 A;  3CCS T;  2EIF A;  3VUZ A;  2DKG A;  2EJG A;  4QVD A;  1MGQ A;  4OGC A;  4IUP A;  2OAU A;  2RD1 A;  3U23 A;  3JSC A;  1UJY A;  5IXB A;  1PHT A;  3TSZ A;  4B6M A;  1Q81 U;  1NLO C;  4HVU A;  1ZLM A;  3UAT A;  4LNP A;  2RA2 A;  1LNX A;  2J6K A;  1YHQ A;  4OP0 A;  1YIT T;  2RMO A;  5CKF A;  3A1P A;  4KUD K;  1W2B P;  3CCJ T;  1YJ9 A;  3HP9 A;  1AWO A;  1WPY A;  4M77 G;  5GAO q;  3THK A;  1KC8 R;  2MWO A;  2VYT A;  3CCJ Q;  4PKC C;  4E7I A;  3X20 B;  1VQ5 Q;  2PVG B;  5CQX A;  3X25 B;  1U5S A;  3CC4 T;  4Q5W A;  1N8R C;  2DER A;  2MF2 A;  4XK8 E;  3VYH B;  3I35 A;  1IRX A;  2CT3 A;  3R6O A;  4E2F B;  3CCM A;  2ZPI B;  3A8M B;  3EG0 A;  2RHZ A;  4DOV A;  4NS5 A;  1KK7 A;  1IB8 A;  3BDU A;  3PIP A;  2O4X A;  1TTH B;  3PGG A;  1EFN A;  2HDA A;  2MAM A;  1YIJ A;  1WJQ A;  1FMV A;  2EQJ A;  2P84 A;  1TUD A;  4JJN K;  4PFO A;  2E5Q A;  1K73 R;  2AHJ B;  2CSQ A;  3CCQ T;  1SRM A;  1O75 A;  1WDX A;  1T0J A;  1A0N B;  2ZCF B;  4D6W A;  2ZPG B;  5D6W A;  1VQP Q;  2LC4 A;  6AT1 B;  2XD0 A;  2C0O A;  1M5Q 1;  3Q1J A;  4EMK A;  1F1B B;  5GAN j;  1ZUY A;  2DEU A;  2MI6 A;  2KXC A;  1E6G A;  4O5V A;  4ELY C;  2GCX A;  2O31 A;  2DBK A;  1GFC A;  2VKN A;  1Q82 U;  1K1Z A;  4F16 A;  1YCS B;  2RI5 A;  3R6N A;  1MV0 B;  2LNH B;  1NYF A;  2WAC A;  1WXB A;  1ZSZ C;  1BCO A;  2EQM A;  2FPD A;  4BY6 B;  1VQ8 A;  1IXD A;  3EGD B;  2JTE A;  2V1Q A;  3PE0 A;  5GAO m;  2DVJ A;  1YHQ T;  3VS6 A;  5KYU B;  1JU5 C;  1M1G A;  1D3B A;  2ZGW A;  1YHQ Q;  3PNW C;  3OYC A;  2HQH A;  2JS0 A;  3HKS A;  4UC4 A;  1NJI U;  1YJ9 Q;  5D6X A;  3DKM A;  1QP2 A;  1X43 A;  3HSB A;  5GAN 2;  5GAO l;  1YWP A;  3QWY A;  3CCM T;  1VQN A;  4C92 G;  2DL4 A;  2GFA A;  4J6Y A;  4E6R A;  2OI3 A;  2QQR A;  3V8K A;  3JCM J;  1VQK Q;  3QUI A;  3OW2 A;  4BUG A;  1MNE A;  4JJD A;  2CYZ B;  1EIF A;  2NUP A;  1YIJ T;  5CQY A;  2RHI A;  4R55 A;  2HSE B;  3JCM X;  1OPL A;  4M75 G;  3M0S A;  1G3S A;  2QEX A;  4M7A E;  2CT4 A;  2RHY