5I30L

Crystal structure of the human astrovirus 2 neutralizing monoclonal antibody pl-2 fab fragment at 1.9 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTFPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De Novo Sequencing and Resurrection of a Human Astrovirus-Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab PL-2 light chain
total genus 60
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30L01
3QIWD 4LCWE 1CR9L 3B4NA 5LBSH 5C9JB 4N9GB 3W11C 2P24A 4LDEB 4KMTL 3RJDA 3HCVB 3GDBA 1UB6A 2J4WL 1MFAL 5IQ9A 2A83A 1GL4B 1KLUA 2AJSL 5CJBA 4R4ND 1M7IA 2LU4A 4PRBA 3QUXA 3MV11 4R4FH 4YXHL 5FA4B 1KN4L 4RGMB 4S0TD 2LU7A 3L3HA 4GG8B 5M7QA 1FNAA 5H35A 2Y07L 5JNYB 1BZ7B 2XA8H 5K59E 2HRPL 4N0YL 3OG6B 5IV2A 1CTOA 4ZSOA 3BH9B 4OT1L 1X5JA 1FSKB 5EIVA 1T04A 3JV5A 3BOVA 3NFPA 3OKMB 5F9OL 3F6IA 2O5ZH 4PJAA 5KN5B 1BAFH 2UY7A 3O6FD 5IB5A 1AXTL 3VJ6B 4WFGE 3CPLA 1IQDB 1FE8L 4HW6A 2A6DB 4QYOB 4JPIB 1RZGA 5J8OA 3WFEH 4CGTA 1QBML 3SO3C 1TTFA 4O4YL 2Z4QA 1W8NA 4YNYB 2E7HA 2W1NA 4K3EL 3ECBA 2W91A 4IRJC 4LCIH 4N0UE 3WKMH 2X05A 4C56D 1DE4B 1PZ5B 4LARL 4G8GB 1A7QH 1EAPB 3GMPA 4I2XA 3RI5F 4RA3A 3VFGH 3VFRA 2XRAL 2GSGA 4EXKA 2AJUH 3FRPG 3BW9B 3MRIA 3MJ7A 3TO4A 3HMXA 4X7CC 3V5DB 4EIGB 4KMTH 1SJEA 3FQTB 4YAQB 1CDYA 5ITFB 5DR5H 1P84J 2P5WD 4Z8FL 4PRHE 4YPGB 2VLKB 4KI5D 4ZUSA 3RWFA 2OX5A 3U79A 2AK4D 3MXWH 1S9KC 1CLCA 5GRJH 1QSZA 3GIVB 5J9PB 1S3KH 1YQVH 2BXYA 5EC2B 2VISA 4U33A 4QT5B 1OB1A 4QRUB 5IQ7L 3K3QA 4TOYH 1YY8A 5JW3L 1KEML 1N5YH 4PRDA 1A3RL 4HCRL 5EN2A 4X6BB 3HPJA 1LP9B 2NR6C 3BPCA 5I8CA 4KVNH 3EW3B 5IB1B 3NPSC 1YYML 5EWIH 4TUKL 1FAIH 1DCLA 3K4AA 1EGJA 5I30H 4MZ2A 3MA7A 1KEMH 3SGEI 1N5YL 5ALCH 3T4AA 1EUUA 2GITB 4PJ5D 1JFQL 3E6FB 3VE0A 4RX4A 3VRJA 3O2WL 32C2B 1J9CT 3WFCL 5GRJL 2P8LB 4FQIL 1DVFC 2LFGA 3DETC 4LSPL 4M8QA 4KJYB 1I9EA 1DLFH 2DWEA 1XR9A 5IV2B 4L29B 1WTLA 1BD2A 3DHJA 1A6VH 3KJ4C 3EDDA 4RMVA 2K9UA 5KSBF 1FORH 1M05A 3QG6B 4EBQH 3CDCA 3FONA 2IC2A 2JB6B 4C57C 1SBBA 5IEKB 2MWCA 3U4EB 4E41A 2A0LC 1XT5A 4HV8A 4DN4L 1XF5A 3MLTB 4JFPA 4N8CL 3GSOB 1K6QH 4FTVD 3NMEA 1JPGB 1DEDA 5IESH 1JPST 4ISVB 5IR1A 1RU9H 4OZIF 4Y1AE 2HWZL 3UJTH 1J0YA 1EEZB 2Q3AA 4PRHD 1EV2E 3VXQB 4JFYB 5GGQH 3JVGC 3K2UH 2EC8A 4OZHA 2W38A 4HK0B 4XX1G 2AW2A 2RB8A 2V5TA 3VXMB 5DD6A 5K59F 2QHRH 4P57A 5EG6C 4QTIL 2I60L 5EIQA 3IDMA 5F9OH 3WV0A 3HC4H 4YPJA 4YQXL 1C16B 2V7NA 4Q6YA 3F12B 3JTTB 5HHPB 5J56B 4MAYD 1YECH 3L5WA 3C5JA 2ICWB 2EH8L 4FG6C 1WBYA 4HS8H 5DJ0A 4U3XA 1WFTA 3B83A 1CL7I 1T21A 2AXGB 1AC6A 4E42B 5IROC 1YEDB 3DX9B 2DLIA 1KB9K 4HGWA 1JIBA 3TCLA 2AEPH 3Q5OA 4M93B 4Q9QH 4LCYB 2VH5H 2AJSH 1LO3H 3B9AA 4QWWC 3WS6C 5FUZL 1T6VN 2VDPL 5D7JD 3ZE1F 1EFQA 1MFNA 1YJDH 1S7WB 4QCIB 5I8CB 1CZ8H 2H45A 5DF0A 3HE7C 1WZ1L 5BZDA 1EPFA 2C9AA 3QDMD 4KK5C 4GKNA 3VW3H 1EEYB 3NPSB 5JXEC 2FJFA 4LLYB 4WY7H 2VIRA 2ARWA 3N1GC 5DYOA 2VR5A 4OKVA 2E8ZA 4R2GB 2KZ1B 2C1PB 2FIKB 4NO0B 3D0LB 1NAMA 1GXEA 3GSRA 3MJ9L 5EBWA 4HAFA 2G60L 1HHHA 5L8JB 1I8LC 1J8HD 4PLJC 4PGCB 1C5CH 2IWGA 1NLBL 1X44A 4JR9H 4LPYA 3SGDI 4YEFA 2XI9A 2H32H 1XH3B 1CGSH 3BIKB 2EIZA 3VWKD 4WUUB 3OHXB 2FATH 2VLRE 4NGHL 1MSPA 3MLYL 4H8WL 3SE3C 2VAAA 5C0IA 4P3DB 2HA1A 5ID1A 3DVGA 4LVNC 2OL3L 4PB9L 3OQ3B 1G6VK 2F5AL 4UQ3B 4M8VA 1MAML 2ATKB 1CGYA 4HIEB 1AI1H 5T3ZD 3QDGA 4V1DD 1Q94B 3C6LA 4Y7MA 5GRUL 2PW1A 3SGJA 4UBDC 2FBJH 1YUHA 1FN4B 3CDGB 3BPOC 3LS5L 2X89D 4JG1H 7FABL 4X4ME 5JUEH 4ODTH 1AIFB 1JI2A 4ZOAA 1MCIA 1U8IA 3OX8B 3BDXA 3M8OH 1JNHA 5MEND 4UT6H 5I2IA 2PTUA 3DVNB 4LLVB 4AQOA 4XCEB 4R9HA 3VD5A 2CMRH 2GJZB 4DKAA 2Q76B 2EC9U 2ATPA 3VFPB 5DJ8B 2MSPA 4U1GB 3ULUL 3ZDXE 5FOBA 4UV4H 5IFHH 3DGGA 4LLUB 3WN5B 4N8VB 3DJ9A 3CH8A 1S78C 4NC2B 1JHKH 5KSBE 5HI4C 1F2QA 2ICWA 2MCPH 5IB3B 3VXME 2BVOA 4XPBL 5IFHL 1T6WA 3T0EE 3U48A 2AXGA 1TTGA 5FM8A 3IDIB 4ZXBA 1IGMH 2VXUL 3MRMA 2EZ0C 5IGXH 3HA0A 4FABL 1N4XL 4H0GA 4YK4B 3V95A 1OAKL 5FB8B 5EO1A 1U8KA 2PO6D 2V2WA 1W72B 2FHFA 1S7WA 4PJGF 2CLRA 3BKJL 5L2KE 1DUYB 3BKMH 4XRCA 4KKBD 3BAEL 2J8UB 3C08L 5TE7L 3ARDD 3K8MA 5CEZD 3AAZB 1U8JB 2N7AA 4LQFL 1CZ8L 5HDQL 1NDMA 3IFLH 1RSFA 1LK3H 4OFKA 1WC7A 1A7NL 1OTSC 2R0ZH 5GSRA 1J12A 1KXTB 2DIJA 5JUEL 5HJ3A 2ICES 4JJ5A 3CFBB 2OTPA 1T1YA 3TBVA 3O3AB 4TSBL 2ENYA 4ALAL 4MXQD 3SDXE 1INEH 4GRLA 4JFXA 5CBAA 1N3NB 2AV7A 4M7JL 1CFQA 4BFEA 1EERB 5BS0D 4YIQA 1CLZL 3GIVA 3QYCA 4JFFA 4JHWL 4WV1A 4RDQG 2V9TA 4FRWA 4GSDH 4ZOEA 2MTPA 3PGCB 4WWKA 1YEKL 4WI8A 5DGRA 1F11B 1TITA 4G43A 3ARFD 2O61B 4RWYL 4YX2H 5HYJD 3SQOL 2MOVA 1UZ6F 3AB0B 2D31A 4MB3A 1I9IH 2HJKB 1ODAA 4UZGA 1YJDL 4WRLA 1QVOA 3E8UL 4QEGA 2NW3B 1KXQE 1T7WA 1NMBH 4RGOL 3MREA 3O8XA 1LWRA 4E9LA 4UV7L 5EORL 2O93L 3IVKA 2VDLL 2BSTB 3LEYH 1RUPL 1J87A 4D2NA 2LAAA 4UBDD 4I3SH 1SEQL 3P3YA 5EU5A 4TVSa 4WEBL 3TBWA 2WLZA 3E6HA 1FL6B 4XXCC 3IU4H 3LN9A 4BM7A 1UVQA 2C3GA 5CHNA 3C5ZD 1S7SB 5IW6A 1T7YA 1FYHB 1H3UA 1KJ2A 1I9JL 4NWTH 1HI6A 5HI3C 3V4UL 1MFBH 4YQXH 2BNRD 4PJ8C 1DSFL 1NMAL 3P30H 1CGTA 3LN4B 4HXAL 1C5DB 1JZ3A 4MMXC 4J1UB 3KPRB 5FYKH 5GIRA 2BVQB 4EI5A 3KYMB 3ARDC 3VH8A 2OLDA 2X5PA 2CLZA 5C0DB 1EUTA 3QEQB 5HBBA 5T33H 