5I30H

Crystal structure of the human astrovirus 2 neutralizing monoclonal antibody pl-2 fab fragment at 1.9 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
212
Chain Sequence
b'DVQLKQSGPGLVQPSQSLSITCTVSGFSLIDYGVHWVRQSPGKGLEWLGVIWTGGSTDYNAAFISRLTISKDNSKSQVFFKMNSLQANDTGIYYCGRPYYGNVMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab PL-2 light chain
publication title De Novo Sequencing and Resurrection of a Human Astrovirus-Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30H01
3AREA 5F9WC 3UZQA 2DQUH 4M93C 3KS0J 3SGEH 3LPWA 5IW1B 4ZAKD 5ITFB 4U6HB 1VFBA 1P53A 1ZLSL 1WBZB 2XKUA 2MTPA 2E9BA 4X5WB 4RFEB 1G7LB 4LLQB 4GAYB 2WWKO 4QRSA 4HUVA 4CL7A 4HT1H 1GVIA 4UNUA 2N56A 3RWIA 2HJFA 1ONQA 2UVEA 2ICWB 3MXVH 4XVUD 2YD4A 4NJ9H 2VITB 4HPYH 1N0LA 5CD5D 4ZFFB 4PJDB 2VDRH 3O3AA 1S5IH 4AMKH 3BIKB 4OLXL 3UYRH 4RIRA 1D5XA 3MCG1 5I1JL 2VXVL 1NGYB 3P4NA 1HH9B 4H25A 5FUZL 4OGZA 3VFNA 3U36B 1IKNC 2D0FA 5CIPB 3G9AB 1MCWM 5IR1A 3OJVC 4IEFB 1O7VA 3T4AA 1F13A 4NZDA 4WNQB 2HH0L 2OTWA 3CFIC 1KENH 5KSAA 1JZ2A 4P2OB 5JUEH 4M7ZC 2AGJL 3MRNB 5C0CB 1AD9B 1XF5B 4PV8A 3TBWA 1BOGB 4UINH 3OQ3B 4TVPD 1OB1A 1IGTA 5EO9B 1Z9OA 2DWEB 4QY8A 3ULUC 1P4IL 1M7XA 1KYOK 4KKAC 2R4RL 1FO0B 1CVSC 2OLDA 3K1DA 1KTLB 1FC1A 2F58H 3BKJH 4PJCE 1FFOB 5LBSL 1MOEA 5E6ID 5L0QB 1A3QA 2NY3D 2WIIB 5D1ZC 5GGVY 3DRQB 2XA3A 3KYOA 5EA0L 2HT2D 3MLZH 1KCKA 3STLB 1CT8A 4TOYH 4HGWB 3BH9A 2BHZA 1G7QB 2FD6H 4LPVA 4PG9A 5AG9A 3RUGA 4E42B 3D0VB 4ZTPL 4LPXA 1MPAH 4HIHA 5BW7C 1G7PB 1X5XA 5IB2A 4K3DH 1FP5A 1H8NA 4W68A 4PG2C 4PJEB 1S7VA 3ZKSD 3GSNH 1BD2B 4Q9CA 3ARDA 5BJTA 2C9AA 4U6VL 1CBVH 1ZVSB 3BMWA 5I6XB 3V6FB 1IAII 3SKOA 2FATL 4Y5VB 5EC2B 1BX2A 4QXUH 1BF8A 3DETC 3MX0A 4CKVX 3GZKA 2QQNH 1IEAB 1ACZA 3QQNA 2AXFB 3SDCC 2P47B 3KJ6H 4D94A 2LFGA 1V7ML 1MJJA 1TJGH 4L4VD 1DLFL 3UTSE 4MXVF 4HCRH 3O2DL 4ZAKB 5HVFB 4LARL 3RY4A 1C5DB 2W0KA 4G7YH 5DQ9A 4KU1A 4DN3H 1FJ1B 3VWKC 4DFIA 3LH2L 3VMOA 4Z95H 2AVGA 1EDQA 5FHAL 4OCWL 5GGRB 3INUL 4Z7QE 4OUOA 3OF6D 3IAQA 3RX5A 3GMOA 1D5ZB 5MI0C 3UDWA 4R4NC 4KV5E 1NBYA 2GK0B 2WANA 4EI5A 3MRMA 3NPSC 3CH1A 3EOBB 4HDIA 1UJ3B 3S35H 5D7LE 5HPOA 2MHAB 1WEJL 5MERB 2JTDA 4PRHE 5T33L 4JPKH 2ZOLA 4ELKB 2X2YA 4ZFZA 5BRZE 4BM7A 5IHBA 1I8KA 2E7LC 3QNYA 4CADB 3QDMB 8FABA 3OG6B 5D96B 1EMTH 3NPZB 3REVB 1ZGLP 3GMPB 5BV7C 1H5BC 4IM8A 5I71B 3P0GB 2MQ3A 4HD9A 2XPGA 1X6NA 4YIQB 2PXYC 4OCLC 2IEPA 1GOHA 1Q0YH 4Y5YA 1OQOA 4F7CB 1KLFA 3D18A 3X11B 4JM4H 1MF2H 3QCVH 5DDHA 1VACB 2YD7A 3MCLH 4NO5A 5J13C 4A2MA 4NQVB 5E5RB 4FQPA 3PDOB 2B1AH 5AEAA 1TVBA 4AL8H 4YK4C 4YDIH 4PJAE 3C08H 4S10A 3TN0D 4X6DA 4BZYA 4OF7A 2E6QA 4FN0A 4ETYA 5E6IB 2CKBA 2NY3B 4JG0H 1O5DT 5SWZE 4ZSOE 3RY6C 1J0HA 4JR9H 2FX8H 1CU4H 3GSQA 3QI9C 3K80A 3MBEA 4D9LL 5DJ8B 5CJXA 2WQ8A 4JE4B 4ZUWA 2NZ9C 4H1LA 4I4WA 4Y2DA 3MXWH 3SCMC 3QXDA 2PW1B 5DJDB 4QYOB 4OGYH 43CAB 3KPSE 4EVNB 5D2LF 4BH8A 3LQAH 3S88H 4LSVL 4BYHA 2DQTH 1PX4A 2YUZA 4HC1A 4YJZL 4NC1E 4JFDE 3BAEL 2YRPA 3CLFH 3E6HB 3GHBL 1CFBA 4UAOC 1B9ZA 5J7CC 1MFNA 2AKRA 1KPUB 2R56H 4NKOA 2EYSB 5E94B 3QPQC 1IM9A 4ISVA 1TZGH 2IQ9L 1JNLH 1MCKA 2VISA 1C08B 4HZLA 3GJFK 4YPJA 4OB5L 4FABH 2X4NA 2BC4B 1HQ4A 4LLVB 5ERWA 2CJUH 5F1SA 4YR6A 2EO9A 3MOBL 3NIDE 1NGQH 2DQEL 2OZ4A 1PKQE 3GMRA 4KJQD 4ODTL 5FDWA 3HPJA 4MCYA 1LK2B 2NY1D 3V5KB 1BVKB 3VXMD 1MVUB 5TQ0H 5IBTH 1JZ8A 1AKJA 1WBXA 3GK8H 1M71B 3ARFD 4NT6B 3JVGA 5A16B 1J8HA 2R1WB 4F7MA 3BXNA 4GRMA 2NX5B 3KPMB 2APBA 2XKNB 1B3JA 3FB7A 1SHMA 4MGXA 1JUFB 2Q8AL 3B9KD 1P5VA 2HG5B 2Q86A 5ADOL 2RCSL 2WUCH 4E41A 2EYRA 4C4KT 2Z31A 4F7EA 1EXUA 1NAMB 1WJ3A 4C59B 4XXCC 1YPZE 3WO4C 2ATKB 3IDMB 2P5EA 1IQWL 4FG6C 4EKXA 1IGMH 4YDJB 1YQVH 5HVWA 5DMKA 4LNRB 3KWWB 2BVOA 2AABH 3B4NA 3WJJC 4RA0C 4OQTH 1AR2A 3BWAB 3OZ9H 3G04A 2FZ3A 1YEDB 3PL6A 4NFBA 4R2GC 4XNYH 4OZGF 5GRWA 4BH7B 1ORQA 1AQDB 4I2XA 5JHDD 5KG9A 1I8MB 3TBTA 1HHKA 5C0BD 4L8DA 3QIUA 4WW2C 5L7XL 4M6NL 2XQBH 3BE1H 4HS6B 1AY1L 3JUYA 1UEYA 1FNEA 3N06B 2DQHL 3QRGH 5JXAH 1MAML 5DUML 3VFVA 4Y16B 7FABH 3U1SH 1I8IB 5HHME 1RUPL 5F6HJ 2DQDH 1VEPA 5LAXA 5IW1A 4KRMB 5ITFA 4MA3B 5F7FA 1WBZA 4AM0B 4X5WA 4RFEA 5GS1B 5GGSA 4GAYA 1ZLSH 3NCEB 3V79C 4M1CD 1I7ZB 1U3HA 1I1FB 4GH7B 1QA9A 3MRGA 2R0ZL 4NC0B 3TVMC 2ICWA 1YECL 3LKSB 3HMXA 3PNWB 4CMHC 4ZFFA 1WCBB 4LLMB 4TRPL 2ERJC 4PREA 3ARZA 2AJYL 3DIFB 3FRUB 3P0YL 2JIXD 3NZ8A 2AQ2A 5A40E 4OLXH 4P57B 3GI9L 4F9PA 3U36A 4PTUB 1AI1L 2VXVH 1MWAL 5FUZH 1I3RA 4U05A 4OLYL 5F1OB 3DV6B 3LDBC 1OW0A 2AK1L 2WW8A 3WKNA 4TNWK 4M3KB 2HH0H 2ICCA 1AD9A 3BGAA 1A6TA 3MPCA 4KDWA 2AGJH 5IVXE 5D1QD 1DVFB 2ZPKL 3IDGA 4Z7WF 2UWEB 1K2DA 2DWEA 3MV7D 4ZODA 1IGFL 3H7BB 1JPGA 4GXVL 4YZFF 3MQIA 1P4IH 3ARVA 2R4RH 1KTLA 4F58L 1MEXL 1FFOA 3B9EA 43C9B 5E1AB 4UV7L 6FABL 2WIIA 5LBSH 5T3XL 3SDXB 2YPLE 2ICWJ 4O2FB 4XAWL 4M7KL 1RAMA 5HI4D 3HE7D 1OP3H 4HGWA 4LSTL 1II4E 1OTUD 2LU7A 5IBLC 3ULVL 5EA0H 1G7QA 1HH6B 1KCUL 2AEPL 5FGBC 3LKPA 3D0VA 4E42A 1F3JB 4P9ML 3PWPE 2F54D 5DHYB 5EN2B 4ZTPH 3RDTD 1ULVA 4P23C 1CZ8L 2DDQL 1FZOB 1NL0L 3EYVB 5H2BA 3GSNB 1AP2A 4PJEA 3QFJB 5CKAA 1YNLL 1BD2A 1VADB 2JJVA 4KI1A 5I8KL 4NM8H 2FO1A 