5I30H

Crystal structure of the human astrovirus 2 neutralizing monoclonal antibody pl-2 fab fragment at 1.9 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
212
Chain Sequence
DVQLKQSGPGLVQPSQSLSITCTVSGFSLIDYGVHWVRQSPGKGLEWLGVIWTGGSTDYNAAFISRLTISKDNSKSQVFFKMNSLQANDTGIYYCGRPYYGNVMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab PL-2 light chain
publication title De Novo Sequencing and Resurrection of a Human Astrovirus-Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30H01
3HZKB 4GAGL 4P46C 4I13B 1NKRA 3O3BB 4JM2F 4F2MA 4Y19A 3FQUB 1FYTA 1RD6A 5JHLL 4XNXH 1DFBL 2CDFA 1KV3A 3TPKA 4ONOA 4CMHC 4UQ2B 4MXQD 2VAJA 4OCYH 2N1KA 1SJXA 3IETA 5DFVC 5C0EB 3GMQA 1DE4B 3MJ9A 1FNGA 2DF3A 1O5DT 5D7IF 3QXVA 1PKOA 3HRZB 1FV1B 2EDKA 5CCKH 4G6FD 4YUEL 4Z7OF 1QFWL 1JGLH 3X12A 2FJGB 3CX5J 5EOCJ 2H2SD 3T2NL 2DQHH 4K9EL 2P8LA 4OLWL 1A6PA 3GUTA 1MFCH 4K3DL 4RMSA 2HKFL 4PG2C 1J88A 4PV8B 4O2EB 4L8SA 2ITDA 2J4WL 1X6LA 3QDME 4XC3L 4X80L 2CK2A 3GB7A 2AV7A 3NACL 5TF1L 1F4WH 3BJ91 3Q1SL 4Z5RB 4P46A 3GRWL 4XVTL 4C4KT 1GZQB 3TNNB 4DVBB 3VG9C 3OGOE 3RDTB 1R3HA 2K3TA 4UQ3B 3I75B 4HCRL 1HHGB 1DN0A 3OZ9L 3QUZC 3UYPA 4KAQL 5DD3L 1QFUH 3BPCB 4LCCB 2WQ8A 4PRDA 3UBXI 1JCKA 1NAKL 5CJQH 4MNQB 5INCA 3SOBH 2CLVA 4GXVH 4PG9B 3VXUD 4KI1A 1FZOA 1CL7H 3QDMD 4QY8B 3DECA 3MRGA 4KHXL 4Y16B 2LVCA 4WNQA 5E9DB 5FKAA 1CFSB 2F74B 1NBVL 5DUMH 3BP5A 1TZHB 3VD5A 4P23A 4I2XA 4LARH 3VFWB 1T6WA 4AT6B 4PG2A 3FCTB 1K2DA 2GJ6A 3IRZA 5I71B 3MNWB 4WWKB 4XNZB 2X4OA 2ZOKB 1R3KA 1QEWA 1QSEB 3LVEA 4C83A 3H9SB 2GHWB 5SX4I 3MLTB 3L3DB 4Y5YB 2EXYC 1AKJA 2Z92A 3UX9B 4P4KC 3HLAB 4EDXA 3GKZA 3BKYL 3GZKA 5JW5B 1UWXH 3BYYA 3EUUA 4PP2A 3BGMA 4GW1B 4PIRF 2JJUA 1T04B 4NP4H 3U6RB 3B3IB 4LSSL 4U7MA 5JZ7C 4LCYA 1HYSD 1QRND 4UINH 3HNTL 1TQCC 5D7JD 2VLKB 2WUCH 3MYJA 3RWHB 1RK0A 1NBYA 4QT5A 2VR9A 4JGJA 1DBBH 1OF2A 2HFEB 1S8DA 1TPXB 5FB8A 2YD6A 2A6JA 3QQ4B 5AUMA 1UB5B 3VD3A 1QLRB 3PP4L 4EN3B 1R5WB 5E95B 5C07E 3QQNA 3HFML 2F8OA 1T66C 1DVFD 5GGVH 1HKFA 3ARGA 5EU6E 2YWZA 4JFQA 5B3JF 4XWOD 4QXWA 2PO6C 3LRGA 3FT4A 4XBGA 3TIDA 4ZPTB 4O9HL 1B2WH 3MA7B 3PABB 2ICWI 1CD9B 1G9NH 5HGGS 4O4YL 1EHLH 4YDLB 2CIKB 1I3GL 3RI5F 1XFPA 4NQCA 2JF1A 3C6SB 1CLZH 3Q5YA 4ZTPH 1MCWW 4QXUL 4BQ9A 4HUVA 7CGTA 3RVWD 3QWOB 1RI8A 1V3KA 3V4PH 3UAJD 1UM6H 3VGDA 2DKSA 5C07D 4D0DB 3GK8L 1RZ7H 3EOBB 3MFGB 4ODTH 5JPMA 3GSOA 4K94H 5MHSE 1KPRB 1PZUB 1TNNA 3LN5B 1ND0B 4PJFA 1IAOB 5EU6D 3HN3A 2DJ4A 5DUPH 5AZEL 3HRPA 5C0AE 4HH8A 4BH8A 4AIZA 4AJ0A 5DUBB 1UWEL 1FAIL 3MUJA 1ORQB 1JYXA 1KIUA 4M62L 5E99H 3KPQB 3GSXB 4GS7B 4Z7NF 1LEIB 1UKQA 3RAJL 1FG9C 4MAYC 1R3IL 4WDIA 1VPOH 2PO6A 5IMLB 5CLWA 4DCQB 3WHXB 3ILPA 4YHML 3QJHB 2OK0L 2H26A 5MHSD 4H0HB 5MEOB 2APBA 1QBML 1WAAA 2J3SA 1JWMA 2P24B 1MQ8A 1LO4L 5DC4B 4XP5H 1YPZB 2OR8A 4P2OC 4HX1B 4KTDH 2ITCA 4RWHA 4WIQA 1LQSR 4X0KA 3G5XB 2EH8L 2A74B 3P73B 1OPGL 4YDVA 2FO4B 5ABDE 4H25B 4RIRA 1OGAE 3K46A 4XP9L 5BQ7A 3STZA 5I8KH 1ZLWH 5JXAH 1YDPA 2EE3A 3UBXA 4MJ5B 4JFYA 1MEXL 4YHIA 43CAB 1FC2D 3ZDZF 4MYWB 4HKXB 1G7MB 1YEJL 3GJFH 1T0PB 5DJ8B 8CGTA 2PETA 1I3VA 1I9IL 3TCXA 3BEVB 4QRPB 4MAYA 4RFOL 2HP4A 1K6QL 2AV1B 1DQDL 1K8DB 2XN9B 5L6YL 1PLGL 3MFFB 3P0GB 4GLRI 3PWPB 1Y18A 5I0DA 1R5IB 1OGAD 2NW3B 1X4ZA 3GKWL 5D1ZC 4LLMA 1RIHL 5JOFA 4UUJB 3IB4A 4P2OA 2W1NA 3HZMB 1BZ7A 5HI3D 4JDTL 3SDCB 5BXFB 4JM2C 2R0WL 4P9ML 4GO6B 1BAFH 5GIRA 3GEWB 3CC5B 2AP2A 3F7RA 2YBRB 1YEFL 2VITA 1KN2L 3OKKA 3RIFK 4Z7VA 5IEHB 5DD0H 1ZEAH 4Y4KB 3BAEH 4ALAH 4KK8C 3Q6FA 1MCEA 5IJVB 4N5EC 1KCVL 1BX2B 3BN9D 5E0QA 5HHQA 3NGBC 3C60C 4LSQL 4V1DB 1JWUB 2WWMC 4W4NA 2NY5H 5IB1B 1CYGA 1MOEA 1YPZF 2VZ1A 5BZWA 12E8H 1KFAL 3QEQE 3LS4L 4Q74A 4TQEL 4PJ7B 1FGNL 3LKPA 2D03L 4XCCL 4CVXA 2VRAA 1X5GA 2AJVH 5B22A 4J2XA 3OXRB 1U95A 5KW9L 1IM9A 3KPPA 2P5EA 1XF5A 4PGCA 4ONGH 5IW6A 3JSSA 2DQUL 1XGPB 2ZG2A 5D1ZA 1JPFB 2NR6C 3RX5A 1NGZA 2QHLA 4P9HL 3TEUA 3WIIL 3D85A 1CD1A 2ADIB 4TTGA 2JK5A 1U93B 3EFDL 3ZTJG 4ZFFB 5IR1B 4NQEB 4PV9A 4WEUD 4X6EA 3SN6N 5ALCL 3W2DH 5L7XH 3QEQD 9CGTA 1C08A 5GRYA 3VWKC 1CGTA 5L8JB 5C0JB 4OLUH 3WIHL 3VXSE 3WFZA 4HFWB 1DUZB 2YPLA 4FFZH 1LP9E 3C60A 4NRZB 4RMQA 3AS0A 4UDUB 1ZHKA 1MLCA 4FXKB 1L7TL 4RGOH 5GHWL 4O00A 1JRHL 1LWRA 4BQBA 1DUYA 3S9DB 4JPVL 3DGGB 4U6YA 2NNAB 2Z8RA 1A7RH 1A9EA 1Q9WA 3L7EB 3ARFC 4GG8A 5DJ0A 3RNQB 5F8RC 3ULVL 1FZJA 3S34L 5F9DC 1A4KA 2VN7A 3REVA 4OIAA 5F70A 1WZ1L 4G6JH 4UU9B 4KGJA 1LDSA 2C3HA 1EV2E 3MODL 3KPSE 3MCKA 3O4LE 4NM8L 3VXSD 4QLRA 3NA4A 4YPGB 3PL6A 5F9WC 2X2YA 3MNVB 2R4RH 3SKJH 3N1QC 1QYGH 4BZ2L 3MROB 2YEZA 4GMSL 3GSNA 4HJJH 1GHFL 2XWTA 5B39A 4NN6B 1NCDH 1D5IL 5E8EB 5C08E 1L0XA 2WV3A 1ZGLP 5A2IH 4XRCB 3PG2A 2BVQB 1UA6H 1U6AH 3SJVE 2IEPA 3ELAT 3ZE0F 3ZT5A 2Z91A 3T8XA 3HZKA 4M93C 2EO1A 3KWWA 3O3BA 2QLVB 5H94B 3G6JE 3FQUA 1J18A 1CGXA 1OQOA 3O4LD 1RIVH 1A6UL 4FZ8H 4YDKL 3QG6B 3ARFA 3HR5A 2VZSA 4M3KB 4UQ2A 4PRIE 5BO1L 4NO5B 2JIXB 3EIFA 3HB3D 4FXLA 1DE4A 2AJUL 4DKEH 4LF3B 3I6LE 5C09E 4YBHA 4OZIE 2M26A 5GQBA 4M6OL 1JGVL 2QHRH 4Y4FD 1CK0L 5C08D 5A3ID 5DRZA 3HRZA 2QADC 3RZWA 5GRXG 4MSWB 2P48B 1FV1A 3JBG7 2G9HB 3D3VB 5HHNA 