1CVSC 4RAHA 2O26U 2DQJH 2BVEA 5K9KA 3DTXA 4YHIA 2I60H 4IMKA 2NQCA 2VITB 2FSEB 4X98B 2FR4B 1U0QA 2X4PB 1C8PA 5FECB 1N6QL 4E41D 3BRFA 3HLAB 4PJIA 3GBMH 4G8GD 1MFEL 8CGTA 3WNNA 1KJMA 3BN3B 4P4RA 4Y5XC 1LDPL 3NOIA 3FQTA 1AP2B 4YAQA 4Y4FB 5TE6H 1J0JA 3G6DH 2NY5L 4MAUL 4MNHB 3HC0A 1MREH 4V1DB 3ZYZA 2HG5A 3KPPA 3RWEA 3WFEL 3MLUH 5IVZA 5AYUH 4E0RA 3L3DA 1AR1D 2CDFA 1DQMH 2IJ0C 1B3JA 3Q6FB 1QQDB 5IHZB 4OIIL 5GS2D 1X5XA 4HWBH 2EE6A 3TIEB 1WIPA 4OLEA 2IAMD 2D0HA 1LEIB 5INCB 1Q0YL 1ONQA 4XPAL 4N90D 5C86A 3VXTB 3RVVD 4F7EB 2CDEA 2A74A 1CN4A 3O4LD 3O4LA 4MD5B 4U7MA 2UY6A 1X6LA 1F58H 1ZT4A 4ODXB 4U0RC 1BOGB 3CC5B 2WINA 1UQSA 5DJ6A 1U3HB 5I1JH 4LSQL 3FFCA 2OJEB 4NDMB 1FO0B 3M17B 3PGDA 4DN3L 2UVEA 3QHZH 4NQCE 3IVKB 5KAQG 1MFAH 4PLOB 1GZQA 5K33A 1CD9B 1UKQA 3QXVA 2GFBA 4HHAB 4PJ9A 5KVEH 3PQYE 1S7RB 5SWZB 3IXTA 5L88L 5MI0C 1TXKA 5IW6B 4HD9A 1I7TA 1U3HC 1T3FA 4B0MM 3MV8D 4KK8D 4F2MA 4FMFA 4ORGB 4CMHC 4UNVA 4I48B 3P4OB 5ID1B 4XHJD 5TDOA 4NM8L 4QHNA 2XICA 5HVWA 4PJCE 4UT9H 4WV1C 5C0DA 3LSOA 1OM3H 5JR1H 1T80A 2PNDA 5KSVA 1P2CA 4DKFH 5ADPH 4ODUA 2R56H 1OLZA 4MNQE 1JWMA 5JLZB 2FJGB 3EO1B 3HE7B 3FQNA 4CMHB 3FB5A 3RHWF 3DX7B 5C0CA 4JPWH 2P24B 3CU7A 4XP1H 1IGIH 5KVFL 1GGUA 5E5MB 2A83B 2CD0A 4PV9B 4GRLD 1JNHB 1S8DB 3A67H 3VXMA 3FT4B 3WO4B 4X6FB 1FC2D 2V7HA 3RNKA 4HUUB 4NWTL 5FM5O 3DMMD 3TBTA 1LQSR 3QHTC 2LQRA 4G7YH 1T1XB 2DBLL 3NN8A 4FTVB 1KJVA 5E1HB 2KL6A 3BYTA 5DMKB 5F44A 3BE1L 3LQAL 1IKNA 3HE6D 2AQ3A 3C5JB 1FJ1B 4L1HA 3VGHA 5KVDL 5EIIB 1Z5LB 2MCG1 3VA6A 2GT9A 3LMJH 4P3CL 4XP9H 4LVHC 2EDOA 3ZTNL 3D1MC 5E08L 1GGBH 3R1GH 4P2YA 4NZTL 4HMEA 4BH8A 4RIRB 3TIEA 3UTZA 2NCMA 5IFAL 1E27A 1G7HA 3V6ZA 2P42B 4FQJH 3C8HA 1MCJA 2VLKE 1QUNA 4NYLB 2YD5A 3I2CL 4FFYH 3WJJC 5HYJE 4X0KA 1BVKA 4HUNB 3UJIH 1MRFH 4RFNC 3F7YA 2AJXH 3QHFL 4U6HA 5B4MD 1W72L 2Y25A 2VLLA 3ARED 4M61B 4GKNB 1K8IB 2A1WH 2XY1A 1DUYA 4IMKC 5F7WC 3P77B 2QQLH 5CGYC 2OTWB 3RGVB 3F7PC 3DV4A 1J11A 2A0LD 5IWLA 1FCCA 4CN6A 2C3VB 1JPTL 5BRZD 2VAJA 4Q9RL 3LPGA 3OAZH 2PYEB 4IM8A 4RFNB 4OLZH 3DXAA 3P0YL 5JQ6H 3GKWL 3P30L 4OZHE 4K3HA 1NBZB 3QQNA 2IH1B 2BDNH 3BGAA 4WU5A 4Y8DC 3WNMA 3LDBB 3G5ZA 1IEAA 4NQEB 4WFHE 4YHYC 3RWHB 3UPCA 3F5WA 5I1GL 1DVFD 1WITA 2YPKA 4U2YA 1IQDA 3KXFB 1T0NA 5IBLC 3TBYB 4PJDE 5E99H 5ACZA 3ESVF 3OB0H 4KQ4L 1N7MH 1CFQB 2A9ML 1SJXA 1CK0H 2FECI 4J8RA 4WGWB 5KOVC 5FYJD 2XFXB 4XP5H 2XWJA 3EYUL 3QDGB 3C08H 3DSFL 4YDKL 5D5MB 2I5YH 5K9OB 3SDYH 1YUHB 3GMPB 2O5YH 2NY1D 1J05A 4JHAH 3IDXL 3B5TA 4NQDA 3RZCD 1AIFA 4PD4J 2DQUH 3KPSD 4IRSB 4ERSH 1MLBA 4JFDE 4XPAH 2ED7A 5D2NA 1RVFH 5I2IB 4LHUD 1KC5H 3MA7B 2XY2A 5BMFH 1JGLL 1P4IH 4P5TD 1ZA3A 4GKSB 4WWKC 4BQ9A 1BHGA 4QGYA 3T2QA 3TA3A 4HS6B 5IOPA 3IJHB 2EDYA 4L4JA 2DQCL 1YEIH 5C0GB 4QOKA 3BKCH 5DJAA 3NN8B 4JHWH 1EK3A 2QKIA 3WJLA 4PJAF 4JDZB 2BP3A 3K1DA 1AKJB 5FGCE 5DRXB 1FL6A 1OB1B 2NY3C 1TDQA 4M1CD 4X5XA 4L3ED 4DK6A 2B2XH 1N4XH 3DOSA 4UTAH 4K94C 2P7TA 4BYHA 5J1SC 5HI5D 2BCKB 4G6FD 4JAMA 4JG0L 4RIRA 4OM1H 4IDJH 1I1FA 4JQIH 3GMOA 2XKNA 3BXNA 3U9PL 3D85A 4I5BA 5D93B 1M4KA 5EO1B 3SKMB 1FVDB 3L5XH 5EZOH 1PKQA 1A7NH 4IMLB 1KV3A 3CLEH 4B7LA 3MLTA 5CCKH 1KELH 3SDXB 4GLRI 4FFWC 4OV5B 3WIFA 1KPVA 4ZYKA 1MCOL 2EDWA 1M71B 4P9HC 5GRUH 1FNGB 1Q8MA 3I85A 3MV9E 3WLWC 2XQYK 1XCTA 3NGBC 4Y1AD 3BKJH 4PJ9D 5B8CC 3QCUH 2APFA 3M8OL 4KK6C 2AK4A 1VACB 4UTBL 1QKZL 3RWIA 3EKCA 4XXDB 2Q8AH 4PTTA 1KIPA 1FBIH 3TBVB 3I75B 4ODWA 2YWYA 3LOWA 2YA2A 1ZT1A 1C5BH 4M43H 5DUPL 2R39A 5GS0L 5KBNC 3LRHA 5C07A 4N0UA 5I8OL 4NPYB 3TBYA 2YK1L 2DMBA 5I1CH 4Z0BH 5B22A 1NAKH 2AJYL 4GXVH 1XF4A 1UWEL 3G5YB 4LDLB 4AENB 1DFBH 3VFSA 4OLUH 3IKCB 4I18A 4PJ7F 4QXUL 3QCVL 5E2WH 1ONQB 1UJ3C 3QQ4A 5T1MB 1OAKH 1XGRA 3BISA 3UROR 3AXLA 1YYLL 3RKPA 4QRSA 5JOPE 5F7YC 1MHHA 4NQXA 7FABH 1YMHB 4MJ2A 3EYOB 3MZGB 1JYWA 4YHPA 3KPRE 1A5FL 1AQKH 1JHLL 4V2BA 4K8RC 4XNMB 3UYRH 5HHXH 2MCPL 1JL8A 4HK3J 4KRNA 5EULV 3C09B 1K4CA 3TBWB 4QRTB 1NAML 4MA3A 4AEIH 1RIVL 4LPVA 1KT2B 3JUYA 1H9VA 4JFDA 4LEOB 4W4OC 1IC4L 2HH0H 2Y72A 3O3EB 1I8MB 4NM4H 4G6FB 2APXA 3HNTL 1HI6B 3WFDH 3ZZ1A 1ULVA 2AXFB 1QFUL 2ICEA 3MUY1 4PIRF 4ZNEE 3IJSB 2Z35B 3QNXB 5HHQA 3I6KB 3I3EA 5T3XD 4IOFC 3ES6A 3K2UL 4UQ3A 2IG2L 1EO5A 3CFDA 2FX8H 1HKLL 4KQ3L 3EOYG 2R69H 4Z7WF 3MOBH 1Q94A 3C6LB 2VIRB 1JP5A 5EOTB 5FXCH 4LASH 1RIHL 3PQYA 4PJ7B 5LQBH 5F3HB 4O9HH 2EXYD 4PJHA 1J1XL 3V52H 4U0QB 3X12B 5FF6A 3PNWA 3BWAB 3ULVL 4YHOL 1SJHB 4G8FB 2YD2A 3HZYA 4P2RD 3DI2B 5I1DA 4C56E 4I13B 5D2NC 2Z91A 1DVFA 3WSQH 2F8VA 3KVQA 4JN1H 4PJGE 3KYNA 4ZUTA 5IFJA 4JO4H 1I3UA 1CVRA 3U0TB 3JV6B 4MHHI 1VCAA 1AQDA 2QADC 3MV7E 5F88B 4CVZA 3DVGB 2R23A 3RKDC 3T0ED 2ZOLA 1ZT7B 5EU6B 3QDGD 4ZD3H 5FKAA 4ZQKB 1E0OB 1NFDF 4Y1AB 1EVUA 5DMKA 3DUSA 2EO9A 3VI4F 5HGAA 3QULB 4CAGA 4Y5VA 1I4FB 4E0RB 4XAKD 3IDGB 3TYGL 1IKFL 5I0DA 4WU7A 2PN5A 5I8KL 3VCLB 1WEJL 4F9LA 5I30L 1MJUH 5DD3H 1S7QB 3T2NL 2LABA 1M6OA 2GW5A 4NYLA 4JFZL 3VXSB 5F89A 4NKMA 1X4YA 4XGZA 3OKLB 4R7DB 1G7PB 4FFZL 4WUKL 3X11A 1BVLA 3BKYH 3LV3B 4XVTL 3D3VD 4DVBA 1A02N 4AMKL 3GRWH 3X3GH 4ZFGL 4V1DE 3EYSH 3C8DA 3RWCA 4FQHA 4KUCD 4YHPB 4XCCL 3LKQA 