5I30L

Crystal structure of the human astrovirus 2 neutralizing monoclonal antibody pl-2 fab fragment at 1.9 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTFPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab PL-2 light chain
publication title De Novo Sequencing and Resurrection of a Human Astrovirus-Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 60
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i30L01
1C08A 5BO1L 3NTCL 1A2YA 5FV1L 4PJ9C 5C0DB 1FVEA 4JY6B 2H8PB 5T1DL 3IKCA 1P1ZB 2FBJL 1HDMA 4JQXC 1I7UA 3LHPL 4UTBL 3QXDA 3RBSA 3ZTJH 4RFEB 5HHNA 4D9QE 1P7QA 4LSTH 2R56H 4MAYB 4UQ3B 1F4WH 5A40E 4EOWH 2DQJH 3BAEL 4ZFOL 1JNNL 4CVUA 3UTZA 4NO2A 3X12B 1LEKB 3GMMB 5HDQH 2MCPL 3VI4F 4CDGC 4OJFH 2XACC 4X4ME 2NX5B 4OZIA 4NM8H 1ZHKB 4C54A 1WAAA 3CX2A 1F6LL 4PGCA 2BC4A 4DVBB 2VQ1B 1DN0B 3RU8L 3CFCL 3MV8D 4X98B 4J6RL 3IF1B 3PDOB 3W82A 3LKOB 4YHKL 3GM8A 5K9KB 5BV7B 1T1YA 5C0RL 4XNUH 4JHAL 2FO4A 2WIIA 3PWVB 4Q0XL 3FQXA 4XB8A 2EYSB 3VGAC 2JB6A 2FLRT 2VH5H 1MREH 2H9GA 1SJHB 5HVHB 3EYSH 3C09C 2YMXL 5C0BA 4LCWB 5FYLL 2FEEI 3G6AB 1K2DB 2VXUL 2ZOKA 1MVUA 2Y5TB 4H88L 4ZSOA 2CUIA 2A6JA 1OP5K 2HJKA 3MYJA 1GHFH 4PJFB 4QTHB 4JFED 1D5XB 4U1JB 2AXGA 3K4AA 1KEGL 1WT5A 3IT8D 3MGAA 4JPWH 4OCNC 5FF6B 3BPLC 3K46A 2WMPA 4JDZA 4ZPVA 4ZFFA 2AQ1A 4J23A 3ULUE 3CAFA 4EDXA 5I71B 4FFYL 5EO1A 1RUKH 1JYNA 4LRNH 4TYUA 3BOVA 4MDJB 1SEQH 3P4OA 4WFFD 2EDJA 1FNLA 2VDLL 3BUYB 4R7NB 3E8UH 1BVLA 1DUYA 1EGJL 5HI5D 1UCBH 3OAZK 1DANT 2OSLB 2QQLH 1QLEH 4EI6B 4MA7H 4UDTA 1CGSL 1IM3B 4KUCF 1H0DB 4Y4KC 1CF8L 4I48A 1D6VH 3MA9L 1VACB 4UV7H 3HLAB 1K3ZA 1MNUL 3IJYA 4JLRA 4MD5B 2Q8BL 3KJ6H 4K23H 4L5FL 4Q6IA 2FIRT 2NY4D 4JFXB 3P4MB 4NCDA 