1HHHB 5C0CE 3SJVD 1LO5B 4PLJC 2DD8L 3GO1H 4IHOB 5BS0E 1JPGB 4FMFA 4JY5L 4OCXH 1JGUH 1FHGA 1AGFA 2R0LH 3MXVL 1N64L 4HIJB 3MCG1 4AMKL 4XCYB 2W9DH 2FWOB 3KR3H 3QZWG 3SE4A 2PW2A 4KQ4L 5C0BB 1PG7H 4PRID 4Z5RA 3LN4B 3V6OE 3I6LD 3GFUA 4Y5YC 5C09D 5IVOA 1QA9B 1GZQA 3U1SL 3TNNA 4X6CB 4DVBA 4I0PC 3RDTA 3LEXB 4G6AD 5CZVH 4KKNA 4KXZI 4UQ3A 2HT3D 3I75A 1U8JB 4K8RL 3PUCA 2H1PL 4NHUB 2I9TA 4KV5E 3O6FD 5BS0D 3BPCA 4LCCA 3JTTB 1NKOA 2EDEA 4MNQA 3HI5L 3RWJB 3MOQA 1BECA 1CCZA 4PG9A 1EO8L 1I8LC 5D6DC 5TPWH 4MS8C 3VFUB 2X05A 2R56H 1FVDB 4Y16A 1N6UA 5E9DA 4EOWH 1CFSA 1TPXC 4Q9QH 4GMTH 5E7FA 3CAFA 5HYFA 1UM5H 2ZUSA 3QFJB 2Q20A 1KCUH 2CGRH 4EN3C 1QBBA 4GRWE 4PJIE 2IQAB 4AT6A 3FCTA 5GJSH 4CNIB 3KPMA 3AC0A 3MNWA 1KG0B 4WWKA 2ZOKA 3V5DB 1FGVL 2Z31B 1IKFH 1QSEA 5JR1H 3MLTA 3L3DA 1IEBB 4YHOL 1NJ9B 4Y5YA 3ZE1F 1WFNA 2Z4QB 4DFHA 3ARWA 4H20H 1DBKL 1NFDB 4EEEA 5JW5A 1A64A 3U46B 4I3RL 5JOEA 3F7QA 2HT2C 4P59L 1WWCA 4GW1A 1U8HB 1L0QA 5F7EH 2J88L 1LO3H 1T04A 3U6RA 3B3IA 3VJ6A 4MCZB 3LAFA 2VLKA 4E9LA 2RB8A 1I8LA 5D6DA 2R2HB 4QGTA 3I84A 3AAZB 2FL5B 1P9MA 4LQ1A 5GS1B 5I74C 1MREH 2VLRE 5GS0C 5IVXB 5GRWA 4EN3A 4LSRL 1R5WA 5HYJE 3T1WA 2CUMA 4S0TD 3OKOB 1NEZG 2G60H 2P43B 1KGCE 5FHBH 2I25N 3OPZH 5SX5K 1QFWI 3D9AH 4XWGH 5D8JH 2R8SL 3KGRA 2X4UA 2IGFL 4ZPTA 2X40A 3FTGA 3IGAA 4HS6A 4XNYL 4YC2C 4X9HA 4WCYH 3TJHC 2CIKA 4KWUA 3C6SA 5CHNB 2LTQB 1YEEL 1C5CH 4G6KL 1EMTH 1MAKA 3QWOA 5FM4A 2VLRD 2NXYB 5HYJD 5EBWB 4TRPL 3T77A 3EOBA 4FP8L 1KYOJ 5J11B 4ENEC 4KKAC 4U1GC 3U0WH 3UYOD 3LN5A 4KMLB 1KGCD 1ND0A 1SEQL 1TVBA 4C4KO 5I9QB 3U36B 3HI6H 2EE9A 1I8KB 1U36A 2W92A 3TVMD 3HCVB 2XXMB 3F5WB 4TVSa 5DUBA 3CFEB 4TVPL 2H9GB 2WINA 1MHCB 3KJ4C 1ORQA 5EB9A 3T0EE 1MJ7H 4AEIH 5IIEA 2F19L 3KPQA 3GSXA 3HAEB 4BFBD 4XNUH 1JFQH 3RY4A 3FN0H 5IMLA 4GQ9L 4AENA 1RPQA 5E00A 2GIYA 3WHXA 5MP6H 5JDSB 4NNPH 2OI9C 4G5ZH 1T7VA 1U92B 5MEOA 3CVHL 2YD2A 2P24A 4JM4H 4PB9H 1QD0A 1N6QL 4P48A 2K1MA 3R1GH 1YPZA 3QYCA 4HX1A 4ZXBD 2HTLC 3NFSH 5DD6B 3DMMD 2A74A 1UCBL 3VXNA 3T0ED 2WP3T 1G7PA 2FO4A 4KK9D 4H25A 1VKXA 1JL8A 1TJHL 1B90A 4MJ5A 4JDVB 1CF8L 5I1KL 4HGMA 3QB7C 2O5ZH 1CBVH 4HKXA 1I1RA 1T7YA 3NPZB 3DETC 1OQXA 3RL2B 4S1SH 3MJ9H 4IIQC 5J9PB 3WO4C 5DJ8A 4F3FB 5EDXA 5GRJH 3VH8G 3F62A 4HH9B 4NWUL 4WEBL 2DTMH 1OWRM 1CFBA 1ZHNA 2BSSB 4JFPA 1NCCL 1JMXA 1NGYA 1MCPH 5CD5D 2I60H 1Q0XL 1CXFA 1K8DA 2ERJC 1HWGB 2XN9A 4L8CB 4Y2DC 4QHKJ 1F4YH 3BGAA 5KSBB 4JFOB 4K7PX 1FL5B 4DVRL 1XT5A 3P77B 5L0QB 1CLCA 3K3QA 4PJAB 5B8CC 1SM3L 3PWPA 1KJ2A 3MQIA 1NL0L 1G9ML 3C2AH 1SYVB 1C7TA 4NNYB 4OD2B 5SV3A 4Z6AT 3MGTA 1QPXA 1U2HA 2PXYD 3DXAD 5F7UA 4UUJA 4NPYB 3C5SB 3HZMA 4HF5L 3ES6B 1XF4B 3SDCA 1RIUL 5BXFA 5BV7B 4AIOA 2E8ZA 3HKFA 3LZFH 4X4YA 3AGVA 2RGSA 2YBRA 2D2OA 1AJ7H 5IEHA 3VFRB 4Z8FH 2B1HH 3B6SB 3HG1E 5TGBB 2E7MA 4MCYB 1AHWB 4NSKB 5IJVA 3LH2H 1XR8B 5C0FA 2A0LC 4RISL 5HHOA 1WIOA 1YN6A 5D7LE 5DJYA 3HNSL 4V1DA 1MWAL 1FVEB 2MQ3A 4CKVX 5LGKA 4IIQA 5IB1A 2FGWH 5TH2B 4NDMA 4PJBB 5CJ5A 5C0DB 3GI9L 2CKNA 4U1LB 1MFBL 5LJYH 4RX4A 4U1IA 2CH8A 1T2XA 3RUGB 1L7IL 3CCHB 1HSBB 2J5LC 2GCYA 2OJZH 1AE6H 1X5IA 3MBXL 3QH3B 2A1WH 2VDPH 3BOVA 5DMYA 2CKBL 3OXRA 4F9LA 4OI7A 3ZYZA 3PWUB 4JQVC 5F72S 1KC5H 5FO7B 5J12B 3NIFF 1XGPA 1KSRA 5HPOA 3HG1D 4OF8A 1JPFA 4DTGL 1U3ZA 1FNAA 4YZFF 4ZQKB 4PJ9B 4U1KB 3SCMB 4KZEH 2ADIA 5D7LD 1QSFB 4ZFFA 3S36H 4F8QA 5IGXL 5IR1A 1IC4H 4CVWA 2APXA 4NQEA 3IDMB 3O3AA 1OHQA 3C09C 2B0SL 3QXTA 2E27L 4MQSB 1RZJL 3VMNA 4JFZH 4IMKA 1UYWH 3DNKA 1ITBB 1IC5H 4FTVE 2FLBT 5C0JA 1TQBC 4NN6C 3O9WC 3IU3A 4HWEL 3U7WH 3GRWA 2ORBL 4HFWA 1DUZA 3RHWK 3QQ3B 5CZXD 1A6WH 5CAYB 4X98B 4HCRA 4N8VB 4UDUA 1EO7A 5DF0A 3SKMB 4P5KB 4Y5VB 1AY1H 4PJGB 3UTTE 3O2WL 5J06A 4OUOA 4UT7H 4P2CG 2NNAA 3DROB 3O6LH 5A1AA 4KH2A 1WVZA 4QYOB 3L7EA 3CXHJ 5FIEA 3RNQA 2A83B 2OR9L 4WFEE 4I77H 2ZG3A 4N1CA 4JQVA 5F9OL 5HPMB 4JRYA 3EJZC 4FTVD 4UU9A 3ZYOA 4A6YL 2VLJE 5C92A 1OAUL 2IC2A 5CSZB 1QFHA 1EXUB 3P2TA 1BGXH 1LEGA 4JPKL 4YPGA 1BFVH 2DWEB 4O02L 3NA9L 2QQNL 1PEWA 5CSGA 3EOAB 4YX2L 5JLZA 5C9KA 1CFTB 2W0KA 1IT9H 3MROA 1L0YA 2VH5L 3REWA 5J6GB 3UTTD 4YHKL 1JNNH 1MI5A 3FB8B 4RMTA 1DBAH 3O9WA 4ZUWB 5I76B 3FL7A 1P5UA 3ZTNL 3CIQA 1RZIB 2E6JA 1D6VL 5INDB 4ODXB 1YEDB 4WFED 2W9EH 4QGYA 4O2CA 1RURH 3DHJA 5H94A 4HIHB 3TBYB 2HN7B 3B9KB 3RZCD 2VLJD 3G6AA 4HWBL 3FFCE 4OZHE 5IFAH 1CFQB 2NLJA 4JY4B 4NO5A 2JIXA 1AGCA 2KUTA 4LF3A 4XP1L 4P2RB 3QZWB 3ARDB 2OTUB 3W11D 2VXUL 1YYML 1G0DA 2CRMA 3MBEB 4ZS7L 5H35B 2WM0A 3D3VA 1LO5A 3SQOH 3IAPA 3BWAB 4XGZB 3EBAA 4IHOA 4JPIB 1JPGA 4E0RA 4YXLL 5IUSA 1LO0L 2IMNA 3BQUC 3PIQB 4N0YH 5I1HH 4GRLC 1MFDL 3TO4B 3FFCD 4WHYG 3RGVB 4JREB 2X9WA 2AXFB 2FWOA 1WISA 2Z31C 3MPCA 5JORB 5C0BA 3SGJC 1U58A 5JQ6L 4KQ3H 3LN4A 2ED9A 4FABL 4OBRA 3SGEI 3TA3D 3G08B 3T3PF 3WDIA 3LEXA 4HJ0C 2EIDA 1U8JA 1TZIB 4KRPD 4Z7UF 4MA3B 4XCNB 2X4RB 5HVGB 3W82A 2VDKH 4QTIH 2E3VA 5KTEL 2C3WA 4S10A 3S98A 3ULUF 3JTTA 4JKPL 3PGDB 4ONHB 5FGRA 1MPAL 3S88L 2IANE 3RWJA 1JRHI 2FEDD 1U8IB 3GSWA 3QEGH 3VFUA 1M7IB 5I1EL 5ID0A 3BH9B 3N85H 4YHZH 1FLRL 3BKCL 4XHQA 2D31A 1C5DB 3V4UH 3PHOB 3QNYB 5DD5H 5GS1C 4NQDB 4U0RB 3BQUA 4HLZG 