4G6KH 3CX5K 4U2ZA 3W2DH 1I7ZA 2WBJC 2G5BA 4HAGA 3IKKA 2NY0C 2VB5A 3C09C 5ESQB 4XCFL 5D7JC 5F9WC 3QG7L 1T20A 5JMOC 2D4FA 1GCFA 1HHGA 3BP4A 1I7RB 4KHXH 3C5SB 5C08E 3ME0A 1NEZA 3OJDB 1RUKL 1T3FB 5A16A 1DL7L 4PJFA 2DQDL 3JWDL 4NNYA 3QIBB 4K9EH 4GS7B 2YUXA 2F54E 3B9EA 1MRCL 2BC4B 1CWVA 2OMNA 1QBBA 4BUHA 5L8LB 3HE6B 3G08B 3KWWA 4LARH 2VERN 4WI2A 5IG7A 1N64H 2EE2A 1JNJA 4PJEF 1P2CB 3DXAE 3GRWL 3X3GL 2VDKL 3QWQB 4EDXA 3VFUA 4JFOA 3MV7D 5CJOH 1WFOA 3U30B 4GAGL 2B20A 1Z3GH 4JJ5B 4K94H 4TPRH 4IRSA 4JRYA 3PDOB 3MBXH 2YPLA 4P99A 4PRNA 1QSFB 1T03H 4TQEL 1MNUH 2YC1A 1H3XA 2YEZA 1DN0A 2O5ZL 3FN0H 3VFTA 3ZKXC 4WHDA 3MBEB 2HTKC 3GMQB 3OKKA 1HSBA 1GGBL 1I8LA 4PJCB 4ZPTA 4RISH 1YQ2A 3H0TA 4M1GH 3ZDZE 4CN1A 4X9HA 1A7RH 3IFPB 3ULVC 3CFEA 4H5SB 3BMWA 4FXLA 4R0LB 3QPQD 3MV8B 3O6LH 4RQQA 1X3DA 5CP3A 5CEXA 1HHIB 3RKDD 1G7IA 2RCSH 3AREB 4LGPB 4LCCA 5JHDB 1NGWA 4Y19A 4APQA 3UO1L 1EVTC 4JDVB 2EECA 5D7KE 2HYMA 2HJKA 2EYRB 4PJXA 4NQEE 4QNPF 4O2EA 2XA8L 2FNBA 12E8H 3ROOA 4QHLB 3HAEH 4DEPB 1F3JB 1OAYH 4OIBA 3MRCB 1U8MB 4H1LH 2VITA 3P9WB 1A6UH 3BQUB 1CBVH 4Z18A 2BRQA 5D9SA 1LO5A 3VDBA 3O6KL 3F65A 3OGCA 4PJIB 1UVQB 3TM6A 2Y6SC 3GMRA 4K9EC 5J1AA 3MC0A 1OARL 4ACPA 4JFQA 1JNNH 4XNYH 4MNGA 4ODWB 5LCVH 1HH6A 2G9HA 1NGXB 3KPRA 1X5GA 1NBVH 5ETUB 4HIXH 5GISL 5A16B 1HZHH 4NUJB 1W0WA 4Q6IA 5BZWB 5FA3B 2X41A 1FL3A 2HVJB 4LDOB 2IH3B 3T65A 3QWOA 1RZJH 5HGBB 1M7XA 4RFEA 5HGHA 3MA9H 2NX5E 1I7UB 3V4PH 4TSAL 2UYLB 3NCBB 3VXUB 3U4BL 3QUMB 3V4VH 3VFUB 3HRPA 3MJ8B 2ID5A 4PJ8D 4PJ8A 4X4ZA 4W4OA 4PJDA 2VLME 5EBMB 4X8JB 4Y4FA 2IPTL 2IADA 3PL6A 4FS0A 5E70A 4QRSB 3VRLE 1XGPB 1MH5B 1OARH 4OFDA 3V5KB 2BRRH 2R0LH 5SWZD 5I15H 5IHBA 4HT1H 4A2MA 3PHQA 3PWJB 3LKSA 2YN3A 5ENWB 4X9FA 1P7KA 4HQQL 5GZNC 2GJJA 1CBVL 4G6KL 4B5EA 4K71B 1X5YA 3FO0L 1OCWH 5FO7A 1ETZA 2XN9E 4OZIE 1LP9F 3Q48A 1A4KB 2MPAL 4QRPD 4QRPB 3N1PC 1OD9A 1I7TB 1YEGL 4FOMA 3Q5YA 4X6BA 4NNXA 1R24B 3C5ZB 5ADOL 3O4LB 1GZPA 1FNLA 1G9ML 3NFNB 4U1JA 2YWZA 1W2KT 3EYQD 3SGDH 2XRAH 1CFNA 2WMPA 5EZJA 1Q9OB 4HUXA 4KTEH 4MD0A 5E7FA 5CUSH 3SGKA 4AYFA 2GTZB 5SWSA 3QT2A 1B6DA 4QRQA 1R3HA 1WCBA 4XP4H 2X4NB 5DD5L 4RGNC 3ARGD 3VXPB 2GITA 2YUWA 3O8XC 2V2TA 1CFVL 5I1KL 5SX4I 3MRRB 1G9MH 4Z7VB 3BIAX 4JREB 4U31A 5IVXB 3MV01 3RVXC 1UM4L 3B9DA 4FQXB 1XR8B 4XP6H 4GQ9L 5TGBB 5D72L 2FZ3B 3QI9B 5J3HC 2D03H 5I8EB 1QBLL 1M05B 4MNGB 2RGSA 1F6AA 5A2LH 3OPZH 5E8NB 3MNVB 2R23B 2JK5B 3AY4C 1UXWA 1KJVB 4IJ3B 2B4CC 3MNWB 1KIQB 4N0YH 4NUJA 3UP1A 3UYOD 3TV3L 2DKUA 1AR1C 2VDKH 1OL0A 3QRGL 3SDCA 4S0SD 4P9MH 4YBQD 2EDJA 3SCMC 2X44D 4ISVA 4I0PB 2VRAA 4XVJH 5KANG 3DX7A 1LK2A 3HMXH 4K9EL 5AUMB 3NABH 4C59B 1FIEA 3FOMB 1S8DA 5F89B 3TT3L 4AEHL 1ZVSB 5CEYB 3E3QC 1QLFB 4JGMA 5C0AD 2FHBA 3ULUF 3U46A 4OZIB 3ARDB 3AS3A 4GRWH 4G7VH 4GLRH 1J0KA 4XNMA 1VB9A 3LKNB 5BO1H 2DWDB 5CEZH 3U7AA 1NQBA 3ZHLA 1WQVT 3BP6B 4PB9H 1B4JH 2ARJA 1HZHL 1B88A 4KQ4H 4NO5B 1CLZH 5EOQH 5E8PB 5F7MC 4CU6A 3LRGA 3OF6D 1ZXQA 3KYKH 2F19L 4L4TD 3EIFA 4M5ZH 1WBZB 1YC7A 5F1OB 2FB4L 2XZAH 1Z0MA 1XF2A 3C5ZC 1BGXH 2VLLB 5TE7H 4JZOA 4XZUB 1IM3B 3NFNA 1FO0L 1H15A 1KPRA 5T3ZL 3I6LE 2H32A 4OFYA 2Q3ZA 3JV0A 2XFXA 4YNYA 3GGWB 4OGZA 3IFLL 4L8DB 2NY4B 4LKXA 4U1LA 4Y8AA 4U49A 5BCAA 2AJYH 3N1QC 5F3HA 1I8IB 2W9EH 4BZ1H 3GSWB 2ZNWA 3FFDB 3X12A 4GQPH 3VFRB 3RDTA 5L0QB 1KTKE 3PDGA 1MJ8H 1U6AL 5IVXA 4FXGA 2W9DH 1NBZA 1GAFH 4HPYH 5I1HH 1P9MC 1Q9KA 1EAJA 4YHKH 1IEAB 4NQEA 4XPBH 3NIDE 5FEBA 2FZ3A 3GMLB 2NY6D 3VXRE 5IJVB 4AG4H 1NPUA 2I07A 4LLMB 1GAFL 5B39G 4GXVL 3E2HC 3JWNC 2X4OA 3CMGA 4PJ9C 1U6AH 5CZXD 4NQCA 3WLWD 1V7NL 3OSKA 1SY6A 1YEIL 4AM0A 1FIGL 1NEZG 3RX5A 3BZEB 4ZAKC 3FB8B 4XMPL 4X5XB 3WXVH 4LASL 1UACL 1J05B 5DD5H 1KG0A 4WFFD 1LO4H 5MI0B 4LPWA 3ARYA 4PJHF 2VYRE 4JKKA 4L9LC 3RX8A 1RHFA 5KSAD 5FKPB 5C2UB 1QFUH 3REWB 3W0WD 3Q1SL 4NKMB 1EGJL 2FB4H 2NZ9D 1CF8L 3SCMD 1D9KD 2BNRA 4XCEA 1TENA 4U1MB 5CUSL 1OLLA 3L1OH 2GIYA 4PUBL 4MQ7B 4ZTOH 3VGDA 3V0AC 4LAQL 1JNLH 1S9WB 4CDHA 2CKBA 4H8WH 4ZSOB 5C0ND 3V6OE 1A6AB 1IC7L 3WKNA 3MRGA 1XR9B 1NL0H 3MLXH 2ED9A 1UCTA 4PY8J 3SJVA 4HJJL 3ZTJH 2AABL 4EUPA 4XB7A 1RIUL 3QXDB 3QQ9C 2OR9L 3JVGA 4XCFH 3IDIA 3WIHL 1NC4D 3MGOA 5C7XL 4J3UA 3DX8B 4GH7B 3QAZB 3D0VA 1HH9B 1RZKC 1YN7A 2Y06H 2XXCB 2AJ3A 3ARRA 3NABL 4HV8B 2BZDA 5BZWA 1CG9B 1HE7A 4E5XB 1MCBA 1JI1A 2H32B 1F3DH 4YHZL 3VFVA 4KRPD 2AEIT 5JW4R 4U1LB 4OCMC 1XCTB 3PWPB 4RNRA 3WUWG 2UYLA 4OJFL 1FZKA 5DFTA 1HQRA 5I9QC 2P8MB 2XZQH 1TVHB 2VDQH 1EJOL 4YE4H 1BFOA 3MV8E 3O6FA 2FLBT 3QPXL 2GKIA 4HULB 3VWKB 4OCXL 4OJFH 1QRNE 4NQXB 1IRAY 1YMHA 4DUWA 5JTWA 3VG0H 3U83A 2F19H 3GMLA 1RFDL 5HGDA 3KPLB 1MEXL 5I9QB 4LSDA 2R2BA 4BFGA 2VISB 3D85D 2KUTA 3IFNL 3KLHD 1G7LB 1T21B 2EDLA 4LLWA 1I8MA 1IC1A 2JB5L 1AD9A 4KVCL 1YPZF 5T1KB 3DXAD 3EO9H 3OJMB 4U1KB 3P40A 4K3DL 5EU4B 4YWGH 3SEPA 1GZPB 1M1SA 4WCYL 3BSZH 4PJAE 1JPTH 2CIKA 3UO1H 4W70A 1MRDL 1K6QL 2R69L 4G9FD 5JIHA 5AZEL 2V2TB 5KVDH 4JFDD 2AJXL 3QHFH 4IBLT 2JF1A 3QCTL 1Y0LA 4YR6A 2WBJA 3GUTA 4ZDHB 2P1YA 2J12B 3VFNB 3VGAB 4Z76B 4JFEE 1XMWA 2N7BA 4OCXH 1P7QB 3UTTA 4KJPD 1ZT7A 5AD0A 5F96H 1TZHB 3RWJB 2P46B 4D0DA 1JF1B 