1MIEL 5C0BB 1NUFA 4U6VH 3ILQD 4WHTA 3H9HB 2FATH 4PS4L 4BKLB 3CVIL 5D9SB 5C2BL 4OZFA 4DEPC 1EO5A 1IEAA 5J4MA 1CGSL 1DBML 2BOBB 2VIRB 4XC1H 2AXFA 2HFTA 4EN3B 3WUWG 1ORSA 2VDKL 3NACL 3W9DA 3T0EA 3QIBD 1V7MH 1YMMD 1DLFH 2H8PB 3O2DH 4LARH 1KC5L 2RBLA 1Z9LA 2X1XR 3CFKB 2CSPA 4UDUA 5GGRA 1REIA 4JVPA 3I6LE 3DVFA 3LH2H 4XGZB 3HHRB 3W0WD 1UH4A 3T0WA 3ZE1E 5B22A 4OCWH 3INUH 5DMGC 5IVOA 4QCIA 3KLHC 1JHLL 2VXSH 2GK0A 1OLZA 1EBPA 5MP6L 1UJ3A 3FKUS 1LDSA 4NQCE 2MHAA 5MERA 5E8PA 4D8PB 4ELKA 1WEJH 5JMOC 3T3PF 5T33H 2BSRB 3DVGB 2J5LB 2YD9A 4UT9L 4UQ3A 2R0LL 2ZNWA 1JGEA 3GMPA 5FO8A 5KSVB 5D7JB 4YIQA 4CVZB 5D2NE 4JJHA 5LWYL 3DNKA 1IT9L 3IDJA 5T5NG 4LHUB 4F7CA 3O6FD 4X9BA 1I7UB 2DM7A 3F12B 3NCFB 5DD1L 4OV5A 3X11A 1DL7L 1QFWI 2CMRL 5FYJU 3X13B 4NQVA 1C12B 3PDOA 2IWGA 5C9KA 4XCFL 5I30L 3NGBB 2CIIA 1XF3A 3ARGD 1G0XA 5DRNB 1FZJA 1JWUB 3GKWL 4LLDB 4I13B 4LKCB 1TENA 4G8FB 1UWGL 4MJID 2Y4SA 1BGXL 3DI3B 1RIHL 4P2YA 3S9DB 4OUUA 4JFQA 4WI2A 1F6FB 4RQQB 1QFPA 4P5TC 4D9LH 4X8XA 3WYRA 2H41A 3RVWC 4KQ3L 4Q9BA 1FGVL 3WBDA 3SKNB 4YDLC 4QYOA 43CAA 3PHQB 3GKZA 1MI5E 4JZJA 5C0IB 1OGTA 2ADGB 4PJHB 1A1MB 4NBXB 4Z7VE 4LSVH 3MLTB 3RZCC 4Q74A 3BAEH 4U1NA 3X12B 2ICEB 3GHBH 4IJ3C 5ALCL 1NLDL 2HT4C 5GRVL 1Z2KA 2WINA 4C58B 4BFIB 4JGMA 2DL9A 5DMIL 2BNUB 3WJLA 1A02N 1MCCA 4GG8A 4OGXL 2IQ9H 2QV2A 1YMMB 3K46A 1ED3A 4OB5H 1MQ8A 4NWUH 5IB4B 2YBRA 4C56B 1AXTL 3QNZB 2Z0BA 3GSRB 3SKUD 3MOBH 1A6ZA 3RNQB 2DQEH 2IH1B 2EC9U 4TSCL 3C60D 1CL7I 3SJVB 1QSFA 1LK2A 1G0YR 3HZYA 4S1RL 3RIAK 2PTTB 5KSBF 5L2KA 1MVUA 3TPKA 1NKOA 1OTSD 4LAJH 5CWSB 4AEEA 4PJFF 2FR4B 1QLEL 2OTUB 4MQTB 4R6UA 5ILTL 1M71A 5A16A 3MC0A 3QUZD 3V6BR 4HWUA 2CDEB 3IU3B 1A2YA 3MRHA 3KPMA 2DICA 2XKNA 1EH9A 4Y88A 2A83B 1CGXA 1CD9B 1JUFA 1WT5C 4Z77B 1KIRB 1LK3L 4AEHL 1X4XA 2Q8AH 1FL5B 4JDZA 1XGQB 2CDGB 2VJXA 2HLAB 3NFSL 1D5IL 2I5YL 5ADOH 2RCSH 2V5TA 4GQ9L 3CXHK 1WTGT 3H3KA 2IFFL 1BZ9B 4NM4L 2ATKA 1XIWA 4YDJA 1A7NL 1UC6A 2QL1A 4AY0A 1KT2B 4Z7UF 1QBLL 1IQWH 4LNRA 2JJTA 2UY6A 1SEBA 4X0KB 4ODUB 2Y06L 1YEDA 2BNRD 1TNMA 5A3ID 3ARGB 2LQRA 1AQDA 2YOCA 3NA4A 3H9SB 1GAFL 4FQHB 1A3LL 4HS6A 3JSSA 4MJIB 5L7XH 3FB8A 4M6NH 3KPRD 1AY1H 4Y16A 1CFVL 2YHGA 2LABA 2DQHH 1MAMH 5DUMH 1L6XA 1MCIA 1RI8A 1DANU 3GMLB 1RUPH 3C09C 4PGBA 4CVXA 1AO7E 3EZ8A 4MA3A 2FNBA 4AM0A 2GUOA 3QWOA 4L8BA 2YD5A 3A6CL 5L88L 5EBWB 3T08A 2IGFL 5DJXB 4JN2B 3ALXA 1JZ5A 2Q87A 1JPSL 5INCB 1CN4A 5DHXB 4M9PA 2XY2A 4K8RL 5ETUB 2R0ZH 1S9WA 3LKSA 2M8XA 3REWA 1YECH 3PNWA 1F6AB 1BFTA 3KPQB 4LLMA 5L2JA 4JCLA 4IRSD 1VHPA 4GW4A 5E99L 4JJ5B 5DTFB 1MUJB 2YWYA 3FRUA 4N0UB 4TRPH 1A6PA 2R15A 3D9AL 2AJYH 3P0YH 3MBED 3P77B 4PTUA 4I0KA 4AEFA 3GI9H 1JGDB 1EAPB 5I8EB 4N5EC 2B20A 5JO5B 5KANI 1AI1H 5B8CB 3STBA 2Y36L 1MWAH 4M5YL 4OLYH 4D3CL 2AK1H 3C60B 5B4MD 1GHFL 4PGDB 2Q7YB 5D93C 4NO3A 12E8L 5CKGA 5E2TL 2P4AB 4DCQA 3VFOB 3VI3E 1DVFA 4FMFA 1FHGA 4NUJA 2UWEA 4K2UL 4KUCD 2ZPKH 5J06A 1X6LA 1INEL 2OJZL 1JRHL 3ROOB 3BZFA 1IGFH 1YN7B 1G9EA 3OR6A 4GXVH 3TA3D 4NCDA 4G6ML 2XWBB 1TFHA 2FIKB 4ZO9A 4U1GC 43C9A 2Y6SC 5E1AA 3UEZA 5FGRA 4F58H 1MEXH 3SDXA 4OZHB 1QRNB 4MD0A 4LSDA 2Y72A 4UV7H 6FABH 4L4TA 5T3XH 3D85A 1RJZB 1JTTA 3HN3A 4XAWH 1UKQA 4M7KH 1K6QL 4ONHB 4UIMA 4Y19D 3ARTA 3H3PH 2ED7A 3K3QA 2V7HB 5EU6A 1NJ9A 2BK8A 3FN0L 4UB0L 4LSTH 1KXTB 5GXBB 2P44B 1F3JA 1OSZB 3RTQB 1KCUH 2A9NL 2AEPH 2E3VA 4X6CF 1E6OL 1M7DA 2DF3A 3MRRB 1ZE3C 5DHYA 1T1XB 4JVWA 1JNHA 4P9MH 4JB9L 3NVQA 1FZOA 4DW2L 1EAJA 3EYVA 3QEUB 3CPLB 5DQJA 3GSNA 3MRPB 1ZSDA 2EIEA 3QFJA 4L8SC 2DDQH 1VADA 1AKJD 3TYGL 4RSVA 1NL0H 4PJIA 3PP3H 5TE7L 3ARSA 1YNLH 2P24A 2DYPA 2P5WD 2IH3B 3CXDL 5I8KH 3CMOL 3L3KB 1KCVL 4KVCL 5IKCA 1GZQB 3JV4B 2X09A 1MIEH 1BQSA 2X1PA 3H9HA 2Z92B 1XMWA 3TZVD 4BKLA 4X4YB 4GSDL 5D9SA 4DKAA 3UMTA 4PS4H 4Y4HD 4PJBB 3CVIH 3EYFA 3QZWB 5C2BH 4EN3A 1U8NA 1RJLA 1RVFL 4F3FB 4PRIE 3FRPG 4G6AD 1DBMH 4HCRA 4E41D 3QH3B 4RBPK 2VDKH 3DXAB 1FZMB 3NACH 5CBAA 5DUBB 3VXRB 2H8PA 4FOMA 4O51B 2QSCL 4J23A 3CFKA 1W72L 3NIFE 4H5SB 4N1EA 1KC5H 5D71L 2BSSA 4MAYA 1HQRA 5C07D 5ABDE 2VQTA 1X5HA 2ZUQB 4JG1H 4YFLF 3PL6D 3H0TB 1AJ7L 1JHLH 5K9KB 4QNPF 4UDTB 5FOJA 3RHWK 3FQXB 3QIUD 1GH7A 5MP6H 3RVTC 1RSFA 4IRSB 1X5LA 4D8PA 1PY9A 4GBXB 3PGCA 1I85C 4M1DL 5I0ZA 3IETB 3R06A 4MWFB 35C8L 3IJYB 3LY6A 1W8OA 2IPTL 2VTFA 4UT9H 3OXSB 4KK6C 2R0LH 4OCMC 4MYWB 4WFED 5KSVA 5D7JA 4KJYB 3CDGB 4L29B 1VA9A 2AJXL 3MZGB 5ALBH 1BWMA 1H3VA 2H6PB 4LHUA 5LWYH 3LQZA 1IT9H 4RGNB 5TDNB 3F12A 3HRZB 3VRLF 1W2KT 4ELMB 1KLUA 5DFTA 5DD1H 1BVLB 1NEUA 1HHJA 2VLKB 1MCWW 3QEQD 2H2PD 3X13A 1KYOJ 1DL7H 1C12A 1LEKA 4UTAL 1BMGA 4MQ7B 5DHVA 2PKDA 2CMRH 3FQUB 3EFDL 3TA3B 5DRNA 4XCFH 5I30H 1BBJB 1HI6A 3DUHA 3VXPB 4LLDA 2BVQB 4LKCA 4G8FA 3GKWH 4S1DD 1MCRA 1K5NA 1UWGH 3L3OB 1FYTB 3L7EB 3RUGF 1BGXH 4P5MB 1EGJA 4BUHA 1RIHH 4AIZB 1FL3B 2KBGA 2FJHB 3TO4C 4DZ8B 1YZZA 3FB6B 1FL6B 3G5ZB 1Q9WB 4KQ3H 1H3XA 3QUXC 1X9QA 4NQSB 1FGVH 5IBUG 1KN2L 3EHBC 4DKDC 5TH2B 2VDOL 1JPST 3RKDC 5C0IA 4NQTA 1A1MA 4KI5D 3EFFB 5FYKE 4RFNC 5FA4B 4MNQE 3MLTA 2PYED 3C5SB 5A2LH 5EZOL 3N1MC 3MOAL 4Y4KB 5HYFA 3TZVB 1M05A 2ICEA 2GAZB 4GUPA 1J05B 4JZNA 