4JN2B 1ZMYA 4GRLA 1RUAL 4CNIA 1JNHB 4UBDC 1KG0A 2E6QA 2X7LB 3BDXA 4RSVA 1BIHA 2Z31A 4LK4A 4P5TB 5D6CB 3SGJA 4PRPA 3HMWL 3MJGX 4ODUA 2AEQH 5FV1L 1IEBA 1I7TA 1NJ9A 4TPRL 4HXBL 4UV4L 5KVFH 1QACA 5JW4R 1MCJA 1CN4A 2HJLB 3S96B 4YPJA 5T1KD 5DMGC 2YPVH 4OFIA 3IJSB 2GW5A 4MGXA 1IGML 3WKNA 1U8HA 1NEZB 5ETUB 4LHUG 5IESH 4MCZA 1I1AD 1VEPA 4TN9A 2HRPL 5J11C 5L2JB 2R2HA 4G7VL 4PGEB 4JHAH 4XMLL 5CEYB 1P4BL 5GRUL 2NQCA 2NY0D 4WU7B 3NH7L 3U4EA 1C16A 1BVKB 1XGYL 3D18B 5ICXA 1S9VB 2F58H 3AAZA 3B9AA 2FL5A 3HUJF 5GS1A 1KTRL 3TN0D 3W0WE 1BVLB 2YUWA 1ODAA 1EVUA 4UMGA 4UTBL 4BELD 5E08H 1MCNA 1CLYL 1VFOA 5T1MB 4WFHE 5JXEA 3W9DB 1E4XH 4L1DA 2PKDA 4UDTB 5GGQL 1AC0A 3PQYB 3ZT6A 4WTZG 3CFKB 5K9OA 3ARUA 3NCYP 3IVKA 1CE1H 3UTPE 4UAOB 3NCCB 5HI5D 3TT3H 2AK4E 4P9HC 3EYQC 1KENL 3HC0B 3T08A 4NQSB 4FQLH 4LDOB 4PJ8B 3U79A 2VQUA 1T89A 4WI4A 5CILL 5KZCD 4XAKE 4POUB 1T1YB 3NFPA 3VFSA 5GZOC 3TYFA 2YMXL 4KI5E 3W0WD 1AXIB 1OWWA 4MA8H 5EBWA 3QIUB 5IVNA 3N50A 3CFCH 1ZVHA 4TOYL 2ZCHH 3WLWC 3B5TA 1R6VA 1MWAB 1ZA3B 3U36A 5IQ7H 1I8KA 4JFEB 3SDXB 3HCVA 2XPGB 1MAML 4YBLC 3KLHC 3CFEA 3UTPD 4QWWD 2AK4D 4ZUTB 3B5GA 3MGOB 1KLUB 5DHVB 4MWFB 4LKCA 2CKBB 3JWOL 1XF2B 4ISVB 1H0DB 3ULVC 1M1SA 2NZ9C 4XAKD 3GMRB 1N8ZB 1Z9SA 4GSDH 4WJ5B 1X5XA 1F6LL 3WJLC 2EDLA 5JDSA 4WU5B 5A2FA 5K9QG 5L0QC 1BMGA 1IGJA 4Z7WF 1U92A 3F7YB 1MFEL 5DVNA 1J8HA 3BMVA 1YNKL 1HILB 5D93C 4JN1L 1OAKL 1QBLH 3V0VB 1HCFX 4M9PA 5DD6A 5HDOA 4OLYH 5GXBB 4J4PC 3WIHA 2P5WB 3CPLB 1OAQL 3CLFL 5HJ3B 2KBGA 1BZQK 1ZANH 2MKLC 5AWNH 1AHWC 4C59B 4JR9L 4PJDF 5CIPH 4D9LH 4K3HA 4JEGB 3UMTA 3MJ8B 2H45A 3EO9L 3RL2A 5IW1B 5CWSA 4F3FA 3WFDH 3RTQD 3AB0B 4HH9A 5J1SC 3QUXD 4KVNH 4CN4A 2MSPA 5DRNA 1HNFA 4XMKH 2PCPB 5CP3A 3QRFM 4ZDHB 4L8CA 3EDDA 4NO0A 4WI9A 1K8IA 2P8MB 5KSBA 1JNLH 4A6YB 2UV3A 4FZEL 1FL5A 5HGBA 2DS4A 2NY6B 4PJAA 3NOIA 5ADOH 3SHSA 4ERSL 5J12C 3OB0K 1SYVA 2V5YA 1ES0A 3EOTL 4NNYA 2E7LC 1MJ8L 4OD2A 3NAAL 3G5YB 1S5IL 1JUFB 1GRWA 1DANU 5IB5B 1MHEB 4JQIL 1CZ8H 4NPYA 3C5SA 3OGCA 3KJ6L 3SCMC 1B4JH 1FCGA 1XF4A 5B3NA 4W68A 2YZ8A 1ZLSL 4O58H 3AFLA 4KDTC 3KLAB 3LB6D 3QXWA 5D5MF 3VFRA 2F5AL 1C12B 2N7AA 3B6SA 5TGBA 4ELME 4MCYA 1AHWA 4NSKA 2FD6L 3DI2B 3VXTA 1B9ZA 2PR4L 5E1HB 3VWJC 3V0WL 1FVEA 5T5NF 4K8RC 4LOUC 5TH2A 4JGMA 2DI7A 4NJAL 4G6MH 1T0MB 5C0DA 5A2JH 5JOPE 4U1LA 1GZPB 2DYPD 1JIBA 4R96B 2WSKA 1HSBA 4YQXH 4M5ZH 3PGCA 2FX7L 3DYOA 1EFXD 3CMOH 1RZFL 3PWUA 4OTXH 4L4TB 1ZT1B 5FO7A 4JJHA 4FQ1H 4GFTB 4HMDA 1T1WA 3ALXA 1FRGL 4K3GA 1YY8B 3K4DA 3QT2A 4ZQKA 5FCUH 2LQRA 4U1KA 3SCMA 5F89B 4XBPB 1AR1C 1QSFA 2VZVA 2XZZA 4LVEA 2PYEB 1OAYH 1LILA 3DUSB 3IDMA 1AXSB 1WWAX 2ED7A 1NANH 2J8UF 3GM0A 5JOPD 4M7KL 3UTZB 1VGKA 3AM8A 3IDGB 3STLA 5JW3H 3UJIL 3ULUC 1IVLA 4FQXD 5K59F 4K7PL 1CICC 3VWJA 2X9XA 1A1OB 4HPYL 1PG7X 3SKMA 2JJWA 4P5KA 4XCFH 4Y5VA 4PJGA 4X9FA 1OARH 1OTSC 1U3HB 3B9KC 3H2WA 2O5YH 1MFAL 2X44D 1WTLA 1DDHB 2WP3O 4ZD3L 1WK0A 2WBJB 4HZLB 2MHAB 2Y9RT 3PJSB 2A83A 2YD3A 4JO2H 2XZAH 1IAMA 3EDEA 1KN4L 4YE4H 4FG6C 4JZJB 4KK6C 1FC1A 1UXSA 1AIFB 2CUIA 3MGAA 3UEZA 4DK3A 2DLHA 4RFNC 3KPRB 1PD6A 2E9IA 5ISZE 1EXUA 1G6VK 1ZTXL 4LPXA 2RCSL 3MBEC 1TTUA 2DWEA 5IHBA 4YBQC 3SDDD 1CFTA 5J6GA 3K1DA 4OQ1A 5E70A 3FB8A 4KMTH 5I76A 5F93C 1OW0C 2D3VA 2F54E 5FOBA 1T7ZA 3RGVC 2W59A 1RZIA 2RBLA 3O3UN 4HC1L 4ODXA 4OM0H 5INDA 3T4AB 2FJHB 4UT9L 5CEZE 3BPNB 1H15A 3V6FB 5FM5O 5FA3B 3QI9D 4HIHA 1LDPL 3B9KA 4JO1H 4H8WC 4L3AA 2KDGA 4PGDB 2P1YA 5ISZD 1CFQA 4PJCF 1GPOL 3AY4C 5CCKL 5GS0H 4ZFGH 4Y4HD 4IRJB 1FH5H 2D7QA 1HKLH 3QZWA 2AI0L 3ARDA 1HINH 4DN3H 5MI0C 1OSZB 2R69L 4EI5D 3ALWA 1A5FL 3MBEA 4WUUE 5ITBH 5HVWA 5T33H 5CEZD 4JHBA 1KB9K 3BWAA 5IV2A 4JPIA 5D1QD 2FBOJ 3QR2A 5DVOA 4U0RC 1X5YA 3RVUC 1D9KD 5TDPB 3FO0H 5I17A 2F8XC 1KBGH 5D1XD 1OW0A 2CMRH 4LFHD 3RGVA 5CSBA 4G42B 4I5BB 2AXFA 5JORA 3MRQA 3OKMB 1REIA 4S2SA 4D0BB 4WFFE 4KXZH 5J1TC 5DVMA 3TM6A 1G7QB 4LBEB 5DD1H 3G08A 3MLZH 5HI4C 2V2TB 2R2BB 2FIRT 5L2KA 4GXVL 4LAQH 2YPKB 4OIIH 3FQWB 1TZIA 1CL7L 1QNZH 4MA3A 4XCNA 4WUUD 4LASL 1A6ZA 2X4RA 2RR3A 2IPTL 3AY4A 4PP1D 5I8EB 5EZIL 2R4SH 4ONHA 3PGDA 1NMBH 1GGIH 2YWYA 2W91A 5ECJE 4LARL 1U8IA 1YQVL 3AREC 5FYKE 5EIQA 2V2XB 5EU4B 3MV8E 3BH9A 2A77L 4FFYL 1C5BL 3DO3A 2OBGA 1H5BB 2AABL 1AXTL 3QNYA 4WFFD 2W60B 4NQDA 4JN2A 4LPWA 1EGJL 1A7QH 1E4WH 1KJ2H 4X7FC 2VB5A 3KXFD 2X7LA 4LHUB 4P5TA 3OKYA 2VZOA 4Z77A 3VXMA 2YD1A 3FQRB 4FFVD 4KRMB 3IRPX 5C9JB 1G9MC 2DMBA 2WNGA 4NKMB 4U2ZA 3RBSA 5EBMB 3CVHA 4OFYD 4RZCB 4UAOC 5CJBA 2HJLA 5J3HD 5FYKD 4CW1B 2MWCA 4L1HA 1KJ3L 3MV8D 3IJSA 4PJ8C 3QDMB 1H3PL 3O8XB 4G8GB 4GAGH 1MJJB 2BOBB 5ETUA 4L4VE 4MHHG 2DDQL 5JHLH 3VW3H 1DFBH 4NCC2 2R2EB 3PE9A 3S8WA 5L2JA 3AREA 4HUWA 2LU4A 4X6DB 5AZ2L 4PGEA 4LCWB 2DTSA 5BOZG 1QFOA 5GGVL 4WU7A 3D2UA 5E24E 1BVKA 3GMPB 4XI5C 2DI9A 1S9VA 4OZGF 1BF8A 2Q7YB 4EIGB 1BVLA 2A9ML 3EYSL 2EKJA 1PKQB 1U42A 1G9NL 1F3DJ 2MFNA 1EHLL 5T1MA 1QFWH 5M94B 4Y2OA 1NMAL 3W9DA 3T2NH 5KVEH 4OLWH 4UDTA 1JGDB 3PQYA 4L4VD 5C0NC 1Q72L 3V4PL 3A6OA 5D7KE 3B9DA 3LQAH 2J4WH 5DEZA 5I30L 1EBPA 1RZ7L 1IAKB 3BIKB 4X80H 2AEIT 2CXGA 5JTWA 3VDAA 5TF1H 4PJ8A 2VZTA 3Q1SH 5EU3B 5L8LB 