3MUJA 1JV5A 4A6YL 3CFDB 3DECA 4Z77A 4H1LG 2XQYG 5HGAB 3BESR 4PRHB 3D39E 4P2QB 4ZD3L 5GGSB 1MCNA 2PR4H 4Y4FC 3RY6C 3SDCB 4RGMC 4ODBD 4Z7UF 5C6WH 4OCWH 3QSKB 4ODSH 2H6PA 3K8LA 3VCLA 2GHWB 1EFXA 5D7SL 3LY6A 4L4VB 3I02A 5EUOA 5I75C 3A67L 3VXUA 4YEEA 1JBJA 4Y5VC 1E6OL 5I73B 4EZMA 4J7RA 2B4CL 5HYQA 1TVHA 4LVNB 3P9LA 3ARFC 4KFZC 2FWOA 2BNQE 2ZOLB 1JNNL 2GJZA 4MJID 1HHJA 1OVZA 4GFTB 4JKMA 1DBAH 3RWCB 1BVZA 1DQML 4B7IA 3HFMH 2WUBL 1T7XA 5ENWA 2DWDA 5IBUB 2CQVA 1NANH 3O6KH 1RULL 2YXMA 4DN3H 2G2RA 3MV9B 1L0XA 2R2BB 3THMH 1FLRL 3RWDB 2EKJA 4JN2B 1S9VA 1IAIL 4GAJL 3MLSL 4PJAB 3MCLL 5DEGA 4E42A 5DDHB 3MXVL 4KZDH 3QFDB 1O5DT 3G6JB 3QG7H 1QD0A 3MRKA 5EU7C 3C9NA 3TZVA 3V0VB 2Y7QA 4ZUWB 5TDNB 4NNXB 3QIBA 2YD7A 4TVPE 3H3PL 5EBGA 4QHMA 2PO6B 5IK3A 3G08A 4JM2B 5IUSA 3QHZL 4PREB 2XG4A 2EIBA 3PP3K 1ZT4B 2RCSL 2QQKL 2WUCH 4ZS6C 1ADQH 3MA9L 4OSUH 1UQSB 5DJ6B 1HDMB 5DK2B 3SY0A 4HKZA 4KRLB 1I8IA 5TDPB 2DLTA 2XV6B 1CQYA 1YEEH 3WMSA 1IARB 1BX2A 1U8QA 3Q1SH 3MRIB 4EDWL 3GIZL 1JGUH 1PAMA 1MREL 2PO6C 3TO4B 3D2UA 3HPLA 4O58H 2L0DA 3WIHH 1Y0LB 4PGCA 5ICZA 3SE4A 4QNPE 5EC1B 2VXTL 4AH2B 1U8HB 1MCWM 5E8OA 3LB6C 2Z8VC 1F6AB 2YS4A 4JO4L 4RBPH 3RWFB 3T09A 2ZCHL 5I1LB 3QO0A 5C6TL 4DFIA 1A6WL 3KGRA 4P4KB 1LMKA 3S35H 5E8DH 2PUQT 1LO0H 4C56B 2OYPA 4M3JA 5DQJB 4CUCA 4WDIA 4XVUD 1IE5A 2YRLA 1HXMB 1RVFL 2A38A 4LVOC 4X4XA 5A43C 3A6BL 3QDAA 2JIXD 5SWQB 4HX1A 1Y6MR 2O61A 3O11B 2VC2L 4XC3H 4NZUL 4RFOH 2EYRA 2YPLB 3EO9L 4C55A 1UM4H 2VTFA 5E5MA 5HYQB 4G9FB 1FHGA 1PFCA 3MRDB 5DSCB 1DN0B 1FFPB 4OLXH 4UIKH 1Y6KR 1VADA 4PTUB 3BZ4A 2IANB 3IAPA 3VU2A 3OKOA 3QH3B 4PJCA 1I1YA 1IC4H 4L4VE 5DMJB 1TPXB 1CL7H 5IVOA 2DIAA 4JM4L 1V7NH 5E99L 3QUMH 4N8VA 1KCVH 3BP6A 2D7TL 3FT3B 2X4UA 5ERWA 1DQTA 15C8H 1XGUA 5BO1L 2X70B 5BRZA 1Z5LA 1ZSDA 2G2RB 3MV9A 4Y4HA 1UG9A 5CHNB 3AUVA 4H20L 1VGKA 3H9SB 5DGQA 4ENED 5CJQH 1HQ4A 5HHXL 5C0BA 4M6NH 1DANU 5LXGL 5JQ6L 3S34L 1VEMA 5DEGB 1R5IB 4CRPA 4HKBB 3CAFA 2ITDA 4ZAKB 1DEEA 5TJWK 1OT2A 4Q9BA 1ZLUK 1T4KA 1H15B 5C09E 3L3KB 1JPGA 3WHE0 1GJIA 2H2PD 1K8IA 3WIHA 5C07E 4KPHL 4YHIB 2BRRL 5CS7A 1L7TH 1N64L 2ICCA 3FFDA 4JO1L 1N2RB 2BNUA 3B3IB 4NT6A 2KQNA 1HQRB 2GYSA 1I3RA 1T1ZA 3H9HB 5BW7A 1D6VH 4XVSL 3SQOH 1BFOB 4JFQB 5DRZB 5DD6B 3BN9C 2VLMD 4OZFB 5F7DB 5H94B 3GM8A 3O3AA 2Q6WB 1JPFB 2F58H 3RIFF 4J12A 3MBED 2EDEA 4MA1C 2FX7L 4P3CH 1ZHBA 5CD3A 1C16A 1NDGA 5EUOE 5I1CL 7CGTA 2R9HD 5IEHB 4HZLB 3TNMA 4V1DA 1QSFD 5GS1B 5I19L 3DGCR 4P4KD 5BS0A 2HFFB 4YIQB 4YFDB 3Q6GH 1NC4B 5E9DD 2J1KA 4ZS6D 4G7YL 1V8HA 3O0RL 3EFFB 5JW4N 3OPZL 4WWKB 3GSVB 1E4JA 3KJ6H 3BPLC 3NIFE 2W0KA 4MS8C 1MJ7L 3V6FA 5HD8C 4S1DC 4PJDB 4OLXL 2H1PL 2GSIA 4QY8B 4YZFF 4X6DE 1CFNB 2DI7A 4CN4A 3GJFK 4M7ZC 4JG1L 5AG8A 1NSNH 3F7RA 4HPOL 3T2NH 1BOGA 3O8XD 2NY1C 1ZA3B 1ZAGA 3VXPA 3U0WH 4GKSA 1RIVH 2OP4H 3C6SA 3MRRA 2FGWL 3B2VH 4PB0L 5FYJL 4P2OB 3BO8A 1QO3B 3FT3A 2OL3H 5GJTL 3V8CA 1K85A 1BJ8A 3NCMA 3S96A 4FQXA 1AKJA 1FNFA 4HFUL 4OZGE 1NFKA 5I76B 5HHOB 3KPMA 3ZKND 1A5FH 5EZIH 3HG1D 3T3MF 4KGLA 2PXYD 3HRZA 4PJ5B 4OCYL 1VA9A 2E6QA 2F58L 1EZVY 3DBXA 2YPLD 4MHHG 3ETBF 4EN3C 3GMOB 1MF2L 2XKNB 4F9LC 2NXYD 5IMKB 5KS9E 4S1RH 4MJ5A 4OSUL 1VPOL 1UENA 3HI6L 1MUJA 2CKNA 4RZCA 1QSEB 1PKQB 5DC9B 4ELKA 4WEMB 3ULVH 3UXFA 1GVIA 1A7OL 4ZO7A 3VMOA 4MJIB 3STLB 4O51A 3HAEG 4OAWB 4L3AA 2IPUG 4GRWE 3QISA 3ULUD 2CH8A 4LLDB 2EDFA 1BGXL 4PJBA 4N1HB 4IIQB 1I3VA 2E5EA 5C3TA 4C83B 3W5MA 5CEYA 3MRPA 1TIUA 3QWRA 3VWKA 3ZE0F 4M43L 5FK9A 3ARDA 4DKDC 4FNLH 1ES0A 1GC1L 2EDDA 3NH7L 3OR6A 3HNTH 4KZEH 1AHWB 3P11L 3LKNA 3SDCD 4MA1B 1S7XA 3D9AH 1Q9LB 3O4LE 4OF0A 5ITBH 2DLGA 4OCRL 4IOIA 4P2RB 3L3DB 1ZHLB 3QUML 1NC4A 5FYLE 2BVOB 1A2YB 3H2WA 4NWUL 1VEOA 2BDNL 3H9ZA 5MP6H 1UEYA 3JV4A 1CGSL 4XNZB 1LEIA 3MLRL 1AHWC 2VMFA 4PGBB 5GHWL 1Z9OA 5A3ID 4DGVH 3V6FB 4U7KA 1T5XA 4GMTH 1NGQL 1QNZL 1W72A 1F3DJ 5IF0B 4NHUA 2DB8A 3SDAA 2XWBB 1IAII 4U6HB 4G8EB 1FYTD 4Y2DA 1PX3A 2YUVA 3ARTA 4LKXB 1JGVL 4I4WB 4MDJB 4P5KB 2CRIA 1CI5A 5ACLA 1U3HA 2ZWLT 1OP5H 4NQVA 3BP5A 1VFAA 1A7RL 2A73A 3VW3L 2IBZY 5C71A 2W0FB 3ARFB 1CXIA 4M6AA 1GIGL 1KBGL 1K4CB 1CLOH 1H5BA 1AXSB 3TH3T 4PY7A 3QEGL 1GPOH 3EZJB 3OAYK 4P2OC 4I0PD 1FNSH 4XBPA 4NQDE 4M7LT 1EDQA 4PG9B 3RVUD 1OF2B 5EC1A 4H88H 4QXTB 1FBIL 3IAQA 3LEXB 4AJ0A 3WHXA 3N85L 5HYSB 3WS3B 3TNNA 5AWNL 2AV7B 3DUUA 3CDFA 3RGVC 5B39A 4YXKH 4JKPL 2EH8H 4N5ED 3UPAA 4AIZA 2EEAA 1U3JA 4YH6A 1DBKH 3MYJA 3HB3D 4L8DA 1YN6A 3GMNA 2PCPA 1NMBL 4RGOH 3QZWG 4UDTB 3VWJA 3MRLA 1MI5E 5DQJA 5EUKA 3TN0C 1WZMA 4OAWA 1IAOA 2DQGL 3T1FA 3D3VE 2N56A 3WNPA 5JW4M 3V0WH 4R4NC 1TJGL 1NLDH 2NYYC 4FXGB 5D6DA 3H42H 1K9TA 1WIUA 2R56L 1IL1B 1CR9H 3FRPA 2X6MA 5D70L 3SJVD 4X6FA 2DKSA 3RVVC 5I1GH 3BMVA 1RZ7L 4BJLA 4I0KA 1UADC 4EI6A 4D9QE 1LD9B 1H5BC 5J57B 1T0MA 5D7JA 4J6RH 1DLHB 3AY4A 1I1YB 2V17H 1NKOA 5ILTH 1Q0XL 1Q9LA 2XTJB 1U8PB 2X10A 2Q87A 4JKPH 2IQ9L 4OI9A 3D6GA 4D8PB 2BY2A 1XGUB 5D1ZD 3QNZA 1I4FA 2ADGB 3NCJL 2HFEB 1ZHLA 3CLFL 3MFGB 3STZB 1SYSA 3UZVB 1IGYA 3OXSA 4QLRA 1IFHH 5FYKD 4K7PL 1FAIL 1E27B 1G7HB 1ZA6A 1ZLVH 5GGVL 4NRZA 4PRIE 3DX8A 1D9KA 4TVPH 5EBLB 4KKLC 2FEEL 