A;  3QWX X;  4PJO E;  2C0T A;  4E7L A;  2QDY B;  3G1J A;  3UDC A;  2DMO A;  4M78 E;  4DBQ A;  2AK5 A;  2QA4 A;  1M3C A;  4HCK A;  3X26 B;  1WHL A;  1WJR A;  2EQK A;  4F17 A;  2PUK B;  4RG8 A;  1VYT A;  2K57 A;  5LJ3 j;  1MMA A;  2FHD A;  2A37 A;  3CD6 A;  3EGU A;  3BE3 A;  2LT4 A;  4XTV A;  2CGH A;  1BCM A;  2COY A;  4AG2 C;  2VUB A;  1VQ8 T;  2QAZ A;  3OS0 A;  2EPD A;  3KBG A;  3QBY A;  2DX1 A;  2HNI A;  2I0N A;  3CPW S;  3KUF A;  1WXT A;  2VGN A;  2KT8 A;  4ZGD B;  3I56 T;  2K3X A;  4A4F A;  4RTZ A;  5I22 A;  4KH0 B;  2W10 A;  3EHR A;  4Z89 A;  4CC3 A;  1K9M R;  1RAD B;  5GAN 8;  4C8Q A;  1ZBJ A;  4L5G A;  1I81 A;  2LCC A;  1AD5 A;  2QI2 A;  1JB0 E;  1VQM A;  4R0K A;  1VQN T;  3RR6 A;  1OPK A;  4F7U A;  1K8A R;  4M7D A;  1RL2 A;  2GFU A;  1VQN Q;  1CSK A;  4FW1 A;  1SEM A;  5KYX A;  3M58 A;  9ATC B;  4OMP A;  3CBP A;  1M1K R;  2YXY A;  4XU1 A;  2PUO B;  4DEY A;  3JCM c;  2QEX T;  1QVF S;  1YI2 A;  2D6F A;  2QEX Q;  5CK9 A;  3CBO A;  2VV5 A;  3OYI A;  4N0A A;  2PQW A;  2H3J A;  3CME A;  2DXT A;  2QA4 T;  3J80 E;  1OZ2 A;  3OS5 A;  2YRD A;  3QXE B;  3EG2 A;  3VKI A;  4C0G A;  1N8R U;  1IGQ A;  2JVV A;  2ZZD A;  1PWT A;  3EG9 B;  3WVD B;  4CRI A;  2GF7 A;  2K6D A;  1TS9 A;  1XTD A;  3CD6 Q;  3MO8 A;  2EQU A;  1D1B A;  2OAW A;  2DNU A;  2YHT A;  1UDL A;  5FRN A;  2E70 A;  2RF0 A;  4ESR A;  2MK5 A;  3NPF A;  1M9S A;  1VUB A;  2DJQ A;  3EGX B;  4J9I A;  1UG1 A;  4E7S A;  2F5K A;  2VAS A;  4N4I A;  3G7Z A;  3E1S A; 
#chains in the Genus database with same CATH homology
 2DTO A;  4C5H A;  3J81 E;  3L1A A;  2XI9 A;  5KCH A;  2XID A;  5HKC A;  2I2L A;  2MMP A;  2XHC A;  4TVR A;  4M75 D;  5CVI A;  4DA4 A;  2IG0 A;  4LDY A;  1VQM T;  2QQ9 A;  4C8Q E;  3S3O A;  2HD0 A;  5CR2 A;  4KT0 E;  1N9S A;  2QQB A;  1YHQ A;  4J7F A;  3CXC S;  4DQ2 A;  5IAY A;  3V8L A;  5A0D A;  4JUV A;  4E7J A;  4ZTJ A;  2X4Y A;  3A8L B;  4PNO A;  3CCJ A;  3JCM V;  4M77 E;  3JCM h;  2C06 A;  1VQ5 A;  5GMK j;  