3GRWH 3OJDB 4XVTH 5DUPL 1NCUA 3QHFH 1RZJC 2NXZC 1KIQA 1B88A 1XZ0A 3MRRB 4HIIB 4TULL 1VACB 2AQ2A 4L8BA 3OZ9H 5T1DL 2NY3D 4KAQH 1SYSB 1DVFB 5DD3H 5I1GL 1MWAA 1QKZL 4JFEA 3VGFA 2GFBB 3DVNB 3SDXA 2EZ0C 5DJZB 2XPGA 3O11B 4UB0H 2VWEC 2WLZA 5D7KD 3VFTB 4ZUTA 2F53E 3W5NA 5SWSB 1DEEB 1KLUA 4IDJL 4MB5A 2DBJA 4MWFA 2CKBA 3VGGA 1NBVH 1XF2A 4ISVA 1H0DA 3ZHDA 2DQGL 3GMRA 1N8ZA 4QOKE 2AJSL 4WJ5A 5TDOB 2CPCA 4X4XB 3VDBA 5D5MA 3UC0L 4KTDL 2Q76B 2YZ1A 2J2ZA 4RMUA 1E27B 3F7YA 3QBTB 2DQCL 3THML 3GSVA 5JXAL 3WHE0 3P9WB 3V0VA 3QAZC 4ORZC 3MX0A 1P84J 2HT4D 1HH6B 3VH8A 4DZBB 2F53D 3MO1B 2ZJSL 3LHPL 1IARB 2P5WA 3ARBB 2DLTA 3CPLA 5KG9A 1MRCH 3KYNB 5HJ3A 2VQTA 4LCIH 1SVZA 3ZO0A 3E3QC 1MNUH 4EUPA 4QOKD 3HNTH 1F2QA 3D39B 1IQWL 4QCIB 4Z7QE 4GBXD 4XT1C 4ETQB 5T3XE 4WW2B 2PTVA 5IW1A 4AL8L 3C6LB 5JPNB 1M05A 3PP4H 2PCPA 2B5IB 4FN0A 4ZDHA 5C0AB 4X8JB 5HHVH 3HFMH 2CRZA 2APFA 2J8UA 3HPJA 4A6YA 2HLFD 1WIPA 2CK0H 3FO1B 4YO0B 2VLLB 1ZEAL 3TH4T 3G5YA 1JUFA 2HLAA 4O9HH 1RUPL 1R3LB 4PUBL 4ZAKB 5T3XD 4TTDD 3DX9B 1I3GH 5LGHH 2EIZB 4UIMB 2NY5L 4F7PB 1T5XB 3FOMB 5E2WH 12E8L 3U0TB 5JDJA 4LRIC 5HYQB 2XQYG 3S3SA 2IBBA 4N0UE 3LY6A 2AJVL 5L8KB 2E7HA 4HWBA 2AJZB 4LLYB 5LAXB 2GT9B 1R3JB 5IFJA 3OKLB 4ONGL 1RFDH 5JA8B 4APQD 1S9YB 1UWEH 1D5ZA 1FAIH 4R96A 1IMHC 2WBJC 2EC8A 4XTRD 2C9AA 2DN7A 3CZJA 3RAJH 4L4TA 1ZT1A 4JZJC 1YMMA 5L7XL 3UZEA 4I8DA 5EOCL 4WWID 3PDDA 4YXKL 2Q8BL 1YY8A 4J7RA 4YHMH 2OK0H 1BOGB 1CFVL 3KYMB 4QRTB 4XBPA 1MCKA 1FP5A 2PYEA 3TV3L 4POYA 1AXSA 5L9DL 4LEXL 4RGOL 1DLHA 2ZWLT 4HW6A 2QQQA 3K4AA 4PJCA 4QXTA 3UTZA 5I66A 3IFOB 3IDGA 3LQZB 5CBAA 5IMMB 4URTB 4PPTA 1VDGA 4GAYB 2VDOH 2D4DA 1A1OA 3ZSTA 4XP9H 1KELL 1W0YT 3N0PB 1U8QB 1NC2B 4PS4L 1MEXH 1WJ3A 4G6JL 4ODBD 4CRPA 5FYJE 2QR0B 3TC9A 1DDHA 5SWQA 2EC9T 2WBJA 5IWLA 2MHAA 4MA1B 2LAAA 3JWNC 3PJSA 4RAVB 3PWNA 2CDEA 5GGRA 3SKJL 2C4FT 2NYYD 2JCCB 3SKNB 4JZJA 4RFOH 4AZ8A 4J1UB 1K6QH 1RZ8B 1DQDH 3OB0H 5L6YH 1T1XB 5DEGA 4JCLA 1Z9LA 4FXGB 2COQA 1WBZB 3UTSE 4MXWL 3TP4A 5D70L 2Z8VC 5GSRA 1K4CB 3EFFA 2ESVE 5EIIB 3GKWH 4WI3A 1RHHB 1KJMB 1RIHH 2OQJB 1S7RA 3WUWG 2VXSL 5DK3A 4HULB 5FYJD 3SO5A 3TGXA 1BQLL 1XGTB 2R0WH 3QEHA 4FZ8L 4P9MH 4PFEA 5TE4L 4H1LG 1T2QH 2XWJB 1KTLA 1KN2H 2FJHA 3T4YB 4MXQC 1A8JH 3FMGL 3V6FA 5FUZL 3BKJL 5FA3A 2X1XR 4U4BA 1KACB 1AFVH 1P7QB 2X89D 4OIBA 4LNRA 3N1MC 4WTWA 1KCVH 3L3IB 4XPTH 4PGDA 4LSQH 4R26L 4JO4L 4E5XB 3UTSD 1KFAH 2ESVD 4XC1H 3IKCA 2F15A 3LS4H 4G43B 3O6KH 4IRJA 4TQEH 2H2SC 5K9QI 1FGNH 4JRXB 2D03H 4XCCH 2DM7A 3RWIA 3T04D 2VQ1A 3WUZA 5JNYB 2VN4A 5IB2B 4MJ6B 2VR4A 4GG6B 5E4EB 3QP3A 4DQOH 3S5LA 1E6JL 4U7KA 5DURD 4XVUD 1IC7H 2DQUH 2XA8L 2BNRB 1PG7L 1KPUB 2J7LA 3JWOC 2ICWJ 2NMSA 4Q97A 4KJWD 2Y23A 4P9HH 5EFIB 4ZFOL 3WIIH 1GOFA 1I7ZB 4U1SB 3HE6B 5CZVL 1HQ4B 3EFDH 3KPSB 4G42A 4IOSD 5ALCH 2FR4A 2JKXA 3OKMA 1ZXQA 5DC0A 4F7MB 2V17H 3HMXH 4G80B 3RQ3A 1NDMB 3S4SG 1G7QA 3K2UL 4LBEA 1LD9B 2R2CA 1EK3A 2V2TA 5I19L 2XV6B 2YPKA 3FQWA 5AYUH 1QR4A 1L7TH 4OLZL 5GHWH 4WI2A 4EOWL 1CGUA 3O8XC 3DX7A 5I8EA 5AYQA 4DAGH 4Q9QL 3MRHA 4ORGB 4HWUA 1UM5L 5IOPA 3U0PB 2CGRL 4R2GD 25C8L 1RAMA 3G6JB 4BZ1L 3PP3K 3S34H 5EU4A 2YSSB 4PGZA 4JQXC 5I1IH 3M17B 2Q3ZA 5CP3H 5JR1L 2H8PB 1IQDB 2W60A 3MODH 3WMSA 4NM8H 1LP9F 4OZIB 4KKBD 4H20L 4LPTA 5C8JA 4LHUA 2G5RA 3QDGE 4BZ2H 1UFUA 4GMSH 2HVJB 5C0CB 1DQTA 3FQRA 5F7EL 5EC2B 5C9JA 1Z2KA 4NKMA 1GHFH 2V2WB 2BMKB 2APWA 2DQEH 1KB5L 2IH1B 1D5IH 1HYSC 3B8SA 2BNQE 3QDHA 3QDMA 1SEBB 1GCFA 4HV8B 3O8XA 4G8GA 3BI9X 2BOBA 3MRIB 1MREL 5KAQF 3MV9B 1KCKA 4X6DA 3UCRA 4LCWA 4WTZA 2FEEI 1YC7A 1DVFC 5BO1H 3ZTJH 1EVTC 4JQXA 5EA0L 2AJUH 3GMPA 1NCTA 4XWOC 3D9AL 1JGVH 1ORSB 3NCFB 1RZGB 5D8JL 1MCDA 3P0VL 2Q7YA 3VXPB 1PKQA 3EO0B 3SO3C 3HI1A 3O2DH 15C8L 4QKXB 3QUMH 2BNQD 1W2KT 1WCBB 4JY5H 5IW3A 2O61B 2X4SA 2XTJE 5B21A 5MENB 4HKZB 1C5CL 2BRRL 1JGDA 5FGCB 1EMTL 1NC4B 3FFDB 3MXVH 3RVWC 1N64H 3T0AA 3UAJC 3AS3A 3I6KB 2C7UA 2DQTH 1HIML 4E41E 2DMCA 1IAKA 4JFDB 5FK9B 1JPST 4KQ4H 3ORJA 3WFBH 3T2PA 1BIIB 1MLBA 3BVNB 3UJJL 4KPHH 2KKQA 3OJDA 1J05A 3U7AA 5C6WH 4KFZC 3U1SH 5E2TH 1Z5LA 4DUWA 3MRRA 4HIIA 4K8RH 2MCPL 5ILTL 1GAFL 2AJ3B 3V4VH 3GIVA 1ZGLM 1SYSA 1CXIA 1DVFA 2FGZA 3O0RH 1CL7I 5KS9E 4XXCA 2VAAB 2XTJD 4XNUL 3HI5H 1BD2E 2GFBA 3DVNA 3VGBA 5DJZA 1GYAA 3FN0L 3O11A 2HG5A 4OGZA 4MX7A 2FATH 4ZO9A 3VFTA 3TBSB 2QQKL 4E41D 5SWSA 2CDGB 2DICA 3VE0A 4G5ZL 2OMBA 1V3MA 3QDJE 4W81A 2BVUA 5IJKC 3PWVA 4Y7MA 3R1GL 1NGWB 3LCYA 4PRBB 4X4XA 5TDOA 5EN2B 5J8OA 4KV5F 5C07A 4I1NB 3EYVA 4PJEB 4LDLB 2WBKA 1EZVY 3I9GL 3IAQA 5BJTB 4YHOH 4K55A 3WNMA 1V3LA 3ULUH 1BD2D 5E5UB 3VFVA 3MRMA 4FQIL 1HH6A 2BCKB 3OAYK 4DZBA 3LDBC 1CBVL 3ARBA 4YR6A 1M4KA 5DZLA 4S1SL 3KYNA 4P59H 3OAUH 5CJOH 4GRWF 5I6XC 4PJIF 2DTML 1MCPL 2CIIB 2I60L 2ICEB 4NC1E 3QUYD 4XVSL 1J5OH 1B0GB 5HVFB 5F7LB 1YMHB 4I18C 3C9NA 4I48B 1WITA 5JPNA 5E8OA 32C2B 4S1DD 1KIRB 4PD4K 1FFOB 5C0AA 4QHLB 1S3KL 1LNUB 2E9BA 1J0IA 5HI3C 4LVNB 3NBNA 2ZOLB 3QNXB 3MREB 1UJ3B 1PEZA 3FO1A 3MRCB 5EOQL 2VLLA 4X5XB 2B1HL 2L7JA 2R8SH 2EXWD 5FYLD 2IGFH 4G9FB 1R3LA 4XNYH 4RDQG 4ZAKA 1YN7B 2M8XA 3RNKB 3BN9C 3DX9A 4J3OC 3IDYB 4UIMA 3K8KA 