3PV6A 3WJLC 5KSBA 1PLGL 2XTJC 3VWJC 1FVEA 1IFHL 2NY0D 2VDLH 1HXYA 2AKRA 4KJQD 1WEJH 5CGMA 3SDXA 4PREA 1BF2A 4Y2DB 4PRBB 2P8PB 4LCIL 5CIPA 3EGSA 3WKML 4RMSA 1MPAH 3JBG7 3PL6D 5J06A 3LKQB 1NCWL 4WUKH 3E1F1 4U3CA 2J6EA 4X7TB 5EZLA 3MOAH 1AKJD 5E6IA 1BX2B 1U8QB 3HI5L 4X6CF 3GHBH 5D7KD 1OTUD 1NUFA 3LKRA 5CAYB 3R8QA 1BEYL 2Z8SA 3RWIB 3VXOB 5T1LA 1TJHH 1T04B 1TNNA 4PTTB 1II4E 4D9LL 2NPLX 5H94A 5FFLA 1G9MC 1N26A 2WM0A 4H1LB 1F6FB 4OZHF 4HZAA 5CD3B 3RVTC 1FQ9C 2BY1A 3H6JA 4L3CB 1PY4A 5FHBH 2WWMD 4N0UB 4NJAL 2QHLA 4D0CB 4ORZC 1IC7H 4LKCB 4MXWH 2ADJA 3O6MH 5DRNB 3RZCB 4XWGL 4H8WC 5BXFB 3BPNC 5HDOA 3CVIH 1UXSB 3VMNA 2GCYA 1AE6H 1G9NL 2QADD 1AD9B 1HXMA 4JPKL 3L5IA 3F58H 1HILB 2XIDA 1EAPA 4I2XB 1F8TH 3KPOB 4NQDB 1PQZB 3QQ4B 2RR3A 2ITCB 5CILL 4MVBD 3RL2A 3L7EB 5CMAB 4YWGL 2DLEA 4H26B 4Y4HC 3S4SA 1D5MB 3O3UN 1MI5D 1DQLL 1QYGL 4RAUA 2Q20A 2H2SD 4NQED 2NY4D 4J3XA 5F1IA 4FG6D 2JJSC 3SBWC 3KJ4B 3MBEA 4KRPC 4EUPG 1HIMH 4O2FA 4GBXD 3QJFB 2EDXA 3O45A 1EXUA 1C1EH 3RA7H 2OQJB 4FABH 5J7CC 4MA3B 5DRXA 4PLNC 1AQKL 1LP9E 1TVBA 5ICXA 1QSFE 3LEYL 4N1EA 4RX4D 5JHLL 4TRPH 5AYQA 1PEWA 1NC2D 1KEGH 4MVBC 2W60B 1ZGLP 3UTTB 1X7QB 5JHDA 2J5LB 2Q1EA 4GKZA 3MRNB 4AEIL 4QHNB 4FHBD 2W9EL 4NFCA 1GRWA 4JQXA 1N5AB 1YEHH 3EJJX 4TOYL 1I1AC 2ADFH 5HTSA 1KPVB 2EICA 2WQ8A 4ZYKB 1JHLH 5DUML 3V79C 5JDJA 1HHKA 4DUXA 1EMTH 4HJ0D 2OCFD 5C0EA 5C0AB 4XB8A 4ZUVB 5FF6B 1RHHB 4NP4H 3S8WA 32C2A 2FGZA 2CKBL 1XGYH 4LVHB 1AGFB 3ZE2E 1NGYB 2R9HC 4OF5A 3FN9A 2DQUL 1KJ2L 2NY6B 1D5ZA 1FFOA 3WFDL 3T77B 2CIIA 1RJCA 4TN9A 4UIMB 1N59B 1PJ9A 5F6HJ 3TIDB 5IT2H 3WNOA 5T3XH 4YHLH 1IGTB 1AI1L 1SJVA 3NCYS 3DSFH 4AK1A 3NPZB 4L5FL 3T0VA 2G75B 3QIBD 1G0DA 4Q6IB 2ZUXA 2GI7A 2K7QA 1XF5B 4LSVL 3VI3E 4HWEH 2H2PC 2IH3A 1BBJB 3CXHJ 3QUYA 4UT7L 1YNKH 5DC0A 1KJ3H 2JE8A 4H25B 1OPGH 3NA9L 3I02B 1VERA 2XN9D 1UXSA 1F2XK 4YDJB 4F3FB 1K5NA 3UAJC 4DTGH 3DYPA 3UAJD 2DL2A 3OV6A 1P5UA 2D0FA 1TCRA 4JANA 4JB9H 4TSCL 2E7MA 1SM3H 3SKOA 4J3OC 2APBA 3FQXB 3LV3A 2IADB 4OKDA 5B21A 2YD8A 5IESL 4DVBB 4PRAA 3SE3A 3W0WE 2GTWA 2FX9H 1ZANL 4LBEA 4JY4B 1SEBB 3V9FA 5GJTH 2VLRD 3B43A 3FZUD 4JKLA 3CXDH 4NOBA 3BP5B 4FFWD 3I3DA 5HYEA 3O81A 5AYUL 3RVWD 2OTUB 2VXUH 4IS6B 3OKDA 5L2KA 1KT2A 1L6ZA 5AZ2L 4GRWB 4WU5B 1ZANH 4OUUA 4FZ8H 5JO5B 2VE6A 4KK8C 1G1YA 4PRPA 3KXFA 3OJDA 5E03A 2D03L 5DHXB 1XZ0A 4BZ2L 3ZYJA 4JB9L 4TSCH 5AZ2H 2YHGA 4P46C 4PY8I 4LMQE 1BLNA 3BRDA 1B0RA 1JZ2A 3CH1A 2P5WB 1YN6B 4P49A 5D5MA 4LHQB 1HDMA 2QL1A 4QRQB 2JLLA 3L95A 4XP5L 4U1SA 5BVPL 4O51B 2DDQL 1HHKB 2FBJL 3WD5L 4XBGA 5JW4Q 3A0OA 2DAVA 4EQ2A 5JOPD 3O2VH 4JRYD 3S97C 1A1NB 4KK5D 1MLBB 5C9KA 3HZVA 3ILPA 4GOSA 3SQBA 3UJTL 3BRGC 1RZIB 5K9JH 1GOHA 4HLZH 4JHAL 1MCPH 4PRNB 4N0FB 2F53B 4NGHH 1OCWL 1U3ZA 1FZMA 1YEGH 1AFVH 1MHCA 5ESAA 4WW2C 5FKAB 4ELMB 4F7PA 2G60H 1KIQA 4GRWF 5CP3H 1KCRL 1RK1B 4QF1B 1XGTB 4HWZA 2FH6A 5C0RL 4EKXA 5BVPH 1MLCA 4WDIB 1CS6A 3O3DA 4HQQH 3ZKSD 1EZVX 2B0SL 3LD8C 5TQ2H 1HQ4B 2CLVB 4LOUD 3BAEH 1H8OA 1HHIA 1OW0C 4KTYA 3K7UA 2B1HL 4OB5H 1AGBA 3SE4C 1YYLH 3UEZA 1UH3A 4BSWB 1M6OB 4PGBA 4EEEA 1DEEB 1K3ZA 1RJZA 1PX4A 2DM7A 2YN5A 3GIZH 4BZ2H 2JCCA 4PJXB 5GRYA 4QHKJ 3KPRD 1B2WL 3WIFB 3WDHA 2ZSVA 1KULA 2ZG3A 1HXYB 1CXEA 2HTLD 1RZJL 2C4FT 2FBOJ 5F71A 4Y4KC 2VZ3A 4K3EH 1M71A 4G6JL 4HWBA 2XYCA 1WZ1H 2ATPB 4ZPVA 3ZL4H 5DUMH 2DKMA 3AREC 4NT6B 4O00A 1A6TA 4HG4J 5GS0H 1RD6A 4KJYA 3AVEA 4Z78A 4M7JH 3NACL 4DK3A 3PP4L 5DD1H 3U1SH 4EVNA 3NFPB 43C9B 1DQLH 1KB5A 3HC4L 1Q0YH 3TEUA 1YJDC 2UWEB 4U6YA 1DTUA 1ZS8A 4K7FA 5C2BL 3SDDB 4XWOC 2GAZB 3MXWL 3S7GA 3NCEB 4ODTL 4Q58C 2ILLA 4PLKD 5GRZA 3S36H 3ECBB 3EFFA 2IAMA 5IG7B 2QSCL 5GZND 3UZQA 4PP1C 3P0GB 5CP7A 2WIIB 5TE4L 4Z7UE 4CVXA 3GI8H 2CXGA 3FMGH 1P6AB 5LGHH 3NZ8B 1QYGH 4XPTL 5TE6L 1I3RB 5IMOA 1IGCL 4X6DF 1UGNA 3GRWA 5F7DA 1JGEA 3RL1B 1P53A 5J13C 5CSBA 3VD4A 1Q9KB 5KS9F 1MELA 5IWLC 1QSEE 3IDMB 1TLKA 2R4RL 4LSRH 4O02L 5HY9B 5JPNB 1J18A 3C2AL 2VJXA 5E08H 2BSSB 4QXGH 2P44B 4FQ2H 1R3LA 2PR4L 2VLJD 3BEWA 1E4WH 5DJYA 3S96B 4AM0B 2NX5A 5E00B 5B38A 5CD5D 3T3ME 1NMCC 1RK1A 4QF1A 4M4RA 3TWCL 1QLEL 3TCXA 4PRDB 1IM9A 5DHYB 1F11A 5ANMA 4WTZA 3L3GA 1NGWB 1NKRA 1YEFH 2BNRE 4D94A 4G43B 4GRMB 4CVUA 1J8HA 2BVPA 2CJUH 3BPNB 3TT1L 1MFDH 3DURB 3EHBC 5D2LA 4L8SA 1EEYA 3REVB 4P5TB 2DM4A 4BFIB 5IIEB 4UV7H 4LHUB 2HT4D 2CXKA 4XCYA 1U8MA 1DQDL 1V05A 1HEZA 4KKBC 1SJHA 1QNZH 1C1EL 3RA7L 4MQ7A 2OZ4H 3GSRB 1LO5B 1I9IL 1Q0XH 3NCYP 3ROLA 4LF3A 5F7LB 3W39B 3W9DB 3GO1H 2LAGB 1CD8A 3GMRB 3LKPA 2JIXA 5IB4B 4KAQH 4HIXL 5GGRY 3SGKC 5FHBL 3JWDH 4DZ8A 1CICC 4NFBA 3LS4L 3PABA 1KJ2B 3TWCH 5D7LD 1CFTB 4K7PH 4H1LA 3DRTB 1QFWI 3IDJA 1QHOA 1F4XL 5DC4B 3W9EB 4X7FC 2QSQA 1S7XB 1RK0A 1F02I 3W2DL 1H3WM 5I16A 4URTB 3QPQC 2XWTA 3EOAB 3T0BA 1FL5A 1F13A 1OTTD 4LKCA 3V7AG 2LE9A 4MCZB 1WWWX 2YBRB 4FQXC 4QOKE 5F9DC 4RFEB 5HGHB 1OAYL 2GCYB 4NUGL 1S7QA 1LILA 3O6ML 1NANI 1F3RB 5DT1L 3CVHA 3DHMA 3L7FB 2X4PA 5K9JL 4ZNCD 2PF6A 4FQLL 3LKOB 1PQZA 1LDSA 1PLGH 1UH4A 4NHUB 4WENB 4X8JA 1ZVSA 2ZUSA 3IFOB 2GEEA 4JFZH 1J1OL 1ES0B 3B2UC 2AVGA 5D7SH 3T0EA 1IGJA 1FNEB 1TJHL 2DQGH 4MNQD 5FA4A 3KDMB 5TF0A 