4F7U E;  4M7D E;  4ZN1 A;  5M9O A;  5GMK l;  2DIG A;  1BKB A;  2A7Y A;  2KMT A;  1O9S A;  2E10 A;  3FIF A;  3JB9 G;  3FC3 A;  1VQ7 T;  4O6J A;  3EFS A;  5D6Y A;  3CC4 A;  4C92 A;  3CCV A;  2JTM A;  3JAM E;  3FB9 A;  3L2Z A;  1BI2 A;  5KCO A;  3VYG A;  2LQ8 A;  3QSU A;  2ZPH B;  3L2U A;  1YI2 T;  3LX7 A;  4E7H A;  4HT8 A;  2E65 A;  3E9G A;  2DO3 A;  4LD6 A;  1BI3 A;  4IUR A;  5A0G A;  1OYX A;  2QTX A;  2JTF A;  3ER0 A;  4M77 A;  5FRO A;  4E47 A;  5A2Q E;  4IUQ A;  1XQH A;  2WSE E;  3L42 A;  3CME T;  3OBY A;  3HHT B;  1Y07 A;  5LL6 S;  4M75 A;  3HPW A;  3MHX A;  3OYM A;  3F70 A;  3GLX A;  4OF1 A;  4BDZ A;  5IT9 E;  2K2V A;  1VQ9 A;  4L6V 5;  5IN1 A;  2XK0 A;  3RIR A;  3FLG A;  4X34 A;  2DIQ A;  3HL8 A;  4X9D A;  2LTO A;  2O4X B;  2DZ9 A;  4MDW A;  4DOW A;  3JCM b;  2E64 A;  2XDB A;  3CCQ A;  1VIF A;  4M7A B;  4KUI A;  1YJN A;  1H3Z A;  2EYQ A;  1ZBX A;  2YLB A;  5GAM j;  1Q7Y C;  3OY9 A;  3OYF A;  4HCC A;  2KK4 A;  1UGS B;  4PJO B;  5FLX E;  4R56 A;  1H64 1;  1NE8 A;  4XTZ A;  1G3T A;  4XU3 A;  4Y28 E;  1KQ1 A;  1NZ9 A;  2JOY A;  3PMI A;  3OS2 A;  4C92 C;  1VQP A;  1KHC A;  5DLQ E;  1VQ6 A;  2Y90 A;  2OTL A;  3JCM Q;  3OYN A;  4C8Q C;  4M78 B;  2DEQ A;  3M53 A;  3PFS A;  1YCY A;  1YJW A;  2K5F A;  3T9N A;  4BDY A;  1Q86 C;  3RMS A;  1P92 A;  4LD9 K;  2DAQ A;  1KQS S;  3MP6 A;  3I56 A;  3GIB A;  3NTH A;  2KSS A;  3JCM g;  4PLI A;  2BUD A;  3G71 T;  4M77 C;  4EMK B;  3S3M A;  5GAN g;  4FM4 B;  2CZ1 B;  3OYD A;  3QYH B;  3RER A;  2L8D A;  3C12 A;  2R58 A;  4J5Y A;  1PSE A;  2YLC A;  5LJ5 e;  1RI0 A;  4LDX A;  2XG8 D;  2DD4 A;  3GF5 A;  2QQA A;  2LX9 A;  3CC7 A;  5FU6 C;  2EIF A;  2KAF A;  3CCS T;  3VUZ A;  5GAN 7;  2DKG A;  2EJG A;  2P0Q A;  2XDP A;  4OB1 B;  5HY6 A;  5LJ5 h;  5GAN d;  4QVD A;  3G6E A;  1MGQ A;  3MEW A;  4QW2 A;  3TRE A;  2XU8 A;  3CMA T;  4OGC A;  2PU9 B;  3BY7 A;  4IUP A;  3RMQ A;  2OAU A;  1K73 C;  1K9M U;  2RD1 A;  2E6Z A;  3CD6 T;  2K5L A;  1QVP A;  2ZPB