4UOW0 5F6IB 3BZEB 1T5XA 4HC1A 3FOMA 3U0TA 5JW4M 4H8WH 3UXFA 5HYQA 2ZUTA 4TRPH 1P2CB 3I02B 2YUVA 1AE6L 1A0QL 4OF5A 4DGVL 1BQHG 1SEQH 4I18A 5BZDB 3DVGB 1J1OH 5LAXA 1R3JA 4HK0A 3OKLA 4NKOB 4P2QE 2HAZA 1OGAA 4I2XE 3C87A 4TVPH 3EJYC 1WZMA 4NN7B 2GJ6E 3DRQB 4KZEL 2VKWA 5CMAB 1UM4L 5LBSL 1QZ1A 1IC4L 2HWZL 2X4TB 3QIBB 4JFZL 1IC5L 4GQ9H 5AAMA 1I7RB 3TO2B 3KYMA 4BSVB 1YEIL 2DLGA 2JJTC 4ZFOB 4QRTA 3VRIA 4MHHI 1A6WL 4OT1L 1ZSDB 3U9UA 3CVHH 1ZOXA 3TFKD 1N6QH 4P23D 4P2QD 4M1GH 5T1LB 3G5ZB 3V6BR 5IT2L 3FO2B 2VYRE 3IFOA 3KVQA 2C1OA 3LQZA 5CBEB 3RWFB 4Q0XH 2GJ6D 5IMMA 4HKJA 3O6LL 4HIXL 3FT3B 4GAYA 2C3VB 3CFDB 4HKBB 1TJHH 1U8QA 1YZZA 5LVEA 1NC2A 2JJSC 3ZL4H 7FABL 2QR0A 3J7HA 4RCAA 1ZLVK 3WUWB 3MXWH 1BFVL 1ZS8A 4IOFC 4WEBH 1PX4A 3SKNA 1H3UA 1IT9L 3UP1A 1NCCH 1RZ8A 3D0LB 3U82B 4UOJA 1DBAL 4FXGA 3C5ZB 3I3BA 3QIWB 2JJTA 1EGJA 1WBZA 3IDJB 5E4EC 1M7DB 1SM3H 3L3GB 1S7TB 2C1PA 3WE6B 1NL0H 1G9MH 4R4FH 5EIIA 4WO4D 5DMIL 1QSVA 1XH3B 5I2IB 3VXRB 4HF5H 3HE6C 1RIUH 1SBSL 1OT2A 4N0CD 1KB5B 1GC1L 5IFAL 3ARGD 1CD0A 4F7CB 1ACYL 2EXYD 1AGBB 4PRHE 1CGVA 2JJSA 4M7JH 2BXYA 4NN5B 3IJHB 5F7WC 3L3IA 4KKCD 1UB6B 3VXSA 5HYSB 4E5XA 1IBGL 3SDAD 5A3IC 4NQCD 1HHIB 4YGAB 3U9PL 4V2CB 3SQOL 4G43A 3GI9H 1OAZL 4AM0A 4X6FB 5JNYA 2DIAA 5JMOC 2CKBH 2IJ0C 4J3VA 5IB2A 4MJ6A 4GG6A 2P8PA 3S4SB 1T1ZB 3MV7E 3BT2L 1RU9L 3GSQB 1KPUA 5EUOB 4U1JB 1MH5A 4PRHD 3EYFA 5EFIA 1A3RL 4ZOCA 5CEXB 4ZSOE 1I7ZA 4U1SA 3N1FC 5D2LB 3HE6A 1T66D 3ZKND 3KPSA 3O4LA 4G6AC 4R8WL 5IGXH 1OP3H 3O6ML 4M3JA 1YC8A 1RZJH 3QNZB 4PLOB 4F7MA 3KPNB 4G80A 3OG6B 1NDMA 3O6FC 3CVIH 2VOTA 1G9EA 4HWEH 1DQJB 1LD9A 1NMCB 2ORBH 2UWEB 5FHAL 4NHCL 4MD0A 3QEGL 3G6DH 4I4WB 5GPRA 3R06B 4YHZL 3MV7D 4EUPH 3L5XH 3SJVA 4B5EA 5C0IB 3O2WH 1A7OL 4ORGA 4PGBB 1L6XA 2NCMA 3V6OC 3U0PA 3LS5L 5DTFB 2OMNA 1A6TB 3G6JA 4KZDH 2OR9H 1ETZA 2YSSA 4WFGE 1U91B 3LN9A 3M17A 3PGFL 5F9OH 1N7ML 4FNLH 1IQDA 4PRIA 2AEQL 5EC1B 4M48H 2K7QA 5KVFL 3BP7A 4U1NA 3HUJE 5C09A 4OZIA 3TPUB 2BSTB 4N5UA 4O5LL 4KROB 4HWNA 3ARVA 1OB1A 1T2JA 4JPKH 1WQVT 4O02H 3NA9H 2QQNH 4YX2H 2VH5H 2A6KB 4K3JH 2HVJA 5C0CA 1FJ1B 5EC2A 4YHKH 1ZE3C 3WN5B 2V2WA 3O6FA 4LFHG 4Y19B 4F2MB 2X4QA 1FYTB 5BS0A 3NCBB 4WUKH 1UWXK 2IH1A 2BNUA 5LWYH 3ZTNH 3HS0B 3WDHA 4JKKA 4R97B 1S7SB 1D6VH 1MUJB 4JHAL 4Y89A 2P44B 4WFGD 3IETB 4HV8A 2VXQL 2NY5C 2N7BA 2EIBA 2F9BT 4HK3J 2IAMD 4G8IB 3KS0H 4P2OD 3V6OA 2XG4A 3MV9A 2P5EE 4C55A 1AI1L 1P6FA 3LEVL 3IJYB 5KSVA 1E4XL 3ZMRA 3X3FL 1UENA 1ORSA 1RZGA 4X6BA 4HT1L 2Y5TB 4LEOB 3CDCA 1YYMH 2IANB 4GKZA 4OD1L 3NTCH 3VXPA 4L8SB 2ITDB 3EO0A 4DGYL 3BRDA 4ZS7H 3DPBA 4K71C 4GRMB 3GB7B 1WCBA 5M95B 2O61A 4QHNB 2YRLA 2FHCA 5DI8A 4YXLH 5MENA 1LO0H 4HKZA 4FQHB 1NC4A 3FFDA 4OZHF 3O2VL 1MFDH 1R3HB 5CD3B 2UUDH 3BUYA 3I6KA 2W07A 2Y5EA 1IM9D 4JFDA 1BHGA 2P5ED 5FK9A 5EWIL 3CFCL 5JQ6H 3Q3GB 3ZYJA 1BIIA 1U41A 2KH2B 3BVNA 4Z7WE 4FABH 4PJXB 5AAWA 2E6PA 5INCB 3L95B 1I4FB 3D85D 5MEPA 3WFHB 2FYYB 3MRPB 2AGJL 5CEZL 4WNQB 2FHBA 4Q6IC 5FKAB 5KTEH 2VAAA 4R7NA 3CUPA 4PB0L 4ZNEA 4UT6L 5CUSL 2B2XH 3VGEA 1NFIB 1KEMH 4OCNC 4PJDE 3TBSA 1K2DB 2CDGA 5GISH 2X4OB 2WWMD 4D2NA 1R3KB 5I1EH 1QEWB 4QO1A 1FLRH 3BKCH 3K8MA 4OD3L 1IAIM 1TMCB 4HBCL 1NBZA 1SY6H 1AKJB 1NGWA 4PRBA 1YUHB 5EN2A 1RUAH 4ZXBC 1VESA 4LVNC 3E2HC 3WD5L 3QUZB 4OLYL 5DSCB 4PJEA 1FNHA 3T0EC 1UJ3C 3HMWH 4KK9C 4WY7L 3RPIA 1ZANL 4TPRH 4UV4H 3DJ9A 4HXBH 4L4JA 5AWNL 3O3EB 4DUXA 2BCKA 3BDBA 4D3CH 4GUPB 1BJ1H 1VFUA 4OSUL 3PL6D 3OHXA 3IDYC 4QT5B 5JIHA 1IGMH 5F6IC 1OF2B 1S8DB 4UNTA 3SKUD 4KVNL 3RY5A 1OT1A 1UKTA 3P4MA 2Y06H 2ICEA 2HRPH 1IGTB 4G7VH 3L5WA 1MCQA 1P4BH 1W0VB 1YMHA 4WHYH 3H3PL 3NH7H 1X5FA 4I48A 1XGYH 3QO1B 4JFQB 4D9QE 1RZKC 4WHTB 5EO9B 3E6HA 4X99A 5KVGH 1I9EA 1KIRA 1FFOA 4YNYB 2PXYC 4P4KB 4NN7C 4QHLA 4AEEA 4UTBH 3RVVD 1LNUA 3MCLL 4PY7A 4O58L 3T0EA 1UJ3A 1X4YA 1HZHH 2XFXB 3H8NA 2R9HD 3MRCA 5GGQH 4X5XA 3VFOB 3UTQB 1BQHB 1TQCB 5LCVL 1KENH 5FM5M 3UTOA 3VA2C 1URLA 2H6PA 2YA2A 2V9RA 1GGUA 1DL7L 1AD9B 4HWZB 4R7DB 3BX7C 4L5FH 3EO1B 4G6ML 4MNQE 4X7DC 5GSVB 4AIZB 1KCRL 3OL2A 3I02A 3MR9B 4UV7L 4J8RA 3RA7L 4TOYH 4Q2ZB 3KDMB 2DL9A 5I16B 3V7AE 3NCMA 4WDIB 1MAMH 5JHDB 2PO6B 4LMQE 3CFBA 3RDTD 2VERN 4WV1C 1J11A 3B8YA 2H26B 5CMAA 3H9SE 3B2VL 1HQRB 1TJIL 1Q9KB 2X4TA 4MNQD 2VXTH 1Q9OB 1YNLL 2D0FA 1I7RA 3TO2A 2ITCB 3C5ZC 4RDQF 4BSVA 4ZFOA 2CO6B 4Y16D 4WHDA 1MFEH 1Y6MR 5CZXC 5E9DD 3WS3B 4B7IA 4Q9RH 1ZSDA 1FIGL 2Y72A 4I3SH 3STZB 4M6ML 2UVFA 4JN1H 2IBZY 3P4NA 4FQCH 4YHIB 1OARL 1F90L 3G5ZA 2VLKE 3FO2A 5CBEA 1BBJA 5CZKA 3RWFA 4OF3A 3NFNB 2DRUA 4WWKD 5KANG 3FT3A 1OAQH 3CLFH 1QSED 2C3VA 3H9SD 4JO2L 3CFDA 3MLUH 4B41A 4KJPD 2IFGA 2NTFA 4MAYB 2ARJA 3HG1A 2KPNA 4WV1A 4HS8H 3GSRA 3JVGC 4R9HA 3T65B 3BRGC 2H32H 3EO9H 3WUWA 1HI6B 1Y18B 4Z78B 4CVZB 1IC1A 1F4HA 1L6ZA 4H1LA 1S7UB 3ZHKA 2VLKD 1KXVC 3FT2B 3CMGA 4LSVH 2PF6A 1AQKH 3C5ZA 4DOHB 3QIWA 3IDJA 2DQJL 1S7TA 4OM0L 5AEAA 3EOTH 4A2LA 2XQYK 3NAAH 4NZTL 1S5IH 4OZ4B 1XH3A 3Q6FB 4YFLI 5I2IA 1F5WA 5DT1L 4JQIH 3S7GA 3VXRA 4NRXB 1S78C 3RZCC 4MQXD 1KB5A 1ZLSH 2A73A 4YLQT 4F7CA 1YEKH 3CU1A 3ARTA 3FZUD 2F5AH 3OKEB 4ZFGL 1JZ2A 2XOTA 1HKLL 3LKPB 2FD6H 