1SY6L 4ZS6D 5GS3A 4Y4HB 4NQEB 3MV9E 5ALCH 5FF6B 4PRPE 2GHWB 1NLDH 2HTLD 4BFIA 2OBGA 2HT3D 4Z0XB 4KQ4L 4KROD 3IVKA 3OHXB 4OCSL 5DMIH 3FFDB 4S2SB 4OGXH 4YO0B 1R3KA 1VEOA 2D7QA 4C56A 2N7AA 4JM2D 3QNZA 3GSRA 4JFZL 1FZKB 1BJ1H 2LE9A 3RNQA 3BJ91 4Q6YA 2IH1A 5HD8D 3HAEG 3SJVA 1CFTA 1IC7L 2YEZA 5C07B 4TSCH 2R2HB 3F6IA 2PTTA 4LCIL 1T80A 4PG2A 2Z93A 5IB5A 1BFVL 4S1RH 3RFZC 2BNQA 4JANA 2HAZA 5CAYB 1I9IL 2JB6B 2OTUA 2FR4A 1HKFA 2ADFL 5I74C 5DK2B 4J3SA 1QLEH 3MV11 4MJ4A 2CDEA 4PY8J 5ILTH 1KCLA 3BD3A 3V4VL 1F6LL 1ZVYA 4PJDE 5IUSA 3O9WB 1DBAL 3QPXL 4K71C 2A83A 4PTTA 2W60B 3SDCA 1KIRA 2G5BB 4RAUA 3V0WL 5I1EL 1QEWB 2AI0L 1IZJA 4M6ML 4HWZB 1XGQA 2CDGA 3T0ED 1LK3H 1X5ZA 4AEHH 1MRFL 3GRWL 1LP9E 2Q8BL 1J5OL 5LXGL 2YD6A 2VSCA 1D5IH 1MNUL 2I5YH 4GQ9H 2QBWA 2IFFH 1C16A 4NM4H 1KT2A 5C0CE 3S4SG 1OAKL 2FLRT 4WVRA 3U2SB 3PQYD 4OQTA 1A7NH 2Q3ZA 5F1NB 4X6DF 1U95B 3GJFA 3H42L 1KJMA 4QRPD 1QBLH 5IMKB 1N8ZA 1EEUA 1S7RB 2O5XL 5DURD 1CDHA 3DO7A 3ZDXE 2Y06H 4BQ6A 3WNPA 4P2RD 4P4KC 4MA8L 4OZ4B 1GAFH 4W6WB 2E7LA 1A3LH 1U8HB 1CXFA 2XY1A 4M43H 2X6MA 3KPNB 4LP4A 1UB6B 5T1MB 1OWRM 1KLGA 4HFUL 1RZFH 1CFVH 5I9QC 5KN5A 3DBXA 4NQDD 1SBBA 4LKXB 1J86A 3SDDB 3HUJA 5ICYA 5FYLD 4B53A 3V2AR 1WVZA 4JFPA 3H7LA 5EBWA 2HA1A 1RZJC 4XPFL 2UZIL 5DJXA 3A6CH 4LDOB 3S6CA 5L88H 1M4KA 2IGFH 5DJAB 1HILA 5INCA 2RR3A 2XKSA 1BBDL 1L0QA 2WWMD 3IS1X 5FCUL 2PYEB 5ETUA 1JPSH 1S7XB 4K8RH 5FDYA 3E2HC 3SQOL 1B4JL 4HLZG 1F6AA 4QOKE 5SWQB 3KPQA 5E24E 5IVNA 2MMXA 3FB5B 3LAFA 1FFQA 4JJ5A 5DTFA 1A8JH 3RY6A 1B6DA 1MUJA 4N0UA 5E99H 1ZHLB 3RJQB 2ARJA 3LIZL 1S7QB 3VG9B 3EDDA 3D9AH 1IGIL 3TCLB 4PRBB 1U8OB 5I8EA 1BECA 1MWAB 5B8CA 3MODL 5DJ0A 3RGVB 1FN4B 4I3RL 1T7WA 1J0KA 4MDIA 4L9LC 2Y36H 4M5YH 4OBRA 2Q7YA 2AV1B 2CR6A 4D3CH 5F9JB 4JFXB 4YAQA 5E9DB 4J3TA 1GHFH 2ZJSL 4JO1L 3ARPA 3QUML 3TIEB 3W11D 12E8H 1KEGL 3PJSB 5E2TH 3OR7B 4JRXD 2B8OT 1A6VL 2IBZX 2YD1A 4X4ZA 3FAXA 4K2UH 5I16A 3ROOA 2VLLA 1FNAA 1INEH 1JRHH 2FIKA 2WLZA 1EA9C 4G8EB 4NDMB 4JQXA 4LPWA 4G6MH 3L3GB 1UM4L 5CZVL 5J57B 4OZHA 5JZ7C 3MUGA 4EUPH 1QRNA 3QDME 3MA7B 3MGOA 3ARUA 1AC6A 5DA0B 3BJLA 2DJUA 3MNWA 4Z7NF 2XTLA 4ONHA 1NGPL 1RHHA 2V7HA 1JWSB 4TSBH 1K6QH 2AXGA 1ROWA 2Y9RT 1MJ7L 3RTQA 3FN0H 4UB0H 1ZHNB 1FNFA 1QSFD 2EE9A 2VLRD 2EXWC 2X4OA 1T1XA 2A9NH 1N59B 3MNVB 1TZHB 4QRPB 1AIFB 1E6OH 4TVPE 5CZXC 3QEUA 1VGKA 2FCBA 3CPLA 3CX2A 3MRPA 3QJHB 5DURB 4JB9H 4NKDB 3DVNB 4DW2H 5J6GB 3OX8B 3TYGH 1MCDA 5BVPH 3FFCA 3L3KA 5TE7H 1WBYB 1N0XL 2J12B 3JV4A 5HDBE 3V5DA 3CXDH 3CMOH 2Z92A 1KCVH 4KVCH 4Q2ZB 1DDHB 4R26L 1NFKA 4PJBA 3QZWA 4GSDH 3O6LL 1YNTB 2H2SC 2ZUSA 4F3FA 5C9JB 2OL3L 1NEZG 3PGFL 1I7RA 1RVFH 3PE9A 1MIML 1FZMA 1AHWB 3DXAA 1T66D 3O2DA 4GW1B 1NGWB 2X5PA 5D8JL 4QWWC 4NRZB 4GRLC 2IG2L 5IV2A 3S35X 1XIWD 4H5SA 2QSCH 2D31B 2AK4B 2XN9B 3RWHB 2Y5TB 1W72H 4MJ5B 5D71H 3P9WB 4JRYA 4NHCL 3WDJA 3H0TA 4XX1E 1CFSB 5K9KA 1S9XB 5GGVL 4U1SB 1AJ7H 3RPKA 4M61B 4PJ8A 1IFHL 2OX5A 3HS0B 3HMWL 3QQ3B 4GBXA 1HK6A 5D1XB 3RU8L 4CDHA 1JIBA 5JIKA 2CIKB 5ENWA 2YXMA 3QA3B 3UPAA 2DQCL 4M1DH 2J88L 3IETA 4MA7L 4PJGB 4HUNB 4D9RD 4MWFA 3IJYA 4XP9L 1LD9B 1AGBA 3OXSA 35C8H 4KKBC 1KNOA 4O2CB 4OLVL 4U1KA 2E6PA 1IGYB 3D3VA 4PGJA 3WFZA 2IPTH 1IQDA 4KJYA 3CDGA 4L29A 1F58L 3LRSB 2L4OA 4OV6F 1OY3B 2AJXH 4KI5F 2I9TB 1IEHA 4ELMA 3MUY1 4JRXB 2VLKA 3HE6C 2ZZUT 1KFAL 1VPOL 5SWSA 5KS9A 3VXUB 2BVPB 4UTAH 4LRIA 3VXPA 3EFDH 1HOCA 2BVQA 1PQZB 2NX5E 2HMID 4CUCA 4CN1A 5HBBA 2I9LB 2FLBT 3NIGE 5E7FA 1FYTA 1AXSB 3L7EA 4OFIA 4R0LC 5ESVA 4P5MA 4AIZA 1FL3A 2FJHA 3RWEB 1JCKA 1FL6A 4PJEF 4DK3A 3SKMA 3I6KA 1PJ9A 5AAMA 5DA4A 4AG4L 3QCTL 5TH2A 1KN2H 3EFFA 4WO4B 2VDOH 3RL1B 3RWDA 3CD4A 2VDQL 3WD5L 2PNDA 4F37K 2OR8A 4Y4KA 2XNAA 4NC1C 1H3UA 1S7TB 5EZOH 3MOAH 5HPMB 2EC8A 4KKLD 1CD1B 4NQEA 5EU7E 5FF6A 4OF8A 1SY6H 5C0JB 5K59E 1NDGB 3AXLA 5D5MA 4Z0XA 3UZEA 1FE8L 2CKNA 3D2UB 1ETZA 1HXMB 3FFDA 4KQ4H 3KHOA 4YO0A 4HJGB 2HYMA 1B0RA 4OCSH 4L9DA 3SQBA 1JNNL 5HJ3B 2B4CC 1FZKA 1PGRB 3VD4A 1QVOB 2P8LB 4JFZH 5LKNA 3HC4L 1IC7H 4MJ6B 4LCIH 1QKZL 1KPRA 1BFVH 3BD5A 2DYPD 3VDCA 5JR1L 2C3VB 4LFHG 2P43B 4JKMA 1RQ5A 3DTXB 3VXSA 5CD3A 1I9IH 1TIUA 1IEBB 1R5VA 4XNMB 2ADFH 4HUXA 4QHUA 1CTNA 3V4VH 3OWEA 2C1OA 2W60A 1G7HB 1DBAH 3ZKXC 3QPXH 1QEWA 4HWZA 1X4YA 3V0WH 3B8SA 5I1EH 2AI0H 3DMMB 4M6MH 1VB9A 4NKQB 1MRFH 3FO9B 3GRWH 2Q8BH 1J5OH 5LXGH 1MNUH 1DUYA 3G6AB 4KKNA 1MHEA 5JIHA 1QBBA 1RZKL 4WW1B 1T1WB 3MCKB 4RNRA 2C3WA 1U95A 3VXME 2A74B 1OAKH 5I73C 5J6HA 3DYPA 4NO2A 9CGTA 3EUUA 3H42H 1CGVA 1SJHB 2X40A 2NXZB 2O5XH 3H6JA 1NPUA 3NA9L 1SM3L 2AEWA 5FCSH 2ZCLL 3BISA 4B41A 1ZT4A 3O45A 3L7FA 4MA8H 3HPLA 2VQUA 5T1MA 4K9EC 3DUSB 1YYLL 4HFUH 4LKXA 1KIPA 2R9HD 5MENB 3S3PA 3SDDA 3FAWA 1YJDC 3DVIA 4M48L 5ICZA 1DQML 5BCAA 2A38A 2PYFB 1MCJA 3ES6B 3D6GA 4XPFH 4E9LA 2UZIH 1UM5L 5DJAA 2YA0A 2DLEA 4YHPA 2XZQL 4APQB 1G9MC 2CXGA 2GW5A 1DN0B 3K8MA 1DZBA 1BBDH 1RULL 1IC4L 2J6EL 3VFMB 3UAJC 5JHDE 5F72S 1EFXB 5C0BE 4LVOB 5SWQA 3BP6B 1KIQB 1V8HA 3SQOH 15C8L 4U0RB 3SN6N 3BT2H 1KELL 4HJ0C 1ZHLA 4P2QA 3O8XC 2VLJA 3WNOA 3LIZH 4QKXB 3TCLA 1T1ZB 1U8OA 2LTQB 3KAAA 4RMVA 1MWAA 1FSKC 3NCMA 1J1PL 