B;  1U1T A;  3JSC A;  3OYY A;  5KH6 A;  2WSC E;  4MZM A;  1Q81 U;  1ZHI A;  4A53 A;  2ZPF B;  4FT2 A;  4PL6 A;  4C92 F;  4C8Q G;  4M7A D;  3HFO A;  2RA2 A;  1LNX A;  2LDM A;  2RHX A;  2K3Y A;  2B8A A;  4OP0 A;  2RH2 A;  3C4S A;  3X24 B;  2F69 A;  4C0Z A;  1B34 B;  5GAM d;  5CKF A;  1YIT T;  1QVG S;  1K8A U;  4KUD K;  2OTJ A;  3OYA A;  4ZGE B;  3CCJ T;  2DXC A;  1YJ9 A;  3G4S T;  3HP9 A;  1WPY A;  4M77 G;  5GAO q;  4JLI A;  3CCL T;  1D3B B;  3MEV A;  4M78 D;  4JRQ A;  4F7U G;  2HAX A;  1JBM A;  4M7D G;  2MWO A;  2VYT A;  4A54 A;  4HCB A;  3RES A;  3AHU A;  5CKD A;  4HT9 A;  4PKC C;  3RUX A;  2Y4Y A;  3M4Y A;  5CO7 A;  3KXT A;  3X20 B;  4EMG A;  4E7I A;  2PVG B;  5CQX A;  3X25 B;  3J7A F;  1M1K U;  2VXE A;  4M75 F;  3CC4 T;  4JRK A;  2DD5 A;  4A4G A;  4Q5W A;  4QQD A;  3CCV T;  1N8R C;  4LDV A;  3PIO A;  4MDX A;  1M90 C;  2BKD N;  4YTL A;  2MF2 A;  4V2S A;  2DTI A;  4XK8 E;  3VYH B;  3GNG A;  3OA6 A;  3R6O A;  3CCM A;  4KBM B;  2DVE A;  2ZPI B;  1Y96 B;  3A8M B;  4C92 E;  3N5B B;  1S72 T;  2RHZ A;  4N4H A;  3LGF A;  1XNI A;  4NS5 A;  4DOV A;  5DM7 R;  3QG1 A;  4EMH A;  1HK9 A;  2KDS A;  1SSF A;  4JDS A;  3EAE A;  3BDU A;  3PIP A;  1KD1 U;  4GY5 A;  3BFM A;  4LDU A;  3QPH A;  1BIB A;  2O4X A;  2IVW A;  2L5Q A;  3G7Z A;  3PGG A;  4OGE A;  5GMK e;  4C5I A;  4RMO A;  4M7A A;  1VQ9 T;  2MAM A;  1YIJ A;  1WJQ A;  2EQJ A;  3V7C A;  3FEO A;  3OMC A;  4JJN K;  1WGS A;  2E5Q A;  4BI8 B;  4PJO A;  2AHJ B;  2XKO C;  4M75 E;  3A8O B;  3CCQ T;  1YJN T;  3CCU A;  3CCE A;  2JZ2 A;  1VQL T;  1O75 A;  3A5Z B;  3OBW A;  3LYI A;  4M78 A;  5GAO p;  2DXU A;  2DZC A;  4RCC A;  3GNF B;  3RKY A;  1N6A A;  3MP8 A;  2OTL T;  4NOY A;  2ZCF B;  4D6W A;  2ZPG B;  1VIE A;  4HKE A;  5D6W A;  3QDR B;  4IKF A;  2LC4 A;  2VXF A;  3PT9 A;  5GAN f;  4XTY A;  1YJW T;  2XD0 A;  1M5Q 1;  2Y4X A;  4FU6 A;  3Q1J A;  4EMK A;  3M56 A;  3O8V A;  1X75 C;  3UWN A;  2D0Q B;  2FL7 A;  4J6X A;  3CXC A;  5GAN j;  2MI6 