4CVXB 3IJHA 4FTVA 1HINL 4XMPL 3JVGA 2PR4H 1BWWA 4W70A 2NY1B 4G9DB 3L5HA 3V0WH 3KPPB 1HHIA 4PGCB 2HT2D 4OLXH 3MZTA 4NJAH 4NWTH 1EUUA 3BUTA 4TSAH 3IF1B 3FKUS 2D7NA 4NFDA 1KB9J 1X5AA 3DBXA 3X3GL 4X6FA 5IMOB 3FO0L 5F7KC 5T3XL 2GY7B 2CMRL 4JM2B 2FX7H 4F7TB 4HFUH 3S4SA 1VEOA 4DKFL 2ZUXA 1MCFA 1T1ZA 4ELMF 3TT1H 3H7BB 2ICES 1BJMA 5GS0D 1FRGH 4PYGA 2QEJA 4IJ3C 5DD1L 5CEXA 4O2FB 3TA3C 2YPLB 5D2LA 4X4ZA 2VLJA 1TFHA 3NGBB 3C60B 1QNZL 1LK2B 2PN5A 4KRPC 1ZHKB 3QNZA 3RVXD 3WXVH 5D7IB 5F71A 3KPNA 4J3WA 4TSBL 3RVTD 1DEDA 1DUYB 5HHME 2R4SL 4M7KH 4Y4HB 1EEUA 4WGVB 1IL1A 1NMBL 4LLVB 3UJIH 1DQJA 3MLXL 1I75A 2UWEA 3NCYS 4R97C 1Q9WB 4GG8B 1XF1A 4K7PH 1E4JA 5EU5B 4LLDB 2F54B 1FIEA 1GOHA 3R06A 4QRPE 1ZLVH 5C0IA 3HPLA 2BX5A 2XN9E 4PGBA 5DJDB 2ARWA 3OX8B 5DTFA 1A6TA 1E4WL 3PWPE 2EYSA 3FFCA 4OZHA 4LIQH 1KN4H 4DGIH 1QPPA 1U91A 3IDUA 5DWUL 43C9B 3MUY1 2EECA 3VWKB 5HHMD 5EC1A 5GS2D 2XWTB 1VEMA 4OZGE 5C70A 1RMFH 4HXAH 1ZTXH 2ATPA 2IH3B 4QRPD 1ZWIB 3HZYA 1QR1B 3OR6A 1FJ1A 2Z91B 4P5MA 3SE9L 3T8XB 3KWWB 3RP1A 3WN5A 1EBAA 1ROWA 2XN9D 1F42A 4U2YA 4ZYKA 3VW3L 2VZUA 2WIIB 1CXLA 2EYTB 1ZVYA 3HS0A 1WFOA 4U7SA 1S7SA 1I1AC 3ARFB 3HR5B 4HC1H 5CIPB 3PWPD 1MUJA 4UT9H 3DWTA 4XX1E 2NY0C 3KYAA 4PJ7E 1LDPH 2A6DB 4G8IA 1IEHA 4ZUSA 3TN0C 3SDCD 4GKNA 5DRZB 3BDYL 1GPOH 5F9WB 2FX8L 5HHNB 5M7QA 3IJYA 4Y4KD 3QHTC 4K23L 1U8OB 5I1CL 1F11B 5KVEL 3Q6GL 4NKDB 1JN6B 2AI0H 5FYJL 1AGFB 2XACC 3LKSB 1U8PB 3GM8A 2Y5TA 4LEOA 1ZK9A 3VXUE 2IANA 4C54A 3LQAL 2R69H 2XQBH 1A5FH 4NQEE 2GK2A 4G8FB 2PW2B 4GRMA 3KPLB 1OSPL 4QHNA 1CT8A 1G84A 3MLWL 4FQHA 4M93B 1W8OA 3QHFL 1PBYA 4MLSA 1CDHA 5CD3A 4XXDA 1G1CA 2I9TB 4F37F 3Q3GA 3VRLE 5IB4B 4JFHE 5DS8B 4PJXA 3AROA 3HA0A 3L95A 4PJHE 2R29H 1I4FA 3TBWA 4UB0L 3ESUF 4GH7B 3LRSB 4QWWC 3WFHA 4LASH 4NQED 2FYYA 1NGPL 2QADB 3MRPA 4JPWH 2IPTH 3TWCL 3U48A 5EZIH 1TLKA 2GTZB 2HYMA 2L0DA 3NABL 1QRNE 3C5JB 1YQVH 4D0CB 3CDGB 3STBA 4KI5C 1NFIA 1JK8B 3DYMA 3KPMB 3MSPA 5CINL 2J6EL 2A77H 2Y36L 4FFYH 4H26B 4L8DB 1C5BH 2HVKB 2GY5A 2AABH 1AXTH 4JFHD 5ACZA 1JPSL 2JELL 1EGJH 5CGYD 2QQLH 4I0PB 1YUHA 3C8HA 1UQSB 4M6NL 2DM4A 4QF1B 3QUZA 5DSCA 5ICZA 3MRBB 2H3NB 5ADPL 1MRCL 1P7KB 1FO0L 3UPAA 5E56A 1F3RB 1BOYA 1JWSB 1GGBL 4LCIL 3VJ6B 3M8OH 2ILLA 1OAXL 3O3EA 1MNUL 2CUHA 1OLLA 1WGOA 4GUPA 2AXHA 1PDKA 1KULA 1KJ3H 1NSNL 2AK4A 4KU1A 1GC1C 4JG1H 2VISB 1H3PH 2Q86B 2E9WA 3LKOA 3GBLA 3RTQC 4BK5A 2DDQH 3QUXC 1FZMB 3G9AB 1A6VL 4LSDA 1IFHL 5EORH 4JKLA 5TQ2H 5HHVL 3GNML 1IGTA 2B4CL 5AZ2H 1J0ZA 1W0VA 2YR3A 2Z35A 4ZOAA 2CK0L 3QO1A 4WHTA 5EO9A 3MOAL 2X4UB 1E4XI 2A9MH 4TNVF 4YNYA 3EYSH 3FTGB 3IGAB 4P4KA 4HS6B 2BERA 4DKAA 5C0BE 3EAKA 1NMAH 2JIXD 5LGHL 1G6RL 4Z76A 2XFXA 4TNWF 2BVEA 3EJZD 5E2WL 1Q72H 2GQHA 4IDLA 4X6CE 1Q1JL 3VFOA 3UTQA 1BQHA 4DFIA 5I30H 3T77B 3RL1A 3Q5TA 5IG7B 3MZGB 4MZ2A 1NUNB 5J13C 3D3VD 1YQ2A 3QXDA 1TVBB 1AD9A 4HWZA 4LIQE 4R7DA 1KNOA 5LG1A 1RFDL 3EO1A 4OM1L 1DSFL 5GSVA 5I74B 3SE3C 4P57B 2WINB 2EDNA 4TULH 5T1DH 4QRRB 5FEBA 4RAUB 1I7UB 3MR9A 1RQ5A 5C0BD 4MB3A 4Q2ZA 1T22B 5I1GH 5IIEB 5CLTA 3KDMA 5I16A 1QKZH 4Y5XC 3QFJE 4UZGA 1ED3B 3CGTA 2XYCA 5JHDA 1ZKAA 4G3YL 4AENB 2P4AB 5E00B 5FA4A 2W9LA 1YJDC 4Z18A 3PHQA 4IDJH 3F58L 4YC2B 3O4OC 1NGQL 1HQRA 1NCWL 3LV3B 1Q9KA 2DQGH 1Q9OA 3N9GL 4AEHL 2AJSH 1IE5A 3UC0H 1U0QA 4DEPB 4U05A 1DZBA 3CSBA 1NFDE 5C1MB 5I8CA 3LMJH 4U1GB 1WEJL 3VXNB 2D0GA 4FQXC 1G7PB 2VDOL 3WS3A 2DQCH 3THMH 1VKXB 3K1KC 5HGAB 3MRDB 1T83C 3QFJD 3SKOB 1FYHB 1ONQB 2QL1A 3ULSA 3NFNA 3RJDA 2ZJSH 3KJ4B 3LHPH 1V7ML 2Z31D 1FL6B 3FJTA 2ADJA 2FJFB 5H37H 1NCAL 2LV4A 3CDFA 5FDYA 1EFXA 2VDLL 4Y5XA 5IVXE 1ZHNB 4JFPB 1NGYB 4G7YH 1IAIH 4OGYL 1IQWH 4ELMA 4M7LT 2HKHL 3T65A 3GI8L 2YK1L 2NY1C 2QJDA 4NQUA 2OI9B 2PYFB 1HI6A 1KJ2B 2LFGA 4KTEL 4QRSB 1QTYT 5FKPB 4CVZA 4Z78A 4AL8H 5LXGL 4RGMC 3SDYL 3WEXB 4S11A 3FRPG 4I0CC 3MGTB 3ZYIA 1CG9B 1LK3H 4AYFA 1S7UA 3VXOA 3FT2A 4CU8A 5C0GB 1JBJA 2EDQA 2WUBH 4X4YB 1JPTL 1T2QL 4PBVC 3R8QA 2BC4B 4NZDA 1KEGL 2VLME 4OZ4A 4ODVL 4Z7QF 4GRWH 4RMRA 1TJGL 1RUPH 1QLFB 3E8UH 3QI9C 1XEDA 1AFVL 4NRXA 4PUBH 3NPSC 4DK6A 5C0FB 1NCNA 5HHOB 1YN6B 4XPTL 5DJYB 4KKLC 1SVCP 5JXED 4IIQB 3WO4B 2DI8A 4NCC1 4XC1L 4NDMB 3K0WA 1NEUA 3OKEA 1ZHBB 3O6KL 4HUMB 4Y4HC 5EH1A 5GGTH 5FCSH 4U1IB 2YOCA 1DBJL 2ERJB 4IEFB 3SGDH 2GCYB 4Y2DB 3RWGB 4PTUB 3M45A 5DEFB 4G9DA 4Y8AA 5DMGD 3F6LA 4YHNB 5B8CB 4DQOL 4EI5C 3QJFA 1KLFA 1A1NB 1IC7L 4U6HB 1BM3L 3GMLB 3IF1A 2B7DT 2VLMD 2NXYD 1F00I 1G1YA 1L9MA 3WJJC 1YEHL 2LABA 5IMOA 1D9KC 3EYOB 1MQKH 4C56B 3LPWA 4JM2A 5D1XC 2DM3A 4F7TA 2K7PA 3O3AB 5TQ0L 1Z6JT 3H7BA 2OL3H 2V17L 5EOCH 3HMXL 1LO2H 5D2NE 3X11A 4YXKH 2Q8BH 3IU3B 5KBNC 1NANI 4O2FA 2X5PA 1CFVH 5CJXC 5GJTH 4MXVE 2GKIA 1FQ9C 3PV7A 3WCYA 1PX3A 3TV3H 5AYUL 1LK2A 5ISZA 4BFGA 5L9DH 5K9KB 4LEXH 5D7IA 3MLPA 2V7NA 1T6VN 4DAGL 4Y4HA 4D8PB 5EZOL 1BFSA 3MLYL 4LLVA 2J5LB 5DJCB 1CDCA 5EU5A 4FFWD 4LLDA 2F54A 4KUCD 1KELH 3OAZH 4NOBA 4NBYB 5I1IL 1I8MB 5DLMH 4PS4H 4ZOBA 4K3EL 4RRPG 4JRYB 3PDOB 5DJDA 3WJJA 4OV5B 5KSBE 3OX8A 4FA8A 5C3TA 4HPOH 1D9KA 2ZNXA 4PJAE 1LEGB 1WCQA 5SWZE 3FN9A 5JLZB 3C09B 3FQXB 43C9A 3REWB 3VWKA 4FFVC 1CFNB 