1IGIH 3IDYB 1OT2A 5F88B 2H26A 3MODH 1NBQA 1F2XK 1BP3B 3MYJB 4I3RH 2AV1A 5HHQA 2QQKL 4JFXA 3OJ2C 5HYSB 4IRJB 5E9DA 3UBXA 2HVKB 4PD4J 3PJSA 2ZJSH 5C2UB 4JO1H 4ENEC 3QUMH 4MCZB 3ULUD 4ZFOL 3OR7A 3D87B 4ZOCA 3AS3A 4KKAD 1KEGH 5DJZB 3W5MA 2QADC 1A6VH 4G8IA 4I0PB 4Y0GA 3BPOB 2K3TA 5F96H 2I25N 4G8EA 3L3GA 5D1ZD 1UQSB 4EUPB 4URTB 1UM4H 1IAMA 5CZVH 1PW3A 4WJ5A 3FQRB 5HY9B 2GSIA 5F7EL 5FOBA 3G5VA 1F3RB 2W92A 1JWSA 3CK0L 5C3TA 1NGPH 4KUZL 1IAIH 4YFLI 2A2QT 1B0GB 1MJ7H 1NFDB 5I17B 1AIFA 1BQHG 5EBMB 1G1YA 4EBQL 1I3VA 1JYNA 5HVHC 1BPVA 3A0OA 3MV7E 4HK3J 2DL2A 1HYSC 5C8JB 3QWQB 1MH5B 1OF2B 3BDBA 4LCUB 3DETD 3MJ8B 3FT4B 1WBYA 2EYTB 2EKSB 1LO4L 5CSBA 5CUSL 1N0XH 1DDHA 2AQ3A 2PO6B 4PJ5B 4BFBD 4R96B 5JXED 5B3JF 1OAYL 4R26H 4Z18A 5D6DC 4PJ9B 3O6LH 4U1JB 1CI5A 1TJHL 5EU3A 2OL3H 5GRZA 1AHWA 4GW1A 4UOW1 5IROC 1AR1D 1NGWA 3UTZB 5DFWH 4Y5XB 3MRDB 3VWKD 3L5WB 1R5WB 4UILL 4JKPL 1MIMH 2FL5B 4J4PC 4M7JL 3AGVA 3PABB 4XH2A 1QTYT 4I48B 5D8JH 2IG2H 4U2YA 5AUMA 5JA9A 2AK4A 2NY6B 3RWHA 1W72B 1NC4A 1T7VA 3F7QA 4IOFC 4XNZC 4JGUA 1BIIA 3MO1B 5HHOB 2APVA 1KG0A 3HG1A 4PJHE 2HTKC 4NHCH 3TH2T 3IFOB 3DPBA 3ZHKA 1MAJA 2I27N 2AV7B 5BZDA 5GGVH 3VXOB 3QQ3A 2XFXA 1U58B 5D1XA 1FVDA 1GIGL 1IFHH 2XTJB 5IB3B 3CCHA 4LRNL 5KVGL 4PP2B 5ESAB 5C0AD 2BZDA 1YEGL 4G42A 4HXBL 3BN9C 5GSRA 1LD9A 2DQCH 2NY2C 2J88H 1OGAB 4MA7H 2V7NB 3UP1A 1JPTL 4I3SH 1YMME 3LSOB 4O2CA 4XP9H 2PXYD 3Q6FA 3RL2A 4XMPL 1VEMA 1XGRB 4GW5A 5T1LB 4OLVH 4YBHA 1TPXB 4LLYB 1F58H 3BESR 4BZ1L 2I9TA 2UWEF 1A5FL 5D2NC 3HI1A 2ADIB 3W0WE 1KGCD 1IJ9A 5CGYC 2F53D 3EBAA 4TUJB 4JPWL 5I1KL 1JF5A 5E8NB 3UTQB 3MMEA 1KF9B 2F19L 4ETQB 1KFAH 1VPOH 3SDXF 4PPTA 4WEBL 2UUDH 1MHCA 4GLRH 4U7KA 3RX7A 4GS7C 2I9LA 3QI9D 5D7IE 5CEZD 4JPVL 4NRYA 1UGNA 4P3DB 2XZAL 2NZ9D 4AENB 1R24B 2B5IC 3SCMD 1Z9SA 3BP5B 3RWEA 3VDAA 5I8CB 3QQ9C 1I75A 5JDSB 4NN6B 3OL2A 3RWJB 2ARWA 2YN5A 4YGAB 1SJVA 3Q1SH 4IOSD 1JI2A 1QSED 1AGDB 4PJIF 5EDXA 1OT1A 1N7ML 4OZIB 3WO3B 1T6VN 4AG4H 3QCTH 1DUZB 4DVRL 4CAGA 2VDQH 2P46B 5HPMA 3H9SE 3QPQD 4MNGA 4CW1B 4DFHA 5CJOL 5FM5O 4X7TA 1LO3L 4MJIE 5C0JA 3OGOE 1NDGA 5I2IB 4OKVA 1P6FA 4PJCB 1PSKL 5EPMB 3BYYA 3D2UA 5DD0L 1N64L 3QXUA 2EDWA 3WN5B 1HXMA 1FE8H 3WHXB 4GOSA 5H35A 1F11B 2EICA 3VWKB 1EHAA 4LSPL 2XZZA 1K8DB 3AREC 2FJFA 5HJ3A 2BVUA 5C0NC 4QHKJ 4WU5A 1QVOA 2P8LA 3S96B 1JNNH 5DVNA 4XWOD 4YXHL 3BD4A 4N9GB 3HC4H 3OAZK 3O11B 1FLTX 4MJ6A 3QIWD 1YN6B 3Q5YA 3FO2B 5CMAB 1N5AA 3LKNA 3ET9F 1UWXH 1QKZH 2BHYA 3F58L 1NMAL 3DTXA 3PP4L 4X7DC 5SV3A 5JR1H 4NZTL 4JFHD 5C0AB 1KB9J 3RVUC 5GS2H 1CE6B 3SDAA 1HSAA 2VAAB 1OD7A 4AJ0A 1QLFB 3VH8A 3NFPB 4OCXL 4OQ1A 3QJFB 3M17B 3DMMA 3KNBA 3T0BA 1Q9KA 4PJ7B 1KJ3L 3UTSB 5HHXL 5DYOB 4LCCB 3FO9A 4JREB 4HMCA 4DUWA 4FG6D 5CGTA 4G9FD 3ULSA 3BZDA 5J13B 3QRFM 2F53B 1T1WA 5KSAC 3S3SA 3EJZC 2A74A 1RZKH 4R2GD 4X6BA 4NJAH 2XWJA 1BJ1J 1SJHA 4Q0XL 4Q7DA 1R3JB 3O0RL 1LE9A 5L6YL 5EZLB 3NA9H 1SM3H 3B6SA 1UA6L 3MGTA 2ZCLH 3QDJA 2D7TL 1QFHA 3ZE2F 1F4YL 3ME0A 3DUSA 4R4FL 3GM8A 4RGMC 4GKNB 3JXAA 4Z7OF 3TESA 1GC1L 2MWCA 2V5RA 5IFHL 3D3VD 1YYLH 5F6HI 1P7QD 4HUUB 4XXDB 5FYJH 5MENA 2CRMA 3CC5B 1I3UA 4JFOA 1DQTA 1QSEB 1UKSA 4FXKA 2PYFA 4OF6A 4Z9KB 4M48H 4QRQB 1DQMH 3ZO0A 5DC0A 2VE6A 5ANMB 1OHQA 4JY5L 3TVMD 5J8OA 2OSLA 4QHLB 4APQA 1XCQB 5BXFB 5GS0C 1UM5H 3JWDC 4YHML 2BNRE 1DN0A 2XZQH 2DKMA 1DANT 1EFXA 3E1F1 1RULH 1IC4H 2J6EH 3BP6A 4XAKD 1FFPA 3ARDC 2I26N 2J8UA 3E3QC 3KPRE 4M9OA 1D7FA 5F3BB 1T22B 15C8H 4WFFD 1KELH 1XEDA 1JVKA 2EEBA 3VGBA 1U8KA 3D1MC 5JW5A 3PV6B 3V4PL 1TQCC 3TO4A 4U1IB 3T4YA 3VXRE 3ARBC 1J1PH 3HLAB 4LF3B 4IRJA 2NQCA 1A1OB 2QQKH 2HVKA 2KKQA 3QIWB 4ZNEA 3QUMB 3Q2CA 4FZ8L 1I3GL 3P9MB 2V2XB 3FQTB 5FYKL 5CP3H 3UDWC 2NLJB 2YK1L 5DD6B 4JFDB 4I0PA 4XBPB 3MJ9L 5E7BA 2UZXB 4KGJA 1UWEL 3V6OA 4PLKC 3WIHL 1J18A 5ID0A 1I1AC 3LQMA 2OYPA 4N8VG 4EUPA 4RRPG 5SX5H 3BUYB 5CS7A 2ICWI 3FQRA 1F3DH 5HY9A 5IBLD 3LKRB 2JB5L 2R2BA 4NN5C 1DBKL 3WEXB 3VD5A 2D0GA 1MJ8L 1U42A 1Q9OB 4W70A 5F7EH 3B3IB 4JAMB 3IYLW 3VE0B 1NCNA 1E6JL 4G9FB 3CK0H 2NNAA 4HWBL 4KUZH 1L0XA 2HFEA 4P23D 4R3SB 5I17A 3FT3B 3GSXA 3QFDB 1CXLA 2EO1A 4TNVK 1H0DB 4ZNCD 3T3MF 4Y5YC 2VLKE 4AIOA 4H26B 4EBQH 1T7ZA 4POYA 1IILE 4CDGC 3QDGA 4LCUA 3MJ8A 3OKLB 2EKSA 1X5AA 5BMFL 2WBJB 1OAZL 1VDGA 3U4AA 2N4IA 4JFFA 1LO4H 4PJ5A 4C57C 5CUSH 1FVEB 4Y7MA 3V6ZB 1D6VL 2FECI 3SO3C 3HUJF 3GIZL 4PJ9A 4U1JA 4GRWH 1OAYH 2WWKT 2OL3B 4PB0L 4Y19E 3UTZA 4M6OL 1TJHH 3MRDA 2C26A 3L5WA 4OZFG 4Y1AA 3ZMRA 2FL5A 2YS4A 2BOCB 3PABA 2DS4A 4DUXA 4I48A 5B38G 4UILH 1GJIA 4JKPH 5E2VL 3OJDA 4KTYA 4M7JH 2O61B 4Y2DC 5EZJB 8CGTA 3OB0K 5DMGD 1CG9B 1YPZB 4KXZI 3KLHD 2NW3B 3MO1A 5HHOA 2ITDA 4LVEA 1A1NB 1M6OB 5BS0B 2CK2A 1EJOL 5IIEB 1BJ8A 3KPTA 2P5WE 3IAPA 3IFOA 4MD4B 3NFNA 5FM4A 1E4XL 4HIIB 2W9LA 1CVRA 1Q8MA 3VXOA 2X4RB 3FCTA 1U58A 2CR3A 1RUAL 3V95A 3BSZL 5IB3A 3KDMB 3N1FC 2XI9A 4HV8A 3FO1A 4PP2A 1GIGH 1NSNL 1S9VA 4LRNH 1HEZB 5KVGH 4AIXA 1YEGH 1OGAA 4HXBH 1HIML 3B5HA 4XCYA 3ARXA 3C6LB 3GMQB 3LCYA 2FX9L 1G7IA 5HHMB 5T1LA 1JPTH 4LLYA 1K85A 4XMPH 3L3JB 3G5YA 3MUZ1 2ADIA 4BZ1H 3T09A 2YWZA 1A5FH 5C07E 5LGHL 1CFNB 3CAFA 1TLKA 4TUJA 