4HIXL 5F7UA 5DA4A 1LP9F 4KY1H 4K7PY 2A38A 4O02H 5IM7B 3V4UH 1KCUL 4JN1L 3HFMH 3BN9C 4WI4A 4NHCL 4WU5B 3AU1A 3ARBA 1XF5B 1BJ1J 3PWUB 3QUMA 4UILL 4Y4FC 1VEPA 4GBXB 5I2IB 1XF3A 2P49B 4WJ5A 4HCRH 1A14H 3ABZA 1RVFL 4MWFB 4W4OA 4FFVD 4YFEA 5MENB 2MKWA 2AI0L 3SO3C 2Z92B 1J1XL 4H20H 5DRZB 3ULVE 5A2JH 3AFLA 4HXAH 4J8RB 4KK9C 5CINL 3VJ6A 4XBGB 3QEQA 2WP3O 1U8LA 3GMQB 1F3JB 1LO0H 4JDTH 4M62H 2VJXA 2I07B 2ICEB 3KPSA 3QNXB 1JPSH 2UZXB 2PTVA 3FB7B 4GJTB 2CKBB 3NZHL 4HUXA 4M6AA 2DLFH 3ZKND 1NCDH 4I0PD 4RGNC 1JGDA 1GRWA 3CMGA 4JY4A 4PJIB 5CGMA 4LCIL 5GGTL 2W60B 3OZ9L 3T08A 1KLGB 3ZKMC 3BEVA 3TPUA 1IGFH 1MIML 1C08B 2LQRA 2RR3A 5CCKL 3OXRA 4PRHD 3RJDA 5JLZB 1MY5A 1FVEB 5L8KB 4LNRA 4F37K 5EBMA 1CL7I 1YJDH 4X6CA 4S1RH 1GAFL 3GRWA 3QXDB 4TSBH 5IQ7H 4K3DH 3NIFF 1A4KA 1L9NA 3QZWG 5GGVY 2VAJA 5JOFA 4H1LA 2JIXB 4D9LH 3SDDD 4K7FA 2Q86B 5A3IC 4HV8A 3UTZB 4NO2B 3PWPA 1I3UA 2FB4L 5DYOB 5DMGC 2QL1A 4X8XA 3SDAC 2FGWH 2IG2H 2X4TB 4Q2ZA 5I66B 3NIDE 3QNZB 5DVNA 2EDOA 4RIRA 4PGCB 4PGDB 1J88A 1NCCL 1A6WL 3NIGE 1FJ1B 5GS1A 3VWJC 4U1HB 4OLUL 4XCYB 4XBEH 1UYWL 1RZFL 5EU6D 4R8WL 2VDNL 1S7VA 2JB6B 5JHLH 5C0IB 4GFTB 4LU5H 4OFIA 4AH2B 4DKFL 1JL8A 1R0AH 5ALBL 5GRZA 4X6CF 3VRLF 3LN5A 4LRIC 2NNAB 2VLKD 2C3XA 1FNSL 1MVUB 1GGBL 1UJ3A 3L5XH 4PJEA 4JGMA 2VDQL 4H1LH 2P5WA 4PV8A 4F7EB 2HJKB 4PJXA 5FYJD 4M93C 3BPOC 1AIFB 4LSPL 5DD0L 1MEXL 3L9RA 3C5ZD 4HMDA 1IC1A 2AXGB 2OTWA 4LMQE 1LP9B 1QKZH 4PJ5E 3DPBA 4ZPVB 4JDZB 5D2LA 2AJZA 3EO0B 3O6FA 4ZFFB 2GITB 4LP4A 1FL3A 1LE9A 3MBED 5GS0C 4KTDL 4ZYKA 3MNVA 3G6DH 3QI9A 4CVXA 3WMSA 1A5FH 3FB5A 2EDXA 2JJVA 3X14A 2DWDA 1DDHA 4NN7B 3VFMA 1YQVH 2WP3T 3EOAA 4DVRH 5I16A 1BVLB 5IEKA 1BEYH 3RGVD 1QRNE 4ODWB 2EDYA 3OWEA 