2HLFC 3L3HB 2P5EB 2V7NB 5KZCB 2XKSA 4X9IA 3F7VB 3IETB 5FOBB 3B6SA 1P7KB 3MLUL 1IKFH 2QQNH 4LLUA 4FXKB 1WGOA 4NZRL 5CLTA 1V3LA 5D1XA 5DFWH 4UOJA 4HXBH 1ETZB 1PKQE 3HN3A 1OT1A 2IFFL 4Z5RB 4NO0D 3A6CL 4LLWB 3P4NA 3RDTC 4OUUB 1OF2A 5FUOH 3BSZL 5B38G 3QBTB 5C3LD 5F7HA 2X4RB 1S5HA 3QQ3B 3CPLB 3W0WA 2MKWA 1RZGB 3SDAB 3ARZA 4TPRL 1U93B 4UAOC 3FRUB 2IQAA 4HLZG 3PHOB 4OGXL 4CBPA 2Z0BA 3MLZL 5HHVL 3ZL4L 1F90L 3I9GL 4YXHH 1FLTX 3DMMB 4G42A 2GJ6D 1WCBB 1T2QL 4JHZA 5JR1L 2VOTA 3QZWA 3MRLB 5E0QA 4HIJB 1U8JA 3FFCB 2AERT 5C0EB 4GMTL 3OF6A 1NC2A 2B1AH 5T3ZH 2WANA 1TMCB 4ZUVA 4HGKC 4PJ5E 5D1ZB 4Y5XA 1RZKH 1AGFA 5GGTA 1A7BA 2I26N 2ZJSL 5L6YL 3HZVB 3ILPB 5I1AA 4U6XA 4I1NB 2ZKHH 4DUVA 2JJUA 3HKFA 4YE4L 5E5UB 2DS4A 4NSKA 4S2SA 3DYOA 4OD2A 2YD3A 3GHBL 2F5BL 3RWGB 5TDOB 4WEBH 1N0XL 4I3SL 1GGCL 3OKEB 1HCFX 2BFVL 1ACYL 1NAMH 4OD1L 1HN1A 4D8PA 1MVUB 4P2QA 4OCSL 5A2JH 5HHNB 5CKGA 5KTEH 3E3QE 2OL3A 4YHLL 5DEFB 3IYLW 2Q86B 3C6LD 3VDAA 4HUVA 1U91B 2H6PB 2I9TB 3PXJA 4YDJA 5I17B 3CZFA 4JZNB 4PGEA 1A14L 4Y88A 4PPTA 3LRSB 2BSED 4PRID 1U8NA 5C07D 3KPNB 2GK0B 4TVPL 1G9EA 2H26A 1RJYA 2KDGA 3PV7A 3FQXA 4HFWA 1F4YH 4KJWC 3GSXB 3QDMA 5FDWA 5LKNA 2ZNXA 4HUUA 3TBTB 2JJVA 1KCUH 2GJ6B 3BPOB 4MD4B 4NHCL 3SKNB 1RJLB 1XF3A 1BOYA 4HIHB 3V7AE 4KTDL 2E6PA 5FO8A 5KSAA 3TZVD 3D25A 1S7SA 5F93C 1SYSB 1QR1A 4XBEH 2VH5L 2ADIB 4OM0L 4QXGL 3TF7C 1G9NC 1KTLB 1HH6B 1WBZA 2AI0H 3CD4A 1CYGA 1ZVHA 2EDQA 5FYJH 1NL0L 1AXIB 4GW1A 5DQ9A 3D0VB 1XF2B 4JY5L 3N0PB 5KW9H 1ZK9A 4W68A 4X0KB 1JTOA 4D0CA 2F53E 2DJUA 1AO7A 1OAUH 1KPRB 2AJUL 1S78D 2X1QA 3PHOA 2VQTA 3VFGL 2HT2D 2V5YA 3KLAB 2L7UA 3ARQA 5CBEB 4WGVB 1QRKA 3WFBH 1EHNA 1ZOXA 2DLHA 1EEZA 2JELH 4OLWL 3KPSE 2PTTB 3QDJE 2AXJA 4R6UA 4OZHB 5ISZE 5BRZE 2P8MA 4R97C 5LAXB 4JM2F 2YD1A 5D8JH 3CU1A 1KJMB 5BVJB 3DPBA 3U7YH 1IQWL 4P4RB 5HDBF 3RIFK 3WUWB 4OIAA 1RZIA 4WO4B 4G8GE 4Z7NF 4LLAA 2ZSWA 5E8EB 3SPVB 1T5WB 2H3NA 4XNQA 1JRHH 1CE1L 2YPKB 3DO7A 4OF6A 2NY3B 1AGDB 2C3HA 1EX0A 1AC0A 1A47A 1OAXL 3B9KA 5D2NE 4G8IA 2H9GB 1TNMA 4CMMB 5BXFA 1G7LA 1DR9A 3HUJE 5IT2L 3SDCC 1B2WH 3R06B 2ZUTA 1BF8A 1ACZA 3MMEB 5DQDH 1QSVA 4NRXB 3WJJA 4X4XB 4G6JH 1QFOA 4JO1H 1J7VR 3EAKA 3SDXF 2A9NL 4U7SA 4F8QA 3WFHB 1S9YB 1XGYL 3JWDC 1QFPA 5I73C 4KI1A 4TNVF 2NXYB 1D6VL 4XVSH 3MJ9H 2AEPL 4Q9QL 3CGTA 2GTZA 5SWSB 1WAAF 1OPGL 2WSKA 2HJFB 4G9FA 4KKAD 1ZGLB 3CC5A 5DYOB 4HFWB 3L3JB 1CU4H 2BHYA 4G9DA 4M3KB 3TA3B 5D6DC 1PY9A 5IMLB 4AQ1B 1MCSA 3QJFA 1FPTH 1SM3L 2E3VA 2Z31D 3RIAK 1A6AA 1A6TB 5GISH 5I74B 4UINL 3JTSB 3PWUB 3U0WL 1ZSDB 4LVEA 3D25B 3SOBH 2EIZB 3VFWA 4JAMB 2UWEA 2D7TH 3MPCA 1KTLA 1D5IL 4R26H 2Q8AL 5M94B 5EOQL 4K2UL 3KPSB 4IRSD 2H1PH 3BXNB 1CGWA 3U36B 1OP5K 4GW1B 4M1CC 3IJYB 1HWHB 4XPFH 1PD6A 3HNSL 4JY6A 2C4XA 4L5FH 2DQEL 5MERA 3BDYL 1C7SA 1FRGH 2FECL 4L9LB 1FN4A 2E6JA 3CDGA 4WFEE 4CADA 4TUOB 3MRFA 3QIWB 5MEQA 4Q2ZB 4N8CH 1JWMB 2J8OA 4WFFE 4DN4H 4WWKD 4ETQA 3DRQB 3VGAC 2ESVB 1A3QA 3LEVH 3HLAA 3FTGA 2MKLC 2BNUB 5F7FA 3OX8A 3UTSD 3CFCL 1U92A 4RAVA 4XC3L 3BYYA 3U4BH 2FX7H 2DI8A 3EUUA 2YPVL 5D5ME 3O3BA 1DQQA 3UPRB 2BVYA 3LMJL 1J10A 4NO3A 2GTWB 4LBEB 3OG4B 5GZOD 2MJWA 3AGVA 4YDIH 1DBKL 3AC0A 5EOCH 1YY9D 4KROD 4PJ7E 5GQBA 4FZEL 4MSWA 5C0CE 1CICB 3CXDL 4NO5A 3OL2A 4GXUM 5E8PA 3SDDD 2VXQL 1KCVL 1OGTA 3KR3H 4HBQA 2DQCH 5FO9B 3CMOL 1YEJL 4NN7C 4KTEL 2VE6B 3H7BB 2CR3A 4PJEB 4X5WA 4DFHA 4BA8A 3R06A 5IB2A 1HCVA 1XZ0B 1C12B 1TCRB 3BN9D 2W59A 3WLBB 1BVKB 5JPMA 4JZOB 3INUH 3AXLB 1QRNB 2BSRA 1DN2A 3RPIB 4TUJB 3D48R 1FFNB 5JW3H 1UM5L 1MJ7H 4LQ1A 4NBZB 1BM3H 4JY4A 4KKCD 1A9EA 1TJIH 5KS9A 3AAZA 3SDYL 2OTWA 4OZFG 1OSPH 4PP2A 4POZC 4GKOA 5CJXA 3PIQB 4KROC 3CFJA 5GSRB 2VUOA 1KNOA 2BVUA 1FV1A 4LNRB 4KJPC 3RNQB 3MACH 2BMKB 5EO0A 5IHLB 1S7RA 2RBLA 1UWGL 5SWZA 3GUTB 2X9YA 4K8RL 3ZKMC 2DM3A 4ZDHA 1JJUA 3PG2A 1U8LB 3PGFL 4WFGD 4ONFL 2QV2A 3LDBC 1ZHKA 3QA3B 3O3EA 1CT8B 3DVIA 3M45A 1CCZA 1L4IA 2VQUA 1BJ1J 5GS3A 4GRLB 4JFXB 2R2EB 4MCYB 3DIFA 3GKWH 3DBXB 2XZZA 4WHTA 3UDWA 4OD2B 3QDJD 4NQCB 3O2DA 5F8QC 3MYZA 4Z7VE 1N6UA 3PJSA 5IMKA 3U82B 1FL5B 3B9KD 4LCUB 4YBLC 1BWMA 5D2LF 1KOAA 5DLMH 1JWSB 5E2JA 3NIFF 1BM3L 2VDOH 2CUIA 4U1IB 5DHVB 4XBGB 1KG0B 5GS2H 1LEGA 1IGFH 2FYYA 1PEZA 4YDVB 3L7FA 1EA9C 5FKPA 2Y4SA 4LSSH 3O11A 5FM5M 1RJZB 3HNVH 1R3KB 2ZUVA 3LCYA 3EFDH 2M8XA 4R2GD 1NBYA 3ISWA 1QVOB 1E28A 1TZIB 2ARJQ 2VXTH 4JJHA 3ARWA 1YNLH 2ENSA 1DBBH 3FB7B 4R7NB 3QAZC 3QDMB 3QUXB 5FDWB 5CZVL 1J0HA 4XVUC 5CSGA 1JGDB 1RUMH 5DJDB 3PP3H 4N5UA 4TTDC 4LSTH 4WW2F 3OJVC 2W65B 4S1QL 4ZQKA 1UT9A 5JNYA 5C7XH 1YEEL 1IZJA 3SE9L 5C0BD 2D7MA 4XT1C 2VDRL 4OQTH 4XI5D 1T7ZA 4U6VH 2Y36L 4Z5RA 3X14B 1FNSL 1E6JL 5CGTA 3C9NB 3QEUB 2NY6C 3GSNH 4HGWB 1FC1A 5FGBC 3W0WB 2BVQA 3VJ6A 4ELMF 2B4CH 2PO6A 3JWOH 4IMLA 3LN5B 1CXHA 3CVHL 2Y9RT 4M61A 1BVLB 1KENL 2IAMB 1D3CA 1VENA 2BOBB 2BSRB 3D69A 1KN4H 4JPVH 1WK0A 4XWGH 2WIIA 5MEOB 1FDLL 1T2JA 3BDYH 4HKZB 4EJ1C 1KN2H 3GJFA 4Y16B 5GSVB 4K3DH 4Y4KD 3BGFB 4FFZH 1OY3B 4NO2A 4M5YL 2CK0L 2VLJA 3D0LA 4RMQA 1T1ZB 4LNRA 2C4FU 5HYJB 2ZG2A 4R8WH 1JK8B 4TNWK 5J0BA 1AXSA 4PBXA 1G6RA 4R96A 4U6XB 1BAFL 4MNHA 4NNPL 