1CU4H 1MI5B 2FHFA 1TQBB 2DQEL 3O9WB 1N0XL 5IFHL 5DGRA 2BY0A 3L3HA 5CJXA 1EJ6A 5GS3A 3OKNB 4NUJB 4MXWH 5D70H 5J3HC 1C1EL 4WUUA 2IH3A 1XIWB 4O2CB 3ULVD 1ZWIA 4RMVA 1QR1A 4NZRL 2OTPA 1F4XL 2VXSH 3OBAA 1FO0B 1XAUA 1OCWL 2O26U 5KVDH 4JFXA 3G6AB 1S7WB 2WIIA 3BGFB 3MV01 1BQLH 1PAMA 1BJ1J 2EYTA 4CBPA 5TE4H 5B4MD 1H8SA 5CIPA 2NLJB 5FUOL 5SWZD 3BIBX 3FMGH 4PJBE 2D4FA 5FUZH 3SY0A 1AGCB 2P42B 5KSAD 3BKJH 5K33A 3RUGE 2A6DA 1MFNA 1RUQL 5ACMA 1JHTB 4R26H 1A3LL 4JO4H 2DJSA 4GW4B 3B2UD 3O2DL 3QUML 1RZKH 5EO1A 4XP6L 4WGWB 3WSQL 1U8OA 4E0RB 1U3JA 1F11A 4NKDA 1JN6A 3GHBH 3LKSA 3OV6A 1U8PA 2EEAA 4W6WB 4F7EA 3DO7B 1QSFE 1I3RB 3D48R 2DLFL 1MSPA 2DQTL 2EYRB 4G8FA 1E6JH 2Y07L 1TETL 3V5HB 4JB9L 3WFBL 2XA8H 3KPLA 4CN1A 1U58B 3GBNH 1OM3H 5C3LD 5DK2B 4KPHL 1PZ5B 4LQFH 3QULB 5KANI 4Y8DC 5TDNA 5E2TL 4XZUB 2YS4A 2JE8A 3BRFA 3V4VL 2P7TB 2NY3C 5AG8A 3O0RL 3T3MF 5IB4A 1F6FB 2VR5A 3QDGB 5DS8A 1MY5A 3K2UH 4EXPX 2UZIL 3KHOA 4LGPB 4PJ9D 5I19H 1GOGA 5CKAA 1X7QB 3GSWB 2FATL 1QSFD 3LRSA 4W4OC 3QXAB 1H3WM 5ID0B 4OLZH 4MVBD 3DUHA 4X5WA 2AQ1A 4HEPG 4X9GA 1Z0MA 2D31B 1RUKH 4JVPA 3QUKB 3FHQA 2X1WL 2GTZA 3BQUB 1K85A 25C8H 4L4VA 4BZ1H 3C5JA 4RBPK 1NLBL 4R0LC 4D0CA 3CDGA 4GRLB 1II4E 3FRUB 1JK8A 4H26A 4L8DA 4LOUD 4GAJL 3V95A 4PRPB 2HVKA 4H1LH 3L5JA 4BJLA 5DJ6B 4ODUB 1I7TB 4XVJL 3ULUL 1K3ZA 1QFPA 3CDYA 4I0PA 3VMPA 4F37K 1UQSA 2G5BB 5CGMA 4QF1A 4NM4L 3HZVB 2ZKHL 4JFFB 3MRBA 2H3NA 4I9WE 1WFTA 4LGRB 1P7KA 3OAUL 3W39B 3U4AA 5CJOL 3DIFA 1JWSA 1KB5H 4R3SA 1KT2B 5D7SL 4GBXC 1UEYA 1J5OL 4W4OA 4Q58C 1CVSC 2GK0B 1SJVA 2CLZB 3ZT7A 2VISA 2Q86A 3U4EB 1C16B 5ICXB 4P2RE 1FZMA 2EH7L 3WLBB 4KRNA 4LVOC 4Z9KB 4R0LA 4TUJB 4RMWA 1UWGL 2HLFC 1CIUA 5EA0H 1NUGA 3DVIA 4JANB 4I9WD 4IMLB 1Q8MA 3B9KD 5FUCE 3U4BL 5K9OB 2DBLL 3P0VH 3IVKB 1MIMH 2RJMA 2HRLA 4M7ZB 15C8H 5IEKB 1EFQA 2RIKA 1AQDB 3EZ8A 2F53A 3P3YA 4TTDC 1KIPB 2BRRH 3QDJB 4H8WL 4P2RD 3DTXB 3NFPB 3VFSB 3ARDD 3TYFB 4DEPC 1HIMH 4QOKA 4JE4B 5IG7A 1YNTB 3MJ7B 4UI2A 5EOTB 3T0WA 3QDAA 3UJJH 1J1OL 3WFCL 1A4JB 3ET9F 1W72L 1JTOA 4OCLC 3BMWA 3WIFB 4XPAL 3C8DA 4P57A 3TO4D 3RGVD 2MCPH 2AKRB 5ILTH 1GAFH 4QRRA 4RAUA 5FO9B 1I7UA 4ACPA 1T22A 4XTRC 4LKCB 3GMMA 3FQNB 1ED3A 4TNVK 3IS0X 4XB8A 1NBQA 1Y0LA 3UO1L 3BP6B 4PREB 2QQKH 3RI5K 3RWCB 3TH3T 1IGJB 2EDOA 3D0VA 4TNWK 5AD0B 5HDQL 3LV3A 2YXFA 5HHPA 1J8HB 1JZ6A 2R39A 2GSIA 2WK2A 4M1GL 5IVZB 2NY2B 3ZDYF 4OB5L 4LRNH 4Q0XL 2JB6A 5KS9F 5F21B 2YD4A 3I9GH 4ZPVB 3QEUA 5ACLA 4U1MB 5HGAA 3MRDA 3SKOA 4NQDD 4RQQB 1FNFA 4BSJA 1ONQA 5E4IA 3DXAE 2FCBA 4YBLB 4FQIH 3ZL4L 3QISA 5GGSB 3GGWB 1IJ9A 3U7YL 4P5TD 1FL6A 5T5NG 1IGCL 1M6OB 5CWSB 2FJFA 3TZVB 3MXWL 2Q3AA 5E03A 2NYYC 5ID1A 5DRNB 3TIEA 1JYWA 1G0XA 2ZP0T 4NO0B 1K8IB 1IEAB 4XVSH 3VI3E 1OVZA 4S0SD 4U6XB 5HGBB 4LPCA 3LKRA 2PYFA 4KDVA 4EUPG 4DZ8B 4QRSA 5FKPA 1MVUA 4R4FL 1ES0B 3WEXA 5CFHA 4ZUUB 1JHLH 2YHGA 4BUGA 4QRUA 5D93B 3INUH 3MNZB 1CG9A 3IDXL 3GSUB 1UZ8B 3BESR 2R15A 1S3KH 3OGCB 4H88H 5C0GA 5DRXA 2ED8A 2LU7A 3LQAC 1M71B 1Z0NA 1T21B 5EOQH 2BC4A 2Q87A 1NAMH 3EDFA 2V5SA 1QLFA 4PY8I 4M7JL 4IRSB 1LGVA 1O7VA 5EU7E 3VXTB 2I5YH 3EGSB 4LHQB 3RKPA 3W81A 1V7NH 1J0HA 4MNGB 3CFIC 2MKWA 3PQYD 4JFEE 5C7XH 1ZHBA 3SDXE 4PJ5B 1F8TL 4Y2DA 4TUKH 1A0QH 4PTUA 4U0QB 5E1AB 5DEFA 3L9RB 3RWGA 3U30C 3PGCB 4DGVH 4YHNA 3J8F7 3EZJB 4OJFL 4PJ8D 2KZ1B 2X4NB 3E1F1 5B8CA 1M7XA 5BOPA 1A1NA 1N6VA 3QUMB 4U6HA 4XVUC 3GMLA 4WO4B 4N68A 1S7XA 1T1WB 4KJWC 3O81A 3QIUD 3EYOA 4XHJD 1UM4H 5LBSH 4C56A 3SGKC 2DOCA 3I2CH 3MMEA 4KRLB 2HWZH 3SQBA 3R0NA 1VSCA 4JFED 1GVIA 3CVIL 2I26N 1VGKB 2FDBP 3QA3B 3STLB 4IS6B 2X89A 3DGCR 3H7LA 4LP4A 1YEIH 4RFEB 1Q9LB 1D3CA 4OT1H 3BZDA 3VWJB 4F57L 1X5LA 1BBDH 4AG4L 3G6DL 4OZFH 5K9KA 1XIWC 2XKNA 3L5XL 1ZVSB 4NQVB 3OSKA 2ADGA 4D8PA 1HOCB 5IT2H 4JZOB 1MY7A 4JDZB 5DA0B 3BGFC 4JKWA 4R2GC 5DJCA 4HIXH 4KZDL 1ZHLB 2Q8AL 1JMZA 1KOAA 4OGAD 4Y1AE 1CDIA 1I8MA 4FNLL 1UXSB 3FN3A 3CFJB 3PDOA 3UPRB 1AO7B 5IK3A 4M48L 7FABH 4OV5A 2IQ9L 4YFEA 4YJZL 4KC3B 1VB9A 4KKBC 4R90H 3SGKA 1UH4A 2FNBA 4N0FB 2B4CC 2J6EA 3FQXA 2QBWA 4X7TB 4K3JL 4Z7UB 2EZ0D 1K9TA 1CFNA 3C8KB 3OG4B 5ALBL 4WUKL 2ZUYA 1LVEA 5LWYL 5FOBB 1EPFA 3OKNA 4NUJA 3LD8C 1CICB 2GUOA 3PNWA 4Y1AD 1XIWA 1H15B 1P4IH 5DMIH 4ZG1A 3D69A 4FQJL 4V2BA 3ME0A 1FO0A 5DHYB 1F3JB 1S9WB 1S7WA 1SBSH 1UADC 1GC1H 1T3FB 2NY6D 2YRPA 5FXCH 5C6TL 3OJVC 1ACYH 5DMKB 1N3NA 1H3GA 1A2YA 2ZCKL 4RFNB 5CKGA 4H5SB 1JHTA 2HFGL 1IBGH 3NTCL 4GW4A 5BCAA 4XP4H 3QG7L 3U9PH 5EZJB 3JV6B 5IV2B 1H8NA 4NZUL 1OAZH 4D94A 4ODSL 1D7FA 2XWBB 5I17B 3DO7A 4R4ND 3QCVL 4DW2L 4J3XA 1I3RA 1OP9A 2PYEE 2M1KA 3O41B 2EYRA 4JG0H 2Z93B 4M5YH 3V5HA 5DRWA 2IPUG 3BT2H 1RU9H 3MRQB 5KN5B 2R1XB 4S2SB 4JGUA 5DK2A 1PZ5A 1JVKA 3QULA 5CJ8A 3S5LG 1A3RH 2CD0A 1VGEL 4XZUA 5BRZE 5L2KB 4R8WH 3HUJB 5EIVA 3O6MH 3VMOA 1A6ZB 2P7TA 2OXHA 1OTTD 1F45A 3QDGA 5T3ZE 3LPFA 2XTJC 1JZ7A 3X13B 2B2XL 1X7QA 3MACH 5FHAH 5MI0B 4NHCH 3BD3A 3CK0H 5HGHB 1KEML 2PYED 4KY1L 3QXAA 2L4OA 5GISL 3IAGC 3DLQR 4TUOB 2FH8A 1A7OH 4U6VH 3QUKA 2WZPD 1YJDH 5KOVC 3LS5H 1SY6L 5E2VH 5J7CC 3KPRE 4AEFA 1QQDB 5BRZD 4H0IA 1RUML 3FRUA 5F1IA 3V52L 1TCRB 3PGFH 4OI8A 1N7MH 4Z77B 