4G43A 5KJRL 1FZJB 2MQ0A 5FGBC 2IPUG 1I9JH 4XNZC 2DQUL 4DZBA 4I48B 4I2XE 3DV6B 4JM4L 4QTIL 3KG5A 5DHYA 3IJYB 4ALAH 4FTVB 1YEIL 4RAUA 3TZVA 3AS1A 4KPHL 5FHBH 4CADA 1TJHL 1OWWA 2UYLA 4Q6IB 2IGFH 1EH9A 3HZKA 4ZODA 1QZ1A 2DRUA 3KYNB 1G9ML 4JO4H 1MHHA 4LHUB 3L3KB 4JPKL 5I0DA 3UO1H 5D2LF 2AJ3B 4NUJA 4YK4B 2X1QA 3T04D 4CJ0A 4H5SB 3ARBB 3QUMB 1VB9A 1G9MC 3ROOB 4JCLA 1JPGB 3CVHH 3KR3L 3SKUD 2AAVA 2VXTH 4P4KA 1U8NB 3DV4A 4XXCC 1MQKH 4MAYC 2O5ZH 1GZPB 2QTEA 1MCJA 1RJZA 2KQMA 3U7YH 2QEJA 3PV6B 4D8PB 2E5EA 4LLWB 4KKNA 2I5YH 1U8LB 4OD1L 1KJ2H 4WNQA 1E4KC 4IRSD 1JIBA 2R1XB 1NCTA 4Z8FL 3VE0B 1ZGLA 3GDBA 1WVZA 3QUXD 3HMWH 4XX1G 4PJHA 3KWWA 2HT4D 2FGZA 4GUPA 1YQ2A 3VU2A 4KU1A 2GJZA 3S88H 4HWBL 1HCFX 1N4XH 5BV7C 4WW2C 3GMRA 3TPUB 1CGVA 4W6XB 3W5MA 4RAHA 2VAAA 3OXRB 5JHDA 4L8BA 4Z7WE 3M1BA 3NCEB 4RFOL 5B8CC 4LNRB 4WEMB 5EBMB 4M7LL 1QVOA 3N1FC 5C09B 1BGXH 2WQRA 4OCRH 4X6CB 1EXUA 3HPLA 1NKOA 5CEZE 1CT8B 1TTGA 4MQ7B 3WLBB 3FFCA 1WISA 3A6OA 4RWHA 4KGLA 2EXWC 5TJWK 2EZ0C 1O5DT 4K7FB 2WBWB 1A8JH 3UTTD 2QHLA 2LU7A 4KKBC 4NQDA 1BOYA 5J1AA 2VISA 5SWZA 4NQVA 4X9GA 4NZJA 2VE6B 4RIRB 2ZNXA 1ZVYA 5TE4L 4KK6C 1HI6B 3DGCR 4WWID 5KSAD 3ZTNH 3QFJE 1NCWL 4NYLA 4TPRH 4QYOA 1T7ZA 1W2KT 4HK3J 1MCRA 1K3IA 3RY5A 2DLIA 3L95A 3Q3GA 4OUUA 3VGHA 5ACZA 1S7VB 5B4MC 1P2CB 4BELD 4OZ4A 3QXAA 4OI9A 1WITA 3GI8H 3LN5B 4FABL 3VWKD 2ZUSA 5T3ZE 4MXQD 4M43H 1UJ3B 1CGWA 4GW1B 2E9WA 3LKQA 4YXLL 5F1SA 4PV8B 4NO0A 4YR6A 5HBBA 1OT2A 1RIUL 5IFAL 4UBDD 4QHLA 3L9RB 3K3QA 3X11A 4HK3N 4F58L 1KG0B 2Z93A 5D2LB 3MJ6A 3O6FB 2GHWB 5INDB 1Q9WA 3WO4B 5T33L 3BP5A 1BFTA 1S7UB 2VDML 1IC7L 4ZYKB 2L4OA 3MNVB 4FXLA 3QI9B 2XXCB 4CVXB 1DVFD 1BM3H 3X14B 2DWDB 1DDHB 3VFMB 3BRGC 