2GYSA 3IF1A 4DWHA 1B0WA 4KZDL 3K4ZA 1ZLUK 3UTQA 1W0VB 3SGDH 4JPWH 5TDOB 5I1KH 4ETQA 2QQQA 4OZHF 3I02B 2F19H 3I6GB 5ID1B 5F7MC 3AB0B 3UTTD 4WEBH 2M1KA 3JVGC 4FQXB 5MEOB 5KW9L 5GRUL 3HCVB 1JPFA 1WZ1L 3UO1L 4P3DA 2BMKB 2NY0C 2RB8A 4P5TD 4AENA 1N2RA 2K7QA 4WFEE 2XZAH 2R1YA 5ELIA 5FYJD 4F9LA 5J0BA 1AGDA 1WF5A 2DQFB 3CU7A 3QT2A 5JPNB 2WUBL 4ONGL 4C4KO 1OM3L 4OZIA 5AWNL 3B9DA 4POUB 3O3EB 3QEQE 1N7MH 4JO4L 3RZCD 1DUZA 3L5HA 5C71A 1N6UA 5IVXB 3T2OA 3BKYL 4PJBF 1ZXQA 2ED8A 2Q20A 5TJWK 4DVRH 4ZXBB 2HVJB 1JZ7A 4DEPB 4FQQA 5F44A 3WSQL 5I18L 5EOQL 4CW1A 2HT4D 3OAYH 1BZ7A 3MLUL 2VZ3A 5FB8B 5H37G 1SY6A 4Q9RL 3VXNB 5CJOH 3RWFA 1FPTL 4PJCA 1FNGB 3QXTA 5K9QI 1LEGA 4Y4FB 3WN5A 4XRCB 3QXAA 4LPYA 3WHXA 4WUKL 3MRJA 1F11A 5F7UA 5DD0H 1N64H 3MSPA 4JFYB 2FDBP 2R1XB 3VA2C 1RK1B 4LSPH 1RZ8A 3S96A 1T21B 4NNXB 3TT1L 3OG4B 3DURB 1X5YA 4HUKB 4N9GA 2NY5C 5CHNA 1SYSB 4TVPL 2HFFB 1YN6A 3LRHA 3FO2A 2VKXA 2PYEE 2DAVA 1S7SB 2GJZA 5INDB 4Q6IA 2DBJA 2FWOB 3AM8C 3PP4H 1NMAH 1YA5A 2GITB 2ZUWA 1KXQE 3CSBA 2CUHA 1DE4B 5T5FL 4D0DA 3NN8A 2W9DL 2X89D 4X98B 1CE6A 5DRZB 2EZ0C 4GO6B 4LSRL 2P8MB 1TTFA 2KUTA 1QLFA 3NFPA 1BLNA 3BIAX 3QJFA 3M17A 3CDYA 3QEHA 4MB5A 2ZG2A 2G60L 3VGGA 2A6IB 3UTSA 4OCXH 1WAAE 4F9PC 4LCCA 4ELMF 3DJ9A 4JKWA 4XMKL 3SBWC 1KJ3H 1U8JB 2H3NA 5HHXH 5KS9F 4R7NA 4O58L 1T2JA 4IOIB 5CEYB 5E9DE 2JCCB 1F90L 1MFDL 1TQBB 4Z6AT 2NTSP 1JMXA 4CN6A 1R3JA 3VWJB 5FECA 4Q0XH 3EDEA 3QISA 5EZLA 3UTTB 3O0RH 5D7LA 5L6YH 2XACC 4PRHA 4F2MA 5BRZA 1UA6H 3HNTL 5T3XE 4GKNA 2WP3O 5L0QC 1F4YH 2H32H 2PCPB 4R4FH 1EEYB 2X70A 1GC1H 1X5KA 2VSDA 5TE4L 1SJEB 4X5LA 5ISZD 4OF3A 1HN1A 4ZYKB 1J8KA 1ZGLM 3PQYE 4U1LA 5C6TL 2L7JA 4XI5C 4QRPE 3RZCB 1XCQA 2HFGL 3EAKA 4FFWC 1Z0MA 4JY5H 3LEVL 1MQKL 3O4LD 2FH6A 3U7YL 1OP5H 4YHMH 2SEBB 3ZDYE 1V3MA 5D5MF 5FV1L 2D3VA 2PW2A 2OI9B 4PJAA 3HFML 4JDVB 5I6XC 3KGRA 4WDIB 4Y5VC 5I1HL 3CZFA 4HG4J 5JA8B 4UBDD 3EYOB 5SWZA 4P46A 4ZSOA 5HHVL 4N5ED 3TPUA 2Q6WB 3DYMA 1U36A 1T4KB 3A6BH 3PV6A 2EDYA 1YEEL 2C3HA 4RMRA 2XWTB 3M8OL 3SGJA 3V4PH 1RJCA 1ZK9A 2EKJA 3HLAA 1UEMA 2ZOKA 3WLWD 2XN9E 3MRBA 1HHHB 2X7LB 1T20B 3QUMA 5I75B 3MR9A 3KPSA 5T1DL 3KYAA 3RIFF 4O9HL 1XGUB 4P9HC 3SGEI 1U2HA 1OL0A 3FQTA 5ADPL 2IPUG 4ZFOB 4CNIA 4FZ8H 1I3GH 1NGXB 2NLJA 5DD6A 2Z35B 4JFDA 4Z7VB 1ZHKA 5FYKH 4HKJB 5E5UB 2HKHL 5K33A 1TCRB 2YK1H 2Y6SD 3MJ9H 1UWEH 1UJ3C 2J1KA 3WIHH 4PJGE 4I9WE 5CP7A 4HK3N 1F4XL 4ZPTA 5KAQG 4PRAB 3WEXA 2JB5H 4TTDC 1CLZL 5D96C 1D5BB 3T2NL 3UJJL 3MRLB 3B3IA 4PY7A 1DBKH 3MFFB 1MJ8H 1T5WB 5I71C 4ODBD 5DC4B 1QPXA 5BO1L 4UQ2A 4WFHD 1E6JH 2IANB 4R3SA 3JWOL 3R0MA 4HWBH 4DZBA 2XV6B 1H0DA 1R3LA 4MSWB 4JRXE 4U3HA 4HK0B 4PBVC 5C0RL 5HYEA 3T65B 3VXUE 4ZFGL 2VABB 4RX4A 3OKLA 3ARRA 4KVNL 3T0AA 4OAWB 4HPYL 4QXTB 3ZKQD 5A2FA 2FX7L 2WBJA 4YPGB 1C7SA 3VJ6A 5BMFH 1OAZH 2DM2A 1FVEA 3OPZL 1EFQA 5DEGB 3V0VB 5F3HA 3V6ZA 4I77L 5J9PB 4GRWB 4XB7A 2NY3C 2ZCKL 3C09B 1D6VH 3GFUA 2Y5EA 2FO4A 3GIZH 3FOMB 3FZUC 4JFED 4IIQB 4ZMAT 5ISZB 4PB0H 3S5LA 4M6OH 5JUEL 2VLRE 1W8NA 3KJ4B 2AP2A 2DRUA 1L7TL 1IAOA 5E2VH 1YPZA 3PWJB 5FKPB 5IFJA 2NW3A 2ZUVA 4YDVA 5DJCA 4K07A 1M6OA 3OJMB 5IIEA 5KVDL 4HKXA 3VMNA 4QLRA 1P4LB 3RVTD 1EJOH 4HIIA 2AJZB 4H0HB 3WUWB 3MRFB 1NANH 4L3AA 1WIUA 2X4RA 1E4XH 3A6OA 3IGAA 3LEXA 2A9MH 2YZ1A 3KDMA 4ZG1A 3BSZH 4I18B 1NSNH 4KK6D 3C6LA 3GMQA 5DS8A 1A9EB 3WJLC 2GKIA 3ZHLA 1HIMH 5IMOB 5HDOA 4O00A 4R4BA 2E6JA 2FX9H 3R1GL 1HYRC 4N0CC 3L3JA 1S8DB 4PJXB 4IMKC 3HI5L 5F71A 4G43B 3TIDA 1CFNA 5FO7B 4L8CA 5LGHH 5FO9B 4KZDH 5TDOA 1EVTC 1QBML 2FRGP 4L3ED 1P4BL 1D3CA 1U8LB 1WCQA 2YPKA 3T8XA 5HGDB 5FM8A 4DAGL 4F8QA 3WFCL 1RZ7L 4M02A 3VFUA 5MEOA 3L5JA 3ULVF 5T1KB 1G7JB 2H9GB 4D9RE 1AE6L 4JZOA 2AJUL 5KW9H 5KOMC 3WE6A 2VR9A 5GRUH 4UU9B 3P4OA 3TO4D 1WZ1H 1RIVL 3UO1H 3RWCB 1D5MA 1BEYL 3TP4A 1Q0XL 3QUXD 2VC2L 3EHBD 4GG6E 2HLFC 3MLXL 3QG6A 2VZSA 4ZO7A 5JPNA 2XQYK 1HHGB 3RKDD 5KSUA 1CGUA 2EDTA 2WUBH 3O3EA 5IQ7L 4ONGH 3JTSA 1OM3H 4U2ZA 5AWNH 5IVXA 4LQ1A 4X6EB 1QSVA 4LLWB 4JO4H 2WBWB 3ILPA 3BKYH 3IDUA 5DQDL 3GJEB 5FB8A 3WSQH 1D9KA 2K1MA 4HUWB 5EOQH 5I18H 2F74B 4XP5L 2PF6A 3MLUH 3PWVA 1IKFL 4Q9RH 2HWZL 1QZ1A 4Y4FA 4XRCA 1EJ6A 1OPGL 2YPLA 1FAIL 4JFEB 4JFYA 3MREB 4Y16C 5GJSL 4WUKH 2VLMD 3W9EB 3U7AA 5DZOA 4QRRD 4A6YB 4NNXA 3DURA 2GSGA 4F7TB 4X5XB 3TT1H 3PWPA 1EERB 1SYSA 4YX2L 2HFFA 3U0WL 5ACZB 4TVPH 1S7SA 4KHXH 3QDGD 2IAMB 1UZ6E 4FFZL 4G8GD 2VRAA 1KPVA 1OAQL 3FQWB 2V2WB 3C08L 3TO2A 5E0QA 3OGCA 4JFFD 4PY8I 1DE4A 1QLRA 4TTGA 1IGJA 4X98A 4EDXA 3QB7C 5T5FH 2W9DH 3QO0B 2FX8L 4ZUVA 1NUDA 4LOUC 5IROA 3HAEH 4PRIB 4PV9A 3D69A 2A6IA 3HZMB 4J4PA 4WWKB 4XPBL 3KHQA 5DJYB 32C2B 3BKML 2G60H 4LP5A 4AT6B 1U8JA 3CSPA 4FTVD 3K0WA 2X9XA 4ZS7L 4M6AA 4XMKH 4IOIA 4JHBA 3N1QC 1IGCL 4K7FB 4O58H 2W91A 4XCNB 4ZNEE 3ARYA 1B88A 5KZCD 3B9AA 3BEWB 1F90H 3WLBA 1MFDH 1DVFC 4P4KD 1KULA 5HGHA 2ZCHL 3ALPA 4NQCA 3CFEA 1NMCB 3CUPB 4QXGL 3STZB 5EULV 5D7KD 3KPOB 1KIUA 4IMLA 3BP4B 2H32B 3HNTH 5CBEB 1S7UB 2CLZB 3WKML 3QO1A 1P1ZB 5E5MB 5I1GL 1J0IA 3LS5L 2APXA 3QUXB 4KJWC 1NC2D 1SJEA 4NSKA 4KDTA 3LKQB 5D2NA 5TE4H 4ZYKA 1KB5L 3TNNA 1R3HB 4S0TD 4CGTA 1IRAY 1DQLL 