A;  3RKW A;  1PSF A;  3CPW A;  4EPC A;  2E41 A;  2EFI A;  5C0M A;  1W2B A;  3FDR A;  4O5V A;  2A3L A;  2RJF A;  4FL6 A;  5J3B A;  2EWN A;  4XTX A;  3M54 A;  2GCX A;  4ELY C;  4B9X A;  1M8V A;  1UB4 A;  3CC7 T;  3QYG B;  1Q82 U;  1XOV A;  1OI1 A;  2M16 A;  4M7A C;  2RI5 A;  1G3W A;  5GAM f;  5GAM e;  5J39 A;  2EAY A;  2RM4 A;  3CPF A;  3G6E T;  2RJC A;  5LJ3 g;  3L2R A;  5I2M A;  4NL3 A;  4PJO C;  3QKJ A;  2WAC A;  3LWH A;  1FWZ A;  2E6N A;  4RKU E;  4BE0 A;  3JB9 D;  2EQM A;  3MEU A;  4BY6 B;  3DLM A;  1VQ8 A;  2R57 A;  4M78 C;  5LJ3 d;  1WNL A;  4MMK A;  1Y71 A;  1B34 A;  2RJE A;  4C5G A;  5GAO m;  2L89 A;  1R8O B;  3ZFJ A;  4C5E A;  4BI4 A;  1YHQ T;  3ZEH A;  3ZBD A;  1M1G A;  2LQK A;  1D3B A;  2V8J A;  2ZGW A;  1M1F A;  2OTJ T;  3V7S A;  4HA8 A;  3PNW C;  4ME7 A;  4ZTF A;  3OYC A;  3M55 A;  1VQ7 A;  3HKS A;  4RG2 A;  4UC4 A;  3VJP A;  1NJI U;  4C0F A;  3A8H B;  3CCR A;  5D6X A;  4M75 C;  4OB3 B;  5CCA A;  4JRP A;  1KHI A;  2RJD A;  3NTK A;  4J83 A;  5HK3 A;  3DKM A;  1QP2 A;  3JCM d;  1FX7 A;  2RB6 A;  3UT1 A;  4BE1 A;  3HSB A;  5GAN 2;  4QQ6 A;  4XAX B;  5GAO l;  3JB9 J;  3OYG A;  4M7A F;  1Y96 A;  1BIA A;  1AHJ B;  1I8F A;  5GAN 6;  3QZ9 B;  4C8Q B;  4QVZ A;  4FT4 A;  2M0O A;  2XDD A;  3JCM W;  4PJO F;  4ATO A;  1QVF A;  3CCM T;  2V8I A;  1VQN A;  2K4Y A;  4C92 G;  3E9F A;  2GFA A;  3P8B B;  5I21 A;  2RK1 A;  4J6Y A;  2HBP A;  2K5I A;  4OB0 B;  1U1S A;  4M78 F;  2QQR A;  4XQ3 A;  1N9R A;  5CKB A;  4X9C A;  3V8K A;  3JCM J;  1LJO A;  3QUI A;  4OMF B;  3OW2 A;  4F7U B;  5GAN 3;  4M7D B;  3M57 A;  4BUG A;  2G3R A;  2CYZ B;  1BYM A;  1VQO A;  1EIF A;  2DTH A;  3S6W A;  1YIJ T;  5FU7 C;  5CQY A;  3FRN A;  3SB2 A;  1VQ5 T;  2RHI A;  4FIB A;  5DLO A;  3L2Q A;  4R55 A;  1HXD A;  3JCM X;  4FSX A;  5GAO n;  3GOX A;  4BE2 A;  3GPL A;  4M75 G;  3UPU A;  3CC2 A;  2X4X A;  4OB2 B;  3CCU T;  1G3S A;  3CCE T;  2QEX A;  4M7A E;  3QHS A;  2KQW A;  4P5N A;  2LNV A;  2RHY A;  1K9M C;  