5FF6A 4KTYA 5DJ6A 3VXMB 3MUGB 5T3ZD 1U3HD 3SBWC 4XCEB 3CVHB 2QKIB 2WBJD 3IXTA 4O5LH 4PBXA 1X5JA 2VUYA 4M7ZC 4D3CL 2G5BA 3HZVA 2HH0L 4JFFA 3L3JB 3WFEL 4J3SA 3W39A 3VFPA 2NY4B 3H9HA 3EOYG 5K93A 4L3CB 3KPRD 1ZLUH 1ADQH 1KT2A 2Y06L 2VNCA 4WRLA 1R0AH 3AREB 4HUWB 3QUYC 3ZE2F 4POZD 1R24B 5ESAB 4E41A 2WBWB 2GK0A 2CLZA 2JB5L 3D2UB 3BH8B 2VXQH 4ONFH 5CS7A 4NQXB 4YHYC 4OCMC 5D71H 4Z7WB 3WLBA 5KVGL 4S1DC 1BP3B 4TUJA 2UZXB 2YD7A 5HHXL 1A1MB 1AI1H 3LEVH 4JANA 1OTUC 1RHFA 4IMLA 4OF0A 1HZHL 4S1RL 4B50A 1MHPL 1X5HA 3X3FH 2X41A 4HT1H 2EXWC 1X5KA 1UC6A 4OD1H 4DGYH 3QFDA 3PDGA 2BJMH 3I6GB 5IEKA 1BPVA 4NC1C 1AQDA 4PJDB 1HYRC 1A14L 1HE7A 2BY3A 1KIPA 4PR5A 4WHCA 4IRJD 2VDQL 4YDJB 1IGIL 2FB4L 2Z8WC 3L3OB 4L5FL 3QDJA 3DTXA 3O2VH 2NY2C 1KIQB 2V7HA 1XZ0B 3BN3B 1LE9A 4LCUB 4L8BB 5E6ID 5F9JB 1EHAA 1YNTA 3MJ7A 3QUYA 5DMJB 5EOTA 3FONA 5EWIH 3NZHL 3V79C 3GMNB 3GHEH 3ZKXB 1A4JA 4P0DA 5ESVA 3BPLB 5IQ9B 3WIFA 1MAJA 2AKRA 4OLVL 2MPAH 5FO9A 2AGJH 5CEZH 1A7NH 5JIPA 4RBPH 1IGFH 1VADB 3TZVC 4YIQB 3H3BC 4JLRA 4PB0H 3FQNA 4FMKA 5JUEL 4UT6H 5CUSH 2VXTL 2YD9A 4WEMB 5D5MB 2HFTA 3BP6A 4PREA 5BMFH 4Q9CA 1G7JA 2V5TA 3RWCA 1HHKB 4BSWA 1WBXB 2GITB 5AD0A 2ZPKL 4BK4A 4OD3H 5LGJB 4Q9RL 2NTSP 2MMXA 3GSVB 4I3SL 4HBCH 3OF6D 1D5BB 4FQCL 3TFKC 4P23C 1EEZA 5IVZA 2NXZB 3OKDA 4OGXL 4Z95L 2FECL 2OXGA 3HMXA 4HQQH 3VH8B 4OQTL 3WD5H 2YD5A 3DHMA 5KG9B 1JYNA 4ZPVA 4NUGL 4G8GE 2R0KH 4WY7H 3MLUL 3DRTB 4U1MA 1FFPA 1KUMA 3T2OA 2WWKT 2XIDA 4RQQA 1PGRB 1BJ8A 3OTTA 4EUPB 4IRSC 4HUKB 5GGSA 2CJUL 4HS8L 4X6DE 3GGWA 4OSUH 3FRPA 4LCWE 4LHUD 1M6OA 1EJOL 3TZVA 1MCBA 1M05B 2WIMA 4EZMA 1BZ9A 1PKQE 1IEAA 1FE8L 5DO2D 2J8UB 3HPJB 3WJLA 3K74B 4LSVL 4U6XA 1AQKL 4EJ1C 3H3PH 2A2QT 4NRYB 4DZ8A 3O8XD 4G8GD 3CNKA 4WO4C 4ZUUA 3MNZA 2HLAB 3QAZB 3GSUA 1UZ8A 4P2QA 4QTHB 4LL9A 1WICA 3AMLA 5FYKH 1FNSL 2YC1A 3MCLH 5I1LB 4PTTA 3PXHA 3B9EA 4LCWD 2D0HA 3EJJX 4J4PA 4N0CC 2AXJA 1M71A 3ARGC 1T21A 1YEKL 2Y7QB 5EZLA 3MLSH 2XNAB 1GGCH 3RWEB 1AP2A 4BM7A 3BW9B 3BD5A 4IRSA 2VABA 5LCVH 1I9RL 3FAXA 3EGSA 4KKCC 1DL7H 3SDAC 4NZJA 4MNGA 5IFJB 4M7LL 4OLXL 2NX5B 4CMMA 4NWTL 5BVJB 4TSAL 4WTXA 1CDJA 4PJ5A 2UY7A 3NZ8A 1KCRH 1D5ZB 3F7VB 4LGSB 2XT1B 5SWSE 5E1AA 3L9RA 2Y6SC 4BKLA 1CDUA 4UV7H 3RA7H 4Q9BA 1DQMH 2X4NA 1QHPA 1T7XA 3D1MC 4L9LB 1YMMB 3O2DA 4XPGH 4LNVA 3QUMA 3TT1L 3QPXL 4WO4A 2E7LA 5F1OB 4JZNA 1DQLH 1U8LA 3BIAX 1JHKL 4QHMB 5F97E 3HE7B 3MA9L 1I9JL 3B2VH 3ZKNC 1TJIH 4WENB 3BFOA 4KDTA 5B38G 4NKQB 2J1KA 1S7VB 3WXVL 1DLHB 5IROC 4PJCB 4QXTB 1YNLH 1BVZA 2GJZB 5KSUB 1FFNB 5I66B 2YN5A 3QA3A 1CD8A 5CBAB 3MRKB 4IS6A 5SWSD 4CADB 2RHEA 4XBEL 4RFEA 4RRPA 5A2LH 1Q9LA 1FIGH 3SDAA 4M6MH 5ANME 5FO8B 4CAGA 1ZVSA 4NQVA 5H8DA 3ZDXF 3D39E 1F90H 1HOCA 4JZOA 3QWRA 1MCLA 3MRNB 4JDZA 4Z0XB 4S1QL 5SWQB 1NPUA 1JGEA 3LIZH 1ZHLA 3PWNB 2CDEB 5GGRB 4LIQL 4DGIL 2QSTA 5JQHC 1T0NA 3DV4B 4XNMB 3CFJA 2C5DC 3RX7A 1AO7A 3UPRA 4PRHA 3BEWB 3FQTB 5DEGB 1RJCA 1RMFL 4HXAL 3ARSA 3ARBD 3RX8A 4F33A 4QNPE 3WNPA 4N0FA 5GSRB 2LAGB 1UXWB 3EFFB 1N2RB 5GZND 4L3EB 4PRNB 1MELA 4M00A 4X7TA 4Z7UA 5IROA 3BSZH 5GRVL 1S7RB 1ZA6A 3C8KA 3D39D 1QG3A 4X4ME 1MF2H 4RWYH 1I1YA 2HTKD 1JF1B 1OGTA 3QEHB 2DQJH 2BSRB 3IKKA 4FQQB 1CICA 1KTLB 3NIGE 4DUVA 3C6LD 3CZFB 1PY4A 4NZTH 2OM5A 3MV7A 1HEZB 3DSNA 2YD8A 5DT1H 5GGUA 5DHYA 5C0AD 1F3JA 4LNRB 2IAMC 1S9WA 1DCLA 2QSCL 3H6JA 3HAEG 3ABZA 1T3FA 5HD8D 4ZSOA 2YRZA 2FZ3B 3IKCB 4GQPH 2H2PC 5DMKA 1W0WA 1P84K 3CLEL 2EO9A 1X6NA 1NLDL 3H42L 5HHMB 2VQ1B 3RWIB 4O51A 4ZAKD 4XMPH 4H5SA 5JA9A 5DQJA 4OCSL 1FPTL 1BF2A 2XQBL 4NBXB 1X3DA 4P4RA 3S5LB 4P3DB 5DJXB 5EZJA 3IFPB 3JV6A 1MRFL 5HGDB 3HC4L 3A6BH 3X3GH 3E6FB 2XWBA 3O3DB 2CSPA 1A02N 5T3XH 4GXUN 2I07B 3O41A 2E7CA 2Z93A 4DKFH 4ZO6A 2I24N 3A0OA 2FR4B 5KN5A 2BK8A 2R1XA 4Q7DA 3QRGL 4UILH 4X7EC 4YWGH 2ZUQC 1QLEL 5I8OH 4MQ7B 3V7MA 4RA3A 2R29L 2IAMA 1AR2A 4XAWH 1N4XH 4G8EB 3HUJA 4OZGB 3KXFE 4JPWL 2YN3A 2VUOA 4TSBH 3DX7B 3F65A 4G6FB 2NY4C 2VZ3A 3MRHB 3DARA 4YGVA 5IOPB 2C26A 1W72A 4NFCA 3MLXH 3X13A 1I1CA 1GL4B 1ZT7B 5KAQG 3KLSA 5HGHA 2HA1A 3RHWF 2AAVA 1F4AA 2JCCE 5FFLA 4TUOA 5C0RH 1EEQA 1MCRA 3NIDE 5FV2A 1QQDA 2QQLL 4M61B 1K5NB 4UIKL 5C8JB 4KMQA 1TCRA 2BFVL 5DWUH 1KPVB 1NC2D 1BFOA 3MUGA 2J8HA 3EJYD 4XCEA 4WVRA 3M8OL 1ZAGA 5DR5H 1ZGLB 2QKIA 1GGYA 4LMQI 1D6EA 5EO0B 2ICWA 3VXUB 2OP4L 5IKCA 3PL6C 1A22B 2VL4A 3L3JA 4JG1L 3SE9H 3RJQB 4L3CA 4R6UA 5EORL 5TQ2L 4N8PA 3BISA 1R24A 5ESAA 3B43A 2H32B 2QTEA 3BH8A 3ZKXC 1HDMA 3BPLC 1B0WA 4JRXE 4NQXA 3ARZA 4Z7WA 2X70B 4NIKB 4PJHB 4GG6E 1A1MA 3HI1B 5H37G 3BDYH 3RVVC 2IBZX 2FX8H 5E8PA 5F88A 2BNRE 4K23H 4HUUB 5F7MC 5I1CH 1IGYB 2X4SB 3Q6GH 2Y4SA 3BZ4B 1R5VB 2R9HC 1P7QD 3QQ9D 5FYJH 3ZKMD 2OS7A 3P0YL 1B0RB 4EKXA 3VG0L 2Z8SA 4N8VG 1XGUB 4XNQA 1SJEB 2IF7A 2C7UB 5IM7B 1QRNB 5D7JB 3I6GA 2XTLA 3S97C 4PJDA 4IOFD 1KTDB 5A43C 4PJ7F 2V6HA 1MLBB 1UGNA 1OSPH 1PQZB 4YDJA 3MLWH 3L3OA 4JRXD 1J05B 4LPUA 1FORL 1HXYB 1Z5LB 4OF7A 5BV7L 1QBAA 5E6YA 4F58L 2Z9TA 3D6GA 4LCUA 4N0RA 5F9JA 3GIVB 5DYOB 3SE4C 2BNRD 3GMNA 4P3CL 5IQ9A 5I1JL 4NQTA 3DX6B 1TTFA 1UEMA 2HG5B 2PW1B 4MX7B 3HE6D 3IU4L 3RDTC 3KPSD 3SO3B 1F97A 1NGPH 3VE0B 3TWCH