4POZC 2C4FT 2CRYA 1NFDE 3C5ZB 3KXFD 4HKBB 1CIDA 5C6TH 4MX7A 4UOW0 4M8VA 2HFGH 3LEVH 3GK8L 1MQKH 2J6EA 4NNYB 3U7YH 4C55A 4JDVA 2HJLB 2R4SL 2DIJA 4D9QD 4F15B 3HFMH 1JHTB 1FG2B 1U93B 5I1IL 5F7WC 3Q6GL 2P7TB 2BX5A 5I1HH 4AH2B 2VL5B 3L3IB 5HHVH 4EN3C 2XWTA 4MS8C 3QAZB 1MY5A 4QRRB 1CXKA 1YEEH 3M8OH 4QHNB 4PYGA 3ZKND 3FN3A 3FQNA 4E0RB 3DWTA 3QHZL 3IDIB 1HHHA 4HLZH 1XGUA 4MAYC 5CP3A 1MI5A 5T1DH 3ZDZE 1HNGA 4G8GB 4O9HH 1VKXA 2Z35A 4Z7VA 5ADPH 2UVFA 3DROB 4MNQB 4HKJA 2VYRE 4YHYB 4K71B 2E8ZA 3OKMB 1OARL 3TBYB 1WFUA 2HKHH 5JZ7D 2XZCL 3IKCB 3QUYB 1V05A 1CLYL 4P5KB 4J3UA 4PRPB 2WBKA 4O4YL 1YY9C 3AS2A 4PRAA 1RUQL 2J5LC 2DQDL 4NYLB 2A77L 3RP1A 3P4MA 1D5BA 1F4XH 4FTVB 3JV0A 1J0JA 3BQUD 3MFFA 4G6FD 1CLZH 1T5WA 4X9HA 2EXWD 2NXYB 3T2NH 3UJJH 2NYYC 1GCFA 1XAUA 2CLVA 3CJJA 5D7JC 5EZIL 2IANA 1OCWL 3IDNB 5CZXD 5JLZB 4OFVA 3DUUA 4IDLA 1U8QB 5BO1H 3ULUE 4XNUL 3JWOH 4MSWA 5IQ9B 2HJKB 1VENA 5MEQA 4DN4L 2W9EL 5EU4B 1WIPA 1YEKL 2NZIA 4LGRB 4N0YL 1X3DA 4GAFB 1T0MA 5HGAB 5C0RH 3JTTB 3KVQA 4LQFL 3BI9X 4OAWA 4Z0BL 3U0PA 3HRPA 4QXTA 4ZFGH 5J1TC 3M45A 4KVNH 4YPGA 3NGBC 2FX7H 2H2SD 4K9EH 5DEGA 3MA9L 1ZTXL 3T0XA 4EIGB 3OPZH 4I77H 4UMGA 1NBZB 1LDPL 3NOIA 3CFDB 1VGEL 2ZCKH 3FOMA 3F8UB 4QWWD 1YJDH 4GRLD 1FVCA 3S98A 4C83A 1NC2B 5IEKB 4IIQA 1KCSL 4HX1B 1LP9B 1FIGL 4S0SD 4BSWB 5I15L 5FKPA 3KXFB 4HW6A 1PG7L 5DRWA 1ZLVK 1UB5A 3LV3B 4OZIE 1L7TH 2X4QB 2E9WA 4N9OB 2J8UF 3LQAC 4W81A 3H9YA 2OXHA 4GT7A 1KXVC 4O2EB 1P4LA 1R5IB 3JZ7A 4PLJC 4X99A 4ZDHA 3WUWA 3MRFA 5KVDH 5D7LD 1ZS8A 5JQHC 2BY1A 4RZCB 3QUKA 2DJ4A 5BRZD 5IW3A 3V4UL 3TBVB 1L0YA 3MRCB 3D39B 3ZZ1A 4KKBD 5DMYA 2V2TB 1A9EA 4C54A 1T0NB 2DBLL 2FGZA 4R97C 5ESQB 1AO7A 2KQMA 3E6FA 4B50A 4PJXA 2GFBA 3R1GH 5GZNC 3VDBA 1EEQA 3U0TB 5IHZB 4G43A 3HE6D 3HI5H 5F7NC 4HMEA 4ZUTB 5DEFB 3Q5TA 5C86A 4HJJL 4J12A 3OKDB 1PD6A 4P2CG 4NM8L 4HH9B 1U8LA 1FCGA 1N6QL 2VWEE 5IOPB 1ACYL 1QBMH 3I75A 1P4BH 1NFIB 4QOKB 5C0AE 3ALWA 3X3FL 4DAGH 1GXEA 2BJML 3WFCH 5T1KA 1RZ7H 5HYJD 4YQXL 1ZLVH 4XC1L 3MNZB 1URLA 1AE6H 2AJUH 4PGEB 4KJPC 1ZT7A 5I8OL 1KTDB 3BPCA 3BQUB 1RIVH 3ARBA 4PJ7E 1DQQA 4LCWD 4OLZL 3T04D 4XCEA 5EIIB 2OS7A 1BEYH 5E8EA 1Q0XH 1KGCE 1HHGA 2VC2H 4HH8A 3MLXH 5C09D 2F53E 1G84A 2X9WA 5I66A 4XBGA 5IQ7H 2VXSL 5TDPB 2G2RB 1NGZB 3GUTB 4U33A 2Y7QB 4NFCA 3KLAA 4RDQG 1I8LA 5DZNA 2ESVD 4DTGL 2ZSVB 4JPIB 5F89A 4PGCB 5AD0A 1I1AA 2CKBL 2ITCB 4HUWA 2F74A 5DQDH 1IBGL 4OZGB 5E6ZA 1CICD 3DGGA 4WHDA 4XP5H 1IKFH 3L6FB 3NAAL 4V2CB 4OFYA 3DO3A 2HWZH 4GRLB 1UVQA 5L8LB 5E70A 5IBUB 2QR0B 4NQUA 2FGWL 1OPGH 1TVHA 1FAIH 3GIVB 5GJSH 3S37L 4LIQL 5JNYB 1QSEE 1A7PL 4ZPVA 1T1YA 5DO2D 1ODAA 5DI8A 3EO1A 4YBLB 5ANME 5J56B 4HAFA 4GMSL 1PBYA 1ZGLB 2V5MA 5GGUA 1F8TL 3C5JB 1OVZA 4YX2H 3U6RB 3IJSB 2IAMA 3FTGB 5HI5C 4YGVB 3U0WH 3DRTB 3FQWA 1HSBB 2FJGB 1D6EB 4FFZH 3KG5A 3KPPB 1OAQH 3U9UB 3H3BC 4M8QB 5DC9B 4BFGA 1MCHA 3HR5B 2D2OA 3HAEB 1MCNA 1YEIL 3S3JA 4PRIA 1H15B 3HB3C 2DI8A 4M03A 4WWKA 3DARA 1AGFA 5DJYA 3VCLA 5FAAA 4AT6A 4XPBH 4IS6B 3BKMH 5B8CC 2DM3A 2C3XA 3HE6B 1VERA 4K7FA 1JNJA 4ZS7H 2RFXA 2G9HA 4UUJB 4NGHL 4NN7B 2DQGL 1IGCH 3GB7B 5IF0B 4U6TA 3WDIA 1C1EL 4FQJL 5EOCL 2VDML 4DOHE 1CD0A 3ESUF 4H88L 1ADQA 4JFHE 1WZLA 1CXEA 2ZCHH 3CUPA 1SYVA 3EOAB 3G5XB 3STZA 1QYGL 1U8IA 5GIRB 3KPOA 4K23L 4QXGH 3BZ4B 4JQXC 3BP4A 2YRLA 2H32A 3N0PB 1J1XL 1P1ZA 4L4VB 3S4SB 5EBLB 1K4DA 3WKMH 4NWUL 5I1GH 3AU1A 1ND0B 2C1PB 1CLOL 3LS5H 3LKQA 5HHNA 1ZA3B 2B39A 2RHEA 2J3SA 5C1MB 5D72L 1KJ2A 4G9FE 2BY3A 1FBIL 5C09B 4MMZC 3EOTL 4U6XA 1KB5H 5DZLA 4JDTL 5IK3B 4HKBA 3RTQC 1DQLH 3T77B 3PWLB 1LILA 4WV1B 5B21A 2ESVB 4PJCF 2W0FB 2FEEL 1ZLWK 5A3IC 1RV6X 4HJ0D 1T3FA 4V1DD 1LVEA 2R39A 3O8XD 5JOFA 1CICB 2R4SH 3W82A 1OTTC 1Q94B 1JHTA 1FG2A 1U93A 3D0LA 2IBGA 1CXIA 4FQCL 2VL5A 1XR8B 5I1IH 3Q6GH 4KZEL 5F7HA 4S1SL 5K9OB 1N4XL 3X17A 3TGXA 4QHNA 1RD6A 1YMHB 3SKJL 5I0DA 4E0RA 2GCYB 4BK4A 3IDIA 2EDKA 4ENED 3VRIB 3QHZH 4HHAA 3CDCA 1AGCA 5IMMB 1NCTA 3MJ6A 4S1QL 5BS0E 2QADD 3LN9A 2FSEB 4RGOL 5EOTB 2LAAA 3GMMB 2YMXL 3DROA 3IJHB 4MNQA 3UBXG 4XAKE 1EVUA 2N7BA 3MJ9A 3OKMA 3VFPB 3TN0B 2DWDA 3WUZA 5BOZG 2IPKB 1OARH 3WIHA 4F37F 3QUYA 4WFFE 3LOWA 4NO0A 4PJ8C 3DI2B 4YBQD 3MV9A 2XZCH 4GBXC 3HC3L 4PRPA 1CLYH 3KYMB 4O4YH 4NYLA 4NPYB 1B2WL 4DGVL 4Z7QF 4ZO6A 4EI6B 1RUQH 1ZLWH 4WUUD 4BZ2L 3NBNA 1SMOA 2A77H 1M1SA 2O5ZL 4S11A 4KV5F 4U6HA 1ZKAA 5J3HC 1V3LA 5I73B 5B4MC 3PWPD 1G7LA 4LLQA 3LVEA 5EZIH 3FOLB 1OCWH 4KTDL 2OM5A 2ZSWB 4RGNC 1HYSD 1NDMB 1MREL 2MKLC 4I5BB 1Q1JL 3BPLB 4NZUL 4XNUH 5EUKB 5HGAA 4DN4H 2W9EH 4X4ME 2KH2B 1YEKH 3AM8A 1OP3K 4N0YH 1IC5L 2VITA 1GGBL 4LQFH 4XC3L 4Z0BH 3BEVB 5J11B 3IRPX 4LRIC 2ZG3A 2JJWA 3K4DA 3UBXI 2FIRT 4YE4L 4PJDA 4CVWA 1J7VR 5K93A 3BIKA 4K94L 5DWUL 3MRQB 3MA9H 1ZTXH 2YUWA 4LSQL 5I1CL 1NCDL 1NGYA 3CFDA 4U1HB 1HH9A 2F8XC 4J4PD 5IEKA 2DD8H 1LDPH 4GKZB 1VGEH 2JK5B 5CIPA 3OAUL 3SBWA 1LP9A 2Q7NA 3ZE0E 1KCSH 3KLSA 4WNQA 4H8WL 4IOFD 4NBYB 4BSWA 5IMLB 5MHSE 1FIGH 2ATPB 3I6LD 2CD0A 4P2OA 2A0LC 2NY1B 1A6UL 5I15H 3G6JE 1JTOA 2X4QA 3L5XL 3MRNA 5C0CA 2HTKD 1XF5A 4TN9A 4PJAF 1PG7H 1BOGA 4L5FL 5C08D 3VXMB 5I76B 4O2EA 1R5IA 3QBTB 5CJ5A 