4PJO E;  4CI0 C;  1UGQ B;  4E7L A;  3ASK A;  4BD3 A;  2QDY B;  2DJZ A;  1Q81 C;  2HQE A;  4Z02 A;  3UDC A;  4M78 E;  3WXM B;  5GAO r;  3CEY A;  3OQ5 A;  4QQG A;  1VQK A;  3DB3 A;  3EFR A;  5CKH A;  3CBM A;  4C0D B;  3C94 A;  3L2W A;  2QA4 A;  3X26 B;  5KE3 A;  3VV0 A;  1WJR A;  2EQK A;  3GP8 A;  1VQ4 A;  1K8A C;  4C8Q D;  3QO3 A;  4L59 A;  5LJ3 f;  3CCS A;  2PUK B;  1KG1 A;  2CZ0 B;  4RG8 A;  2K57 A;  5LJ3 j;  2FHD A;  3CMA A;  4BI3 A;  1BI0 A;  2LCL A;  4WF2 A;  5C6S A;  5GMK h;  5LJ5 g;  3OSV A;  3CD6 A;  4M77 D;  2O01 E;  3JRZ A;  2YRV A;  1M1K C;  4GLK A;  4M7D D;  2DPP B;  3SFM A;  2KVQ G;  2LT4 A;  5GAN 5;  3SWN B;  3C95 A;  3X28 B;  2LRQ A;  3SD4 A;  4MML A;  4XTV A;  2CGH A;  3WVE B;  3HFN A;  1VQ8 T;  2VUB A;  2JNG A;  5LJ5 d;  3OYE A;  4KUL A;  3OS0 A;  1M4Z A;  1VQP T;  4EDU A;  4JS5 A;  3KBG A;  3INZ A;  2NLU A;  3NTI A;  3QBY A;  2HNI A;  1UGR B;  3MP1 A;  1YIT A;  3JCM f;  3OS1 A;  1VQ6 T;  3JCM e;  2CS7 A;  3KUF A;  3CPW S;  2PVO B;  1WQ7 A;  5GAN e;  2V8K A;  5FRM A;  1W2B S;  3G4S A;  2VGN A;  2E1H A;  2MWP A;  3FJP A;  3CCL A;  2RHU A;  4ZGD B;  2K3X A;  4A4F A;  3I56 T;  5GAN h;  3M59 A;  1KD1 C;  4II1 A;  4J7I A;  1IZ6 A;  3QJY A;  3BW1 A;  3JB9 I;  4PLL A;  5HK0 A;  5A0L A;  2HQX A;  2FVU A;  3HRS A;  1YBY A;  5GMK i;  2L3R A;  3CCR T;  1G3Y A;  2QQS A;  1Q7Y U;  3JB9 F;  2R5A A;  4ZGJ B;  3LWI A;  1KC8 U;  3I55 A;  3JCM P;  1U8R A;  3LLR A;  5GAN 8;  4C8Q A;  4L5G A;  1I81 A;  5KE2 A;  2LCC A;  4BAC A;  3NFC A;  5AYF A;  2GQV A;  2EJ9 A;  3M4G A;  4Y91 A;  2QI2 A;  3H6Z A;  4BY6 C;  3P8H A;  5J26 A;  5GAM h;  3OMG A;  1S72 A;  1JB0 E;  1VQM A;  4A4E A;  4ZN3 A;  1Q86 U;  5CKE A;  1VQN T;  2LT1 A;  2RK2 A;  4LDW A;  4MZP A;  3S3N A;  4F7U A;  4M7D A;  1RL2 A;  2X4W A;  4RCB A;  2GFU A;  3QII A;  2P0P A;  3SDZ A;  1IRE B;  4E7K A;  3HRU A;  1N27 A;  2RI3 A;  2M1H A;  3M5A A;  2P0K A;  3OB9 A;  4N4G A;  3H8Z A;  3M58 A;  1WQW A;  3PMT A;  4EMK C;  3OSS