1CGXA 3UTPD 5DUBB 3TN0B 1DSFH 1NMAH 3Q3GA 4HC1A 1YEJH 3C5SA 4N8PA 4PG9A 3RVXD 1G7QA 3MCG1 4WUUA 4HZLA 3RY4A 2EXWC 4Y16C 3GO1L 5DMGD 5EFIA 3STBA 4ZMAT 5HHMD 5BS0B 2HFFA 2JCCF 3D9AL 4OLYH 1UB5B 4YDIL 1EIBA 3ARBA 3HE6A 5KJRH 2FLRT 4M9OA 1D9KC 4DGIH 4QT5A 5I66B 5E6ZA 4HJGA 1CFBA 1HYSC 4U1KA 1DZBA 1LP9A 3VG9B 5IVNA 1A21A 4K94L 3KXFE 2XKUA 3MLPA 3G5VA 1L6XA 3GEWB 5GGVH 1VFOA 4MWFB 4KY1H 3RL1A 4QY8A 5D2LB 1MJUL 5DD3L 1T66C 4ODXA 4DKEL 1UZ8A 4AZ8A 1A1OB 4D0BB 2H26B 4L4TB 4XNUH 4LLVA 2UUDK 1A7OH 4TNWF 4O9HL 4LHUA 2AP2A 3U7WL 3OKOB 1NCNA 3OXRA 1AD0A 4QKXB 2WNGA 4ZUSB 2R2HB 2APVA 1DLHA 3CUPA 1MVFA 4O5LL 1CXKA 1A1MA 3W39A 2IBBA 2NX5B 5E00A 3KPTA 1X4XA 3CFEB 1UA6H 3T4YA 4JFDB 4LEOA 3JWOC 4Z76A 2BCKA 4J6RL 3STZA 4ORGA 5A1AA 4UU9A 2IEPA 4JQVC 2ZG1A 4LCCB 3KPQB 5JMRA 1RK0B 1W8OA 4Y19B 4APQB 3QEUA 3KAAA 1TJGH 2IPKA 4ZAKA 1T1WA 5F7EL 5HVGB 1IGCH 3EOAA 2XWTB 1RZ8B 3U36A 4GBXB 1VFMA 2FO4A 3C6LC 3ARPA 3NZHL 5IW1A 1CU4L 2UUDH 3GI9L 2NMSA 3STLA 5SV3A 2ORBH 3ILQC 5MEQB 2NNAA 2GK2A 2WK2A 4XMKH 4KJQC 3HUJB 2MNUA 3PABB 3LIZH 5F96L 4RBPK 1QZ1A 5F9AC 2DLFH 1JPFA 1WWBX 3L5JA 1KB5L 4KKLD 2H8PA 5T1LB 5T5FL 3CMOH 1HHJB 3OR6B 3TYGH 2P5EA 4HMDA 3AM8A 1ZTXH 1UACH 1WT5A 1AGDA 1F4WH 1V3KA 2X4QB 4RMUA 3KLHC 5D1XB 4IDLA 3JXAA 1CLOL 4WI4A 3RUGB 1NFIB 3T65B 3ARGB 4WI5A 4X6EB 4X99B 1G6RL 1T66D 3MRKB 25C8L 3CVHB 5I18H 1YEDA 1XGQB 4KXZH 1PYWB 1I1AA 4JRXE 1GGIL 4K3JH 3T04D 4WVRA 3MJ8A 1T7VA 1VESA 3I3BA 4AY0A 4XGZB 3TJEL 1G7PA 4Z7QF 1VGEH 3WXWL 2PXYA 5DZOA 3NTCH 3H7LA 1LO4L 5D1QC 4L4TA 3UDWC 4P59H 2J5LC 4FQHB 2O5XH 1PVHA 2C3VA 2GY5A 2A73B 2A6KA 3C87A 4P4KC 4LU5L 2NY0B 5D1ZA 4B41A 1QO3A 1N8ZA 4QO1A 2PTVA 3HPLB 4OD3L 35C8H 4MAYA 3D18A 1UJ3A 2QEJA 3L1OL 1WT5C 3IS0X 5HHOA 1TVBB 5ICXB 2YRPA 4BQ8A 3ZDZF 3F5WB 5TH2A 2WZPD 2FL5A 1CT8A 4OFIA 5F9JA 4O5LH 1NLBH 4MCYA 2Q8BH 4QXUH 3ABZA 1UA6L 1NCDL 2ZPKH 3U9UB 5GIRB 5J12C 2XQBH 1JN6A 3WD5H 1BIHA 1NJ9A 4GBXC 2QQLL 4LQFH 5HDQH 5KAQF 1QEWA 2UVFA 3GNML 4G6MH 4HKXB 5D7IF 4HUVB 4UIKL 1JGLH 1P4IL 2EYTB 4G7VL 2YRZA 1QA9B 2R4SH 4M7ZB 5IJKA 4WW1A 2DJ4A 3MRQA 2VZ1A 4XVJL 4I3GA 1TCMA 3L6FB 3OB8A 5INDB 3BVNB 5IQ9B 4WUUD 3BZ4B 4F7CA 2CRMA 1RIUH 3BIKA 5E94B 4KPHH 2VWEE 1RPQA 5I8EA 4LCWB 3GMQA 4U4BA 1AHWA 2Z31C 1NAKL 3P4MA 2Q76A 3HC0B 3RWGA 1HWGB 1UXWB 4DAGL 3VD3A 4MQXD 4XPGH 1KLGB 5H37H 1P4BL 3QR2A 1UCBH 1E4XL 4JVUA 5FO8B 4NZJA 4MJIE 4UV4L 3DX6B 1YDPB 2AJZA 4HCRA 3DARA 2P7TB 3BZFB 2YA1A 3QUYB 5A2KH 4JQVA 4W6XB 3SKUD 4UOW1 2JJTC 2N1KA 3BWUC 4LHJB 1V7ML 4NN5B 5KVFH 4JDVA 1MIEH 2NR6D 3FL7A 3RY5A 5I1KH 2VZTA 2DTML 3FOMA 5FB8A 1JF6A 2LV4A 2XWBA 1AO7B 5FUCE 4YHYB 2AS5M 5DK3A 4M03A 5JHDD 1CL7L 1RI8A 1U41A 6FABH 1MFCL 3RPIA 3L3IB 3WBDA 5DA0B 4I9WE 4IIQC 2R0WL 1BECA 3BI9X 5KS9B 4HH8A 4HWNA 3MUGA 5C8JA 3I9GH 1XF3B 3BUYB 1FYTB 3ARFA 3QO1B 2WWKO 5GSVA 5JXED 5ESQA 2B5IB 2OXHA 2OSLA 5F1NA 2VSDA 5J1AB 3UTQB 3GSNB 4G5ZL 2EYSA 5IB3A 5FHAL 2D7PA 1JZ5A 3CFBA 4JGJA 43CAA 4O2CA 4NZTH 1YA5A 2FJHA 3MQIA 1IAKA 3LQZA 2X7LA 5D72H 3WS3A 5F9JB 2AK1H 1I8KA 3VXNB 1N3NA 1IAIM 3HMXL 3MV7B 4M6ML 3V4VL 1UB5A 2AJVL 3U9UA 3N50A 1S7UA 3CJJA 3DV6B 4MMZC 5CBEA 4QRUA 2A6JA 3EO0B 1QPPA 4UDTA 2A9MH 4G8GA 5HVFB 1J1OH 2CPCA 5EN2B 3QRGH 4RRPG 4YHMH 1Z2KA 1K4DA 3G5XA 1SYVB 5E1AA 5ACMA 4XX1E 3RDTB 4WI3A 2IFGA 1M7DA 5IP4A 1JPSH 3L7EA 5DO2C 4DTGL 5GGUA 1JZ8A 4NUGH 3FQRB 4JFFE 3VXSE 4FP8L 4GW5B 4TSAH 4DWHA 4Z6AT 1FZOB 4HS3B 1Q72H 2V2XA 3E6FA 3TN0D 3VE0B 1AY1L 1HSBB 3P4LA 4M6NL 4Q9CA 1U58A 2UZIH 3CK0H 3P4MB 2Z31B 2ZOKA 5D7IB 4L8CA 2AK1L 3IDUA 1U8PA 4LSUH 5FO7B 2Y06L 1ORSA 2ZUYA 3KHQA 2VSCA 4LSRL 4O02H 2HFEA 1V5JA 5HDLA 5JIIA 2AJZB 4MAUH 4NRXA 5I15L 3CX2A 2IANE 1Q1JL 3I6KA 4DCQB 5C92A 3KPQA 4AEHH 3THML 2EKSA 3EJYD 4XPHH 1O7SA 3BEVB 1MUJB 1X4ZA 1QSEA 4FQ1L 3DETD 4GBXA 4XHQA 4O2EB 4ZFGH 1FG9C 5JORB 4LOUC 4K3GA 4IHOB 3PXHA 1R3HB 1Q72L 3BD3A 1P4LB 3MREB 1A0QL 3D69B 2ZCKH 1A3LL 3O8XB 2YXFA 3IRZA 5JA8B 2QR0B 1MQKH 5MENA 5C1MB 5TFSH 4D3CL 3FOLB 4L1DA 1MFDL 4NQSA 3UJIL 4X98A 4G3YH 2NZ9C 4RISL 4ONHB 4Z7UA 5CJXC 3EYQC 3F6LA 4JO2L 4C54A 4N0CC 5KSAC 5JDSA 2BOCA 1G6RB 3JV6A 5DWUH 4LMQI 5LWYH 5IM7B 3O4OB 3S36X 2Y23A 3DYMA 3P73B 1KB5B 2G9HB 4HWBL 1ZEAH 3RWHA 3CXHK 4GQ9H 2VL5B 1C5DA 2P48B 1BFVL 4X5LA 5DWUL 3QEGH 1HH9A 5HYIA 4YFLI 1HKFA 3HS0A 4GUPA 1B90A 4LNVA 4AEEA 2ICWJ 4DAGH 5DJ0B 3CCHA 4BQCA 2X4TB 3QIBC 3L3OB 4YDLC 4RA0C 5CLWA 5GRVK 3MRFB 3QIWA 4J8RB 4Q2ZA 3O4OC 4RMWA 5IHZA 1JFQH 1IEHA 3E8UH 3MJ6A 1JGVH 4HJGB 2V9RA 4GAGH 5INCA 4P46D 4R90H 2PW2B 5FECA 1MNUL 1WAAA 1WISA 1Q9WA 2W9DL 3MBXL 2IGFL 5HSFA 3BP7B 3O6FB 4WHCA 1MCEA 4NO3B 3F58L 1IGFL 4QRPE 4DKFL 3FO9B 4KGJA 1AO7D 1VFAB 2WQRA 4ZO8A 5HHPA 5EO9A 1CDBA 5DXWA 5HGDB 4K2UH 1I1AD 2CUMA 3UBXB 1U58B 3QDJA 5SX4H 3RX7A 3HNSH 5DEZA 1IT9H 1LO2L 4P23A 1HHHB 1MRCH 1OAZL 1Q1JH 3VG0L 2UWEF 5DJ2A 5C09A 3H7BA 3DX9A 5GJSL 3QFJE 1RZ7H 4MYWB 2NXZC 3LB6D 3T3PF 5L88H 3MLXL 3NACH 4GKZB 5LJYH 1F42A 2QJDA 3MRNA 4HH9A 1ADQA 4V2CB 2A74B 4I48A 1T1WB 1IZKA 5EZJB 4I5BB 1JYXA 3DURA 4KHTH 5CSZB 5TF1H 2X89A 1JN6B 1A9EB 4OIIH 5EORH 4MA8H 2VABB 4IHOA 4OV5A 1P5VA 3L95B 4GG6B 5T33L 4EXPX 