3AVEA 4X8JB 5EO9A 2Z8VC 3FRPA 1NEZB 3ARFB 4NQCD 3OKOB 3GEWB 3O8XB 1FO0A 3SE9L 4Y4KC 3TZVC 1QQDB 1QUNA 1KTRL 3BN9D 2WZPD 3TBVA 2DI9A 4XNXL 2NY2D 5C7XL 4Y4HC 4JLRB 3V4UH 3B9KB 2VZTA 3P30L 3IDXL 1BQUA 2MPAL 4XPGL 2Y25A 4LPUA 2V2TA 3DRQA 3U83A 4F8TA 3H3PL 3STLA 5ESQA 2DBLH 3ZYJA 4D2NA 4P48A 2CRIA 2D03H 5CGYD 3U0TA 4LFHD 4Q97A 3MV8D 2FBJL 1G7PA 3BGFC 5L9DL 1UFUA 4HJJH 1XCTB 5FK9B 1ZVSA 4QT5B 5JHDB 3V6FA 4ZUSB 3BO8B 1N6QH 1A7QL 4Y5VA 4HAGA 1ACYH 4QOKA 4QXWA 4RAVB 3PWNB 5EC2A 4J3VA 3O6KL 1XF2B 4PJFB 4J8RB 2BHUA 2F15A 2NTFB 1H3WM 1NAKL 3X3FH 4NRXB 2BJMH 3NIDF 3O9WC 1YDPB 2X41A 4YQXH 4PGEA 1KTDA 3EO0B 2GJ6D 4WUUB 5I8OH 4ZAKA 2VZUA 1WWBX 3VFWB 1C5DA 5FYLL 5IB1B 2J8HA 4N5UA 4OLZH 2V17L 1DFBH 1EPFA 5JIPA 1FJ1A 1KACB 5HVHB 3GSVB 4PGZA 2JCCE 4PBWD 5TGBB 4TSAL 1SMAA 5EG6C 1D5ZA 4JG1L 2G2RA 3GUTA 5F7KC 3ZLQC 2EIBA 5FV2A 4G3YL 4O5LL 1JBJA 2VAJA 3GSUB 4JPIA 1A14L 3EOBA 3UTTE 1LEIB 1Q72L 4DTGH 4KRPC 3RAJL 5AG8A 2CKBH 1UCBL 3GSWB 2NY4C 2JIXB 1FFNB 3L6FA 1IBGH 3R8BB 4WTXA 4CADA 4QTHB 3ARED 2QR0A 3QDMA 5C0ND 3NAAH 4HS3B 1YPZF 3BYTA 3REVA 5FYJE 3GIVA 5BQ7B 2FGWH 5MEPB 3LB6D 4QHKI 3QQ4B 4XNZB 5JNYA 2BVEA 5ALBL 3MV01 3S37H 2F8OA 4LIQH 1A7PH 3SDDC 1T6WA 3P0VL 1ZGLA 1EHXA 1LGVA 5C08B 2ZUXA 4GMSH 5D1QB 3C5JA 3IJSA 3LHPL 1VACA 5ICXB 3U48A 3O3DB 3TC9A 4DJMA 3QDAA 1F8TH 3MV7B 4OLWL 2COQA 2G75B 3GNML 4HF5L 1D6EA 3RVUD 2C5DC 3UTPD 1VFMA 1MHHB 2VDPL 5DUPL 3BWUC 4ZS6C 4M8QA 3VA6A 5E6IA 3E0GA 1YYML 3HAEA 5I1AB 1H15A 3AMKA 4B0MM 3HE7B 1YEIH 2QKIB 3VG9C 3IFNL 5DJ8A 2OJEB 3O2WL 1MHPH 3RGVC 1A21A 1RPQA 5KSAD 3VH8G 2RAMA 3EJZD 2PW1A 3WFHB 5DJDA 5HD8C 1DQDH 3RIFK 2F54B 4PRDB 3RDTB 3OKNB 4EVNA 3HC0B 4HWEL 4UT6L 4NGHH 2DQGH 4ORGB 1C1EH 4FQJH 4XP4L 2XA8L 1FGNL 2GTWB 2VDMH 1ITCA 5EOCH 3VRJB 4I8DA 1P9MA 3E6HA 1GGTA 3WV0A 4H88H 3G5XA 5JMRA 1OLLA 1KPUA 4RMSA 2EYSA 4JQIL 5E94A 4PR5B 3BZ4A 4XT1C 1QYGH 3PXJA 5GISL 1QP1A 4UIKL 1H9VA 4K23H 1GL4B 4N0FB 4QHMB 2KDGA 3WIFB 4NHUB 1C08A 5KVMC 1J1XH 3F62A 3PV7A 3QIBB 2BC4A 4LLVA 4IMKA 5IVXF 3TFKD 4HULB 1QSZA 1CLOH 3ULVC 1KB5B 5D72H 2IANE 5TE6L 3OF6A 1FBIH 1U8PB 5IK3A 3ZL4H 5GS0D 3W0WB 3EOTH 1P7KB 3V5KA 4JDTH 2A6DB 4WV1A 1BVKA 5EC1B 3MOQA 4X6CB 3VI4E 1LO2L 4PD4K 3ARDD 2W0FA 5DVKA 3PG2A 1J1OL 5AYQA 4NT6A 4LHQB 2IF7A 2R1WA 1GOFA 2NX5A 3HZKB 4KH2A 2BRQA 3MJ7B 2BDNL 4D0CB 4GRWE 3AREB 5D7IB 1ZVHA 3ZSSA 1G0DA 2DLGA 2HG5A 4FQCH 3ARBD 3TJEL 3G9VA 4KZEH 3AC0A 5K9OA 1F02I 3IFLL 5JOEA 3MLWL 5ISZE 1VFBB 1YMHA 5DVOA 1HNFA 4S1SH 5IJVB 1N4XH 1AHWC 1NAMA 2GCYA 3SKJH 3MZTA 4HUVB 3O6FB 2PUQT 3IDMA 5HGBB 1WWCA 3RWIB 5IMMA 3O4LE 4WTZA 3KWWA 4U6YB 4LPTA 4HWNA 4FP8L 3BWAA 4S1QH 4EI5D 2X1OA 3GMMA 3IJHA 4RGOH 3ETBF 4PLKD 3C6SB 1I1AD 2YMXH 3V5HB 3V7MA 4BH7A 3O3AB 1I8MA 3LS4L 5SX4H 4M43L 1D5XB 5HSFA 3B2UC 2ENSA 5D1XC 3P4NB 3RPIB 3KYMA 4GXUM 3HC3H 5EO0B 2QSVA 1RZFL 5KANG 1U8MB 1I8IA 4NPYA 4YEFA 4Y8AA 2DIBA 3ZE1F 4DGVH 1B2WH 1K3ZA 1KTKE 5KSAB 3FL7A 5HGGS 1CR9H 4PJXE 4BZ2H 1A0QL 2O5ZH 5GS1A 3TBWB 1PX3A 4MZ3A 5C92A 2ZSWA 1I7ZA 1CFQB 1NDMA 1I1FA 4CBPA 4I5BA 4KTDH 3U30B 1G6RL 5EUKA 1MREH 1Q1JH 4NZUH 3ZKMC 3EYQC 1I9RL 3RVXC 3BEVA 1G9NL 1IC5H 1GGBH 1P69B 1K4CB 3IT8D 1J11A 4XC3H 1WCBA 4JRWA 4YE4H 4RMTA 1G6VK 3DIFA 4MVBC 2V9TA 3O41B 3O4OC 3KYOB 4U1HA 4K94H 5DWUH 4P57A 2Q1EA 3IFPB 1CT8B 3L95B 4LSQH 5I1CH 1NCDH 3BH9B 4GKZA 2QEJA 1T7XA 1BQHB 1JRHI 3PP3K 2B0SL 4JQVA 3DV6A 4Y2DD 5EUOE 3RUGB 3OAUH 5IMLA 3MJGX 4WFHE 2ATPA 3LD8B 4H8WH 5IB2B 2BSED 3IS0X 3A67L 1A6UH 3L5XH 3VXMA 2FB4L 4OGAC 2I24N 4L5FH 4WO4C 1BX2B 3H7BA 4AQ1B 3CSYB 3QUZB 1JP5A 1QQDA 4OZFH 3SE9H 1IM9D 2VN7A 3RRQA 3B9KA 4XNXH 4LSUL 5C7XH 1MJJB 2D7PA 1VFOA 4O2FA 3P30H 3IDXH 4JFEE 4WHYG 4BSVB 2MPAH 3U7WL 4XPGH 1S9YB 3QNXB 1TDQA 4TSBL 1TETL 3IU4L 4X80L 2FEDC 2H1PL 1HH6A 5TF1L 4QGYA 4OI9A 3SY0B 3BW9B 4Z7VF 4M5ZL 2MFNA 5EN2A 2WSKA 2EH8H 1NBYB 4PB9L 4EI5B 1QR1B 1R3IH 2FBJH 3P40A 1ZOXA 2BNRB 5L9DH 1XCTA 5BVPL 5JHDA 2VH5L 4ZUSA 1J8HD 3BO8A 3TWCL 5C0BA 5LVEA 3PWNA 2G5RA 4MHHI 4ZFZB 1I8KB 2CQVA 1A7QH 1AFVL 3KPRB 3O6KH 2NY0D 4NRXA 2EDXA 5CEXB 1YDPA 2YA1A 2BOBA 2VIRA 1NAKH 1C8PA 4YFDB 3SDAC 4R90L 3EO0A 1MSPA 25C8L 5JOPD 2XPGB 2Z31D 3V52L 4YC2B 3VFWA 3DMMC 3CMGA 4Y5YB 3WCYA 1ZHBB 5FYLH 2V17H 2P5ED 5FM5M 3D18B 4LMQE 1JF1B 5TGBA 4XGZA 3R8QA 3RJDA 4NO5B 2P8PB 4KK9C 4X7SL 1Z5LB 4TSAH 3WNMA 2L7UA 4L3EE 1TVBB 5IM7B 4G3YH 1NCCL 4O5LH 1UH3A 4X6DB 1LEIA 2NXZC 3SO3B 2W0LA 1CXHA 4NP4L 1A14H 2CKBB 2IQAB 4NO0D 1Q72H 5DJ2B 1J0YA 3RAJH 2D9QB 2JIXA 2KL6A 2BSRA 1UCBH 3GSQB 1EGJL 3DVGA 3MBEB 1K8IB 5FUOL 1KB9K 4HS3A 3EIFA 4PLOB 4ZUWB 2IMMA 4TYUA 4I4WB 4Y2DB 5MEPA 3QQ4A 4LLUB 2EDDA 4J7RA 4CVZA 1N3NB 3BRFA 3LPFA 1CE1L 4HIXL 2F8VA 2X44D 4HMDA 5B39G 4BH8B 4OCNC 4RMUA 3P0VH 1U3HD 1I7UA 5IEHB 5D1QA 3ULUL 1X4ZA 5GRVK 5H37H 5ICXA 3O3DA 4TNVF 3MV7A 4APQC 3LHPH 1QR4A 2G75A 5CLWA 1MFAL 2AKRB 3QCUL 4J6RL 4K8RC 4OLWH 4GFTB 4WFGD 1L4IA 3GNMH 4HF5H 5CSZB 3I3EA 4NKOB 4ZO8A 1JWUA 1MHHA 2ADJB 2Z8WC 4ISVB 4LVOC 2EZ0D 1FLRL 3QEGH 2VDPH 2OR9L 5DUPH 4U0RC 4TUKL 4HZLB 1YYMH 1IARB 2X4NB 1F4WL 1HQ4B 5ERWB 2VLME 4YR6B 2QKIA 5IWLA 4RQQA 4QRRE 4Y19B 2LTQC 2OJEA 3IFNH 4NCC2 