C;  3LH0 A;  1VQO T;  3CBP A;  1YJ9 T;  3JB9 H;  4HCZ A;  4JS4 A;  4XU1 A;  3ME9 A;  2JUF A;  1KC8 C;  2PUO B;  5EG2 A;  4ELZ C;  3TU4 K;  1Q82 C;  3TCJ A;  3CC2 T;  2EKO A;  3JCM c;  4BB7 A;  1K73 U;  5CIU A;  2BIV A;  3MET A;  4J8O A;  2QEX T;  1NPR A;  3OYJ A;  2X4J A;  2PVD B;  1QVF S;  2RO0 A;  2FB7 A;  4XTU A;  1ZQ1 A;  4M7A G;  2DXB A;  1YI2 A;  1JJ2 S;  2KY9 A;  2P4T A;  3L2V A;  4C92 B;  5GAN 4;  2D6F A;  5DY9 A;  4PJO G;  5CK9 A;  2ZPE B;  1W4S A;  1BI1 A;  1OZ3 A;  3CBO A;  1I4K 1;  2VV5 A;  3MCA B;  3OYI A;  3URG A;  1QP3 A;  3QZ5 B;  4N0A A;  2E12 A;  2PQW A;  3OW2 S;  3V8J A;  5CAI A;  4M78 G;  2XIC A;  1UGP B;  4IUT A;  1VQK T;  2CKK A;  2H3J A;  3CME A;  1NPP A;  2DXT A;  2QA4 T;  4JRI A;  1X6O A;  4OVA A;  3J80 E;  4M7D C;  3OYL A;  1KQS A;  2CZ7 B;  1FXX A;  1OZ2 A;  4M77 B;  5LJ5 f;  3OS5 A;  1VQ4 T;  2VGM A;  1UEB A;  4VUB A;  2F5T X;  4JLG A;  2EJF A;  3QXE B;  3A8G B;  1I5L A;  3DB4 A;  4M75 B;  5LJ5 j;  2WSF E;  2JN0 A;  4J6W A;  4IUV A;  3QJ6 A;  4QVC A;  5FU6 B;  1NJI C;  2LVM A;  3VKI A;  3SWN A;  4MZT A;  5L8R E;  4C0G A;  2CZ6 B;  3TEE A;  1N8R U;  2JVV A;  2ZZD A;  1G5V A;  1M90 U;  3LW5 E;  3V7R A;  3MEA A;  3WVD B;  4CRI A;  1JJ2 A;  2GF7 A;  5GAM g;  1XTD A;  1JRI A;  4A4K A;  3MO8 A;  2EQU A;  3E19 A;  3OYH A;  2DK3 A;  3M9Q A;  3HRT A;  2YHT A;  2VC8 A;  4C8Q F;  4B9W A;  5I2S A;  2RI2 A;  5FRN A;  4PJO D;  4A4H A;  2E70 A;  1QW1 A;  3RKX A;  3VU3 C;  4C0D C;  4IUU A;  4XU0 A;  3PTA A;  4N0A C;  3BDL A;  3DLL A;  4NL2 A;  3G71 A;  1M9S A;  1VUB A;  2X35 A;  3VUB A;  2FYK A;  1V29 B;  2R5M A;  4C92 D;  3OYK A;  1WJS A;  1DJ7 B;  1QVG A;  4M77 F;  5FU7 B;  3OYB A;  1TH7 A;  4F7U F;  4M7D F;  1GXI E;  1LOJ A;  5LJ3 e;  3LGL A;  2D9T A;  4XTW A;  1MHN A;  1VQL A;  2QXF A;  4XU2 A;  2F5K A;  1X01 A;  3I55 T;  5LJ3 h;  4N4I A;  1KQ2 A;  1Y7X A;  2M9U A;  3P8D A;  3E1S A;  5GMK m;  3SWN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...