2GSGB 2KBGA 4L3EA 5L0QC 5SX5K 5DJZA 5C0CB 3F7QA 3G6JE 2NXZD 5DS8A 5E9DE 5BJTB 1MFBL 2V5RA 1A4JB 2VKWA 3BVNA 2AEQH 1I9JH 1RUKH 2HP4A 2VLKA 1I3GL 5FOJA 4EI6B 3K74B 3I50H 5E94A 1OP9A 4MS8D 1J1PL 1JGDA 3MROB 2GY7B 3WYRA 4RGNB 1ZGLM 4Y2OA 4HGMA 1KGCD 3H0TB 5AEAA 1JF1A 3IU3B 3WN5A 5E2UH 2BNQD 1OD7A 3SDDC 1MJJB 2HT4C 4GUPB 2K3TA 5DVNA 2KPNA 2LVCA 3WEXA 5GZOC 4YDLB 4LIQL 2ICWI 2L4OA 1XF4B 3UZEA 1RUQH 4JFEA 1A3LH 12E8L 5J3HD 1NSNL 3FCTB 3V6ZB 2C5DC 4MGXA 4Z7WE 4XMKL 4WEUD 3REWA 1K8DB 3GSNL 1LGVA 1XGRB 3IXAA 3LN5A 1KTDB 2DM2A 2R1YA 1BMGA 3QXAB 4XMLH 3PL6C 3GI9H 3G9AB 3MUHL 5ISZD 3MRCA 1DDHA 3SCMB 4X4YB 4ZFZB 5DJDA 3TO4C 2UV3A 5T3ZE 4CDGC 3GSQA 3X3FH 4QRRB 1H8SA 5CZXC 5FYKU 1BQHB 2EH7H 1BQLL 5EZLB 1IAMA 1EGJH 3TVMA 4FXKA 3NBNA 3UBXA 3PWNB 4XTRD 1BD2B 3MRGB 3U4AA 4X7SH 2GT9B 3VGEA 5F1NB 1BBDL 5L2KB 8FABA 2CRYA 3QG6A 5DRWB 5E2VL 2KH2B 2NW2A 1YC8A 43C9A 2NTFB 2IH1A 1KJ2H 2J8UE 1TQCC 35C8L 2R29H 2NY7L 2CR6A 1UKTA 4HH9B 1QACA 3PE9A 3WIIL 1I8KB 2CGRH 3VXNA 4NC1E 3RZCA 3ARBB 2BOBA 1HOCA 3UCRA 2P49B 3CH1B 3LPWA 3OKNB 2ZUUA 4M48H 5GGTH 3RAJL 3MLVH 5I66A 4PG2C 3NAAH 1H0DB 3HZKB 2EYTA 1NCDH 3ET9F 4P2CG 4WW2A 5B3JF 4NO2B 4S1SH 1BP3B 1VPOH 3HI6H 3TBSB 3NFSL 2FX8L 4ONGL 1MIMH 5FGBA 4PJFE 3RDTD 1WF5A 1WBXA 3KXFD 1CE1H 1PSKL 5DS8B 4JREC 1DVFB 3Q3GB 4L4VD 3TC9A 2ORBL 3TYFB 2YMXL 5H2BA 4BSJA 1FZMB 3AMLA 3PWJA 5F1IB 2BSSA 4AIOA 2R0ZL 5I1IL 1G7IB 5J6HA 5KTEL 1L7IH 1I85C 4ELMA 1WBYB 3GJFH 3QCUL 2O5XL 1I1CA 1A1MB 3VXUE 4L8CB 4X6CB 1BQLH 5AAMA 5I1IH 2X42A 3FAWA 3TCLB 2OL3B 4X80H 1P69B 3OZ9H 3KNBA 1IM9B 2YPLE 1P9MA 1I9RH 1LVEA 3RVUC 3UTPE 1EO7A 3ZHDA 1BJMA 4GRLC 3BUTA 1RZ8A 3IRPX 1J0ZA 4ZXBD 2JCCB 2GK0A 4IDJL 1V7MH 4X80L 3REVA 4IEFB 1R6VA 4UQ2B 3MLZH 4OKVB 5HHVH 1M7IB 1XIWA 1DFBL 1KCSL 2ADFL 2BSTA 4MA7L 3UMTA 3ZSTA 4M48L 3RAJH 1JHKL 1TETL 1VKXB 1GC1C 3BUYA 5IBLD 2EDBA 4NZDA 4JLRB 1D5BB 1X5FA 2Y1VA 4NQSB 4NKDA 4JDZA 5L2JB 1P4BH 4Z78B 5F3BB 3MODL 4QTHB 4FFVC 3LIZL 4PJBF 5DRWA 4O2CB 1CFTA 1IGTA 1RUQL 5MEPA 1UZ6E 1ZT1B 1D7FA 3MUZ1 3BKCL 5IROA 3D85B 5C07B 4NQUA 5HVHC 4WO4C 1UWXH 3L9RA 3L3OA 4MA7H 3QI9D 4I0PA 4L9DA 4A6YA 4D9QD 2DJSA 2FSEA 4F3FA 3G5YA 3PWPA 4KV5F 5AUMA 4YXLL 1K4DB 1OAUL 2XZAL 2XQBL 2D3VA 2CDEB 1HINL 5I6XC 1A64A 3FT2A 2C3WA 2I5YL 4AIXA 4LPUA 4OZFA 2WP3O 3V5DA 1C5CL 3HG1E 3S4SG 3PDOA 2OXGA 1MHEB 4HUWA 3SOBL 1IGJB 2MPAH 3NCJH 3RP1A 2HH0L 4EN3A 3DGGB 4HS8L 2IAMC 2V2XB 3MLWH 5J11B 2X4QA 3RWEB 5EO9B 5KVGL 2BJMH 4NPYA 4LK4A 3IDYC 1SQ2N 2YD4A 1NFIA 4IS6A 4PJ9B 2EDTA 5B38B 3HFML 2X9WA 4D9LH 1YNTB 3I50L 3EYVB 4HWUA 4OBRA 1LNUB 3L3GB 3SO3B 3KNBB 1H3GA 3SE8H 5T1MA 1A6ZA 2GQHA 4MQSB 1KN2L 5DA4A 1BLNB 4PP1D 2COQA 3QUXD 1OSPL 1ZLSL 3LSOB 2VDMH 1T83C 4XCCH 3O9WA 1DP0A 3AMKA 3LHPH 4U1SB 3X13B 3ILQD 4OCWL 1SMOA 2HMIC 4XAWH 2VO5A 1QA9A 3NVQA 5J4MA 1F90H 4L3EB 3QRFM 4WW1B 1KFAL 1OAXH 1YYMH 2WBKA 4GS7C 4K23H 4UILL 5DJZB 4ONHA 4Z7UB 5I1DB 4WI7A 1T1YB 2DWEB 2R29L 1WFNA 1X5IA 1CDJA 1S7VB 3FB6B 3KHOA 4O58L 2Z35A 4FTVA 5EU6A 1JV5B 5FYLD 1ZLWK 5I1LA 2DBLH 1NFDE 1WUNT 5ETUA 4E41B 1NCTA 3RI5K 3ZHKA 2R8SL 1FJ1A 5DT1H 4HG4K 4RZCB 4JY6B 2Y5TB 3GSUA 2HVJA 4C56A 1QEWB 3GB7B 4M62L 2ZCKL 3IDGA 1A0QH 4P5MB 4LVOB 5T1LD 1U91A 4CADB 2F54D 3EOBB 3ZKXB 5HGBA 1K2DB 4JFEB 3QEQD 3BWAA 4GW4A 1N7ML 3DRQA 2D31B 2EDHA 4UT9L 3WSQL 4G6AC 1Q9WB 4M5YH 3MACL 4JO2H 4P23C 4JQIL 3L5HA 1LEKA 3ZTJG 3FT2B 4HEME 2VQ1A 2FEDD 4B50A 1AE6L 4ZUTB 5DSCA 5IFJB 4NN7B 2V7HB 5FK9B 3PDDA 4YFEA 5HI4D 4MZ3A 3GI8L 2EO1A 1CDGA 1BZQK 1EO8L 2W92A 1QRND 4OCRH 2YD6A 1Z9MA 4XP9L 3BIBX 3IFNH 4KDWA 4YXKL 4GMSH 3QDGE 4MSWB 3TVMB 5I1EH 5AWNH 4X6DB 4P23B 4Y5YA 1DANT 3NA4A 2OM5A 5DDHA 43CAB 1X5LA 3QFDA 3PGFH 3MO1A 2NTFA 4QRPA 3HUJF 3WNLA 5DI8A 1RZFH 3QIUC 4UINH 4DQOL 5MHSD 2YR3A 4HKBA 4EI5B 2CLZB 3SGJC 5CIPH 4K07A 2NX5D 1LE5A 3TVMD 1E6OH 4F33A 1IGIL 3MV7A 2OR8A 3EFDL 3QDME 2VDQL 5D7IE 3WL9B 1MPAL 5JPMB 3K8KA 3L3IA 3V6BR 4GT7A 4PYHA 1X5ZA 2VABA 4K8RD 3O9WB 2RFXA 1ZV5A 5TF1L 4N68A 4H0IA 3X13A 4ZFFA 1QPXA 1OM3L 3ZO0A 2NY2B 5F6HI 1UM6L 1AJ7H 1M7DB 2ESVD 4UB0H 4BUGA 5EBWB 1PG7X 3BJ91 3FHQA 5BVJA 5ICZB 1IMHC 1S9XB 4OTXL 1KCRH 4KK9C 4XXCA 1T5WA 2H3NB 2YEZB 5H2BB 4KZDL 1QP1A 4WIQA 4Z7WB 1WWAX 3QFJD 4HS6A 5IOPB 2SEBA 4OZGF 1DQJA 3GJEA 5GGSY 1RMFL 4PB0H 1F5WA 2FGWH 1HK6A 1CD0A 2V17L 3PWPE 4K8RH 5ILTL 3MNWA 4X6CA 2HT3C 4GMSL 3R0NA 3T8XA 3CZJA 1T2QH 3QUXC 4ZG1A 2R0WH 5EDXA 5ANMB 3VWJB 1FDLH 1HNGA 2D7QA 1MRDH 3VXTA 5T3XE 5I17A 3H42L 1N6QH 5D8JL 1CD1B 2BY0A 3UX9B 3KS0H 3LZFH 4ETYA 5C2BH 1AXTH 4RSVA 3BGMB 3S3SA 4K71C 5JXEA 1E4XI 1T83A 4P48A 4HIIA 1EEUA 1YEFL 1RJYB 3AS2A 3VFOA 1LEKB 2VQ1B 4ENEC 1ZGLA 4GAFB 5CKAA 1B6UA 3QH3A 4XCYB 4BSVA 5DD1L 4R7NA 3MOBL 2YUZA 4F37F 2WBWB 2Z31A 2ZOKB 4XVTH 5KSUA 3BQUA 3TPUB 4UUJB 3PWNA 1ORSB 1WLHA 5DVMA 4A6YH 2R8SH 5D71L 2A77L 1QR4A 3KPMB 4OM1L 4CJ1A 8FABB 4HXAH 5DQDL 2NW2B 2OMBA 2X9XA 4N9OB 5A40E 1XIWD 3T2PA 1NEUA 2NY5H 4LRNL 3BGFC 3RWJA 2VZUA 3BEVA 4OFPA 4CW1B 4L4TE 4U1NA 3QIUB 4JPIA 1TZGL 3ZDYE 2AQ1A 4PLJD 3ALXA 4RRPA 3IJYA 1J5OH 5EU6D 1X6NA 5JORA 1T4KB 3OTTA 3CCHB 2DMCA 4N90E 5TFSL 4LEXL 2XN9A 4L9LA<