3PXHA 3IDYC 3O2WH 3HPJB 1JZ6A 4MCYB 3WFHA 4MXVE 3SKNA 3K4AA 4W4OA 1BWWA 3C8HA 4PRDA 3RDTA 3PHQA 3MBXL 4IRJC 1U2CA 1AKJB 2ADGA 4G8GE 4KGLA 4N8PA 2X05A 4PJHA 4UT6H 4HWEH 1J0ZA 2P5WB 4UT7L 2E7MA 4XP4H 4FNLL 2XA8H 1FGNH 3X12A 5JW4R 5TPWL 4I0PC 4NIKB 1DCLA 3BPOC 2NY0B 3FB7B 4H20L 3V6OC 4OD3L 4PR5A 4JQIH 2Q86B 2BNUA 1XT5A 4E41B 2EYRB 5GISH 2Z31B 4I0CC 4UIKH 3C8DA 4F7EB 1H3PL 5DVMA 1YMMA 1EXUB 4FTVE 4KTEL 1B6UA 1KJVB 2FHBA 5DSCB 5IB4A 3VI3F 1CGTA 4XI5D 4XBEL 1KB5A 4FFWD 5DMKB 3W0WA 2BVOB 2LVEA 1S78C 3X14B 5TE6H 3H9ZA 1N6VA 2FZ3B 5EC1A 3PL6B 1LWRA 1BD2D 1ORQB 5CWSA 4I2XB 1XF1A 5KG9B 3R4DA 3TBTB 1LO2H 1HHKB 3QIUB 1PG7W 4FQ1L 1J1OH 3IU3A 5D7KE 4KK8C 4LEOB 3FO0L 4D0CA 4WU7B 5D7IA 5BV7L 2PO6C 3SEPA 4Z77A 2FHCA 2BDNH 1Z3GL 1WQVT 3MUHL 3ZSTA 1Y0LB 5LAXB 1FL5A 2OTPA 4LVNB 4PJ9C 2YN3A 3WHE1 2HLAA 3DHMA 5DFVD 5IJVA 2MJWA 3TJEH 2R9HC 4N1HB 3IFLH 4Y5XC 3MLWH 5F97E 5GGSB 1BZ9A 2EDLA 3O6FA 3BGMB 1U3HB 3KXFE 5T3ZD 2DLIA 4CVUA 5HGBA 1QA9B 1JGLL 2NY6C 3MRGB 1EO8L 1S5HB 3QEQB 4U6YA 2EE6A 3S97C 1IE5A 4X0KA 3MACL 3WNKA 2P1YA 4JO2L 4ODUA 1PY4A 3C6SA 4FP8H 5D2LE 4X7EC 3ARGA 4UOJA 3V5HA 2EE2A 4D9QE 1U3ZA 4PREB 3H9SA 4FQHA 1JFQL 2BRRL 4MJIA 3NZ8B 3LS4H 5CEZL 3SDYL 3RPIA 2R23B 2ZNXA 1I1RA 3D39E 2XTJC 1A7RL 5KVEH 5EO0A 3QDMD 4TTDD 1U8MA 1I3RB 3NIFF 3BP7B 3VGDA 3GMLA 4LAQL 4LBEB 2MKWA 1TPXC 1A6TB 3EGSB 3RWGB 1A0QH 4JN2A 1CFQA 1E4KA 4MNHB 3IDGB 3EYUH 1K2DB 6CGTA 4N8VB 1JPGB 1G6RH 5AZ2L 5C0EB 3IXAB 1AD0B 2OQJB 3QXWA 5CINL 5IFAH 1I9RH 1K4CA 3ISWA 3BT2L 1G9NH 3Q3GB 4B7LA 3FZUD 3O41A 1QD0A 4KROB 4X7FC 3WNNA 1INDL 3IFPA 1NCBL 3L95A 3P77A 3MGAA 1BQHA 1CTOA 4LVHB 1JGDA 1EAPA 5JO5A 4JM2B 4OT1L 1E28B 4YNYB 3LKPB 2B0SH 3C60A 4NN6C 4JO3L 4PGDA 4F9LC 4B5EA 1WV7T 5H2BB 3S5LG 1AP2B 3BUTA 5ECJE 3VFOA 3BIBX 3A67H 1MCFA 2FB4H 2VDNL 3AY4A 5CGMA 2P45B 3VGAB 3CSYA 4WHTB 3QUZA 5F96L 4JKLA 2R29H 1YN7A 3BVNB 4OZFB 3GBNL 2XWBA 4OZGE 2ZWLT 5B38B 5JXEC 1ORSB 1W0YT 1CDBA 3W9DB 2NW2B 1HXYB 4QRTB 3T0EB 3TEUA 4LSUH 4BSVA 1RJZA 1S9YA 3QNXA 4N0CD 3WN5C 4KHTL 1AR1C 5DR5H 2YR3A 3U7WH 4P4RB 1IAIL 4UDUB 1T83A 1TETH 3IU4H 4X80H 1G7MB 3SY0A 3BW9A 2H1PH 3I85A 1OSZA 5TF1H 1ITBB 4FFVC 3MRRA 3PQYB 2X9YA 4QCIB 5M7QA 4M5ZH 4BJLA 5L2KD 1QR1A 3N50A 2E7CA 2BNRA 4DK6A 2DTSA 4PB9H 2ICES 2EDHA 3FONB 2IH3A 5E8PB 4O02L 3VW3L 4P2RB 3DSNA 4KK5C 2VWEC 4OCRL 1GZQA 2VH5H 2NX5D 4Q6IC 1CK0L 3TWCH 4X4YA 3KPRA 1CWVA 2F9BT 5CEXA 1GPOL 1AFVH 4UQ3B 1BF2A 1JGEB 2UYLB 5FO8B 5HVGB 3QH3A 4NQDB 4R90H 2CO6B 2HLFD 25C8H 4RMWA 3IDJB 5DUBA 3VXRA 3V52H 4O51A 1ZHBA 4LCCC 3BH8B 4JREC 1JF1A 4OV5B 5F1IB 3VMPA 1E27B 2P8PA 4TVSa 4HSQA 3CDFA 1Z5LA 5I1DB 4ZOEA 4PJDF 2DI7A 4X7SH 5DHVH 5IM7A 2CIIB 1T2QL 1XF3B 4ZD3H 4N8CL 1FZJB 4UDTA 1NCCH 3FQXA 2IQAA 4IRSA 5DJ2A 4Z7WE 1HE7A 5HYJE 5J89A 4NP4H 1LP9F 1N5YL 1I7TB 4YZFE 4Y16D 4OUUB 3PHSA 1K8IA 4JFQB 1EGJH 4I3SL 4L4VE 1EEZB 1PYWB 4LCWE 5FUOH 4OFPA 1IAIM 4GLRI 4BQBA 4LLUA 2VZVA 2JELL 3WS6A 1N3NA 3K2UL 5C09E 2H6PA 1F5WA 3F6LA 4HXAL 3ZDXF 5F6IB 1CE1H 5IEHA 5TDNA 4HIXH 2D7MA 3HRZA 4JZJB 1OGTB 1H8SA 2YD3A 1FNLA 1BVLA 1OAUL 3ULUH 5F70A 5IW6B 2ESVE 5E2JA 3FMGH 4MQ7A 1JJUA 4OFKA 4U1NB 3FQUA 1UH2A 1JV5B 3TA3A 1FV1B 5CSZA 5A1AA 1BBJA 1MFAH 2ADJA 3QCUH 4J6RH 2WINB 3EZJB 1ZV5A 4RA3A 4LOUD 1FLRH 3L3HB 4GG8B 2CDFB 2OR9H 3L3OA 5TQ2L 4TUKH 2EIZB 1ED3B 4P46C 3L1OL 4I3GA 1GGUA 2XIDA 2YBRB 2DKUA 1F4WH 4Y19A 2YZ8A 1W0WB 1A6ZB 4DZ8A 3Q1SL 1G1CA 3FB6A 3SGJC 2QSQA 3G5ZA 1QSFB 1Q9WA 4XWOC 5GPRA 3UJTL 3HZYB 2VLRB 4NQSA 4YHKL 5L2KB 3CZJA 5A2KH 4L3CB 1DVFD 3MBXH 3QIWC 5FA4A 4YUEL 2P5WA 3C5SA 4MB3A 1K3IA 1A2YB 3MRHB 3TZVA 4UT7H 4X7CC 2GAZA 4FNLH 5F21B 1J05A 5D6CB 1CDIA 4Y4HA 5EU5B 5HI3C 3GMNB 5TPWH 3TNMB 2BXZA 4H20H 4JDZB 4OD3H 1F45A 4L4TD 2DQJL 4KJWD 3D85D 4HG4K 3OHXA 3T3PE 3ARQA 4S2SA 1KJVA 1H3PH 2CLRB 4N90D 5DSCA 5EU6D 5SV4A 4KTEH 4POZD 1XIWB 3BKCL 1HHIB 2AEQL 5GHWL 4XBEH 5CJ8A 3X14A 2IALB 1SEBB 5C07A 2R2HA 3GJFH 3EJJX 3PWUB 3QFJD 5E8DL 5E4IA 3V7AG 4KRLB 2V6HA 3RVVC 2JB6A 1SJXA 4J2XA 4YH6A 2L0DA 5DK2A 4TULL 1UG9A 4OFDA 4YHNB 3WXVL 3FB8B 4FXGB 4FQ1H 4LEOA 3QP3A 2WBJC 3O9WA 3IAGC 1A4KB 4OIIL 4WU7A 4MQXC 3B2VH 4EN3D 1P84K 3FO0H 2G5BA 4MS8D 5EOCJ 1Y0LA 2W65B 5BV7H 3BFOA 1DSFL 4KFZC 2B1HL 1Z3GH 4PGBB 2C4XA 3PDGA 4CVXB 1JYVA 2GUOB 3QWOB 4L8BB 3CIQA 3PHOB 3I3BA 4G80B 4K7PL 3BGMA 4P49A 4GG6B 4HIJB 3HTLX 4MAYD 1MY7A 1CIUA 1LE5B 3U2SA 1S5HA 2WV3A 3QEQA 5F1NA 4LDLB 4K55A 2M26A 1JGLH 5HDBF 4B7IA 4NJAL 1EO8H 1S9WB 3MTRA 1HINL 5IMKA 1S7RA 3REWB 1SBSL 2VZOA 2JF1A 3MACH 4JO2H 4M1GL 2K9UA 4V1DE 5L2JB 2CGRL 4GW4B 4DUVA 1RZGB 4N68A 4OZ4A 2EEAA 1U8HA 1JFQH 2R23A 3KPNA 1YY9D 3ELAT 2BRRH 5F7LB 3GDBA 2O5YL 5EO1B 1UB6A 5I1JH 5CEZH 3SDYH 3KLDA 2DMKA 2CUMA 3BP7A 1A7RH 4QEGA 5FYJL 2NYYD 4OJFL 5D7JD 3C6LC 2AXHA 4NFDA 2ILLA 4LBEA 4NO3B 4LHUD 1UACL 3ZTJH 4YHOL 3EGSA 3RWGA 4LAQH 4DCQB 4XMLL 1EK3A 4MNHA 4MXQC 4NUJB 4N8VA 4UTBL 4FMKA 1G6RB 4RRPA 2PYEA 2HP4A 5C0EA 3BZFB 2WP3T 3IXAA 1A6WL 1S7XA 3OR6B 1AD0A 2OQJA 3KPLB 5KSBE 5AZ2H 4FXLA 3AB0C 3FB5A 4PJFE 5CINH 3TH3T 3EKCA 1UJTA 3Q3GA 4MD0B 4JHAL 4L4TB 4FQXC 1S7QA 3D85B 1PG7X 1OD9A 1PEWA 4HEME 4UIMB 1INDH