3EOAB 5I16B 4PRID 4TTDD 1V3LA 2EYTB 1E0OB 4G43B 1JGLH 2HVJA 3MLSL 2D9QB 3MUJA 2GTZA 5KVDH 5DHYB 4GXUN 4YHZL 3O4LE 2GJ6A 4EEEA 4U6HA 1V7MH 3TZVB 3BPNB 4Y8AA 1YNLL 5F97E 4FRWA 5FO9A 5DK2A 2DQTH 5BW7A 3ZMRA 4IJ3B 5GJTH 1UKQA 2HLAB 4CADB 1JPFB 1T03L 5CILH 2UYLB 5CP7B 4PS4H 2HVKA 3K1KC 3SDXA 3GFUA 2JK5A 4O2FA 5E2VH 5MEQA 1MHHB 3PDDA 3ROLA 3EGSA 1UB6B 5IB3A 1HHJA 3DHMA 3GGWA 5JW4Q 3QA3A 1GOGA 4NUJB 3ZE1F 1G7JA 5JO5B 3NIDF 4JZOA 2YD6A 3FN0L 5IHBA 1RJCA 2AJSH 1PYWA 3I2CL 7FABL 5ICYA 4OZGA 3SGJA 2Z31A 4KQ4H 3OR7A 4ORGB 4TNVF 3WS6A 1RQ5A 3MXWL 4P4KB 3DV4B 3V5KA 3EDDA 4ZOAA 1RJZB 1J0HA 4JO3L 1SVCP 4YDJA 3WIHH 4AZ8A 1ZVSB 4LEXL 5FA3B 5FYKE 4ZTOH 1MH5A 1NMAH 1KENL 4WNQB 1RV6X 4YDKL 4YDLB 5DVKA 1FNGA 1VADA 5TF1H 3D9AH 1ZGLB 5D6DA 4Z0BL 3SJVD 1S5HA 2ADJA 3VFGH 5C2UB 4HAGA 4X99B 4K7PH 4LGSB 3I9GH 1I8MA 3ZT7A 4M4PA 3IDMA 4GUPB 3RWFA 2NZ9C 1X5GA 4MQXC 1CU4L 3SKMB 3T0VA 3V6OE 5LGJB 3CSBA 3X13A 5IGXL 1RZGA 3LRSA 5DRNA 2YKLH 1KC5L 3S5LA 2VXQH 2BVPB 4NWTH 3WL9A 5GRXG 4WWKD 3MYZA 1K8DB 4D0BA 4L8BB 4DJMA 4Y2DD 3RY6C 4KXZH 2YS4A 1EVUA 2DQCL 1RZKC 2V17L 1BQSA 2Z35A 4RBPH 2JLLA 1IBGL 4J3VA 1QHPA 4PR5A 4B53A 3RTQD 1D5BA 2EICA 1C7TA 1CK0H 2NMSA 3FFCB 4Y7MA 2VABB 1OAKH 1ND0A 3SKOA 1A3QA 5IHUH 1YPZA 1ZLUH 4DW2H 1CZ8H 5HJ3A 3EYVB 4NQDB 5CUSH 5J1AB 4MZ3A 2VISB 2X10A 3O8XD 5EU7E 1T1WA 4NQVB 5F9JA 3RZCA 1K4DB 2C3HA 3OKNA 4NN7C 4KQ3L 4P0DA 1I1YA 3MLRH 4KI5D 1G6RL 4HLJA 4XP6L 1T0NA 4MLIA 4HPYL 1M6OB 4QYOB 1J0IA 3DYMA 1QHOA 3BSZL 4FS0A 4Y4HD 4A6YH 1DBAL 4WW1B 4KDTC 3WN5C 3L95B 4OUUB 5ACZB 1CE6A 5IHLB 3GSUA 4OZ4B 1I3RA 3QXAB 1HSBB 3UTSD 4ONHB 1J8HE 1NCBH 5L8JB 4NZDA 5GGVH 2WBJA 3VXOA 4RA3A 2OL3H 4TULL 2PXYB 3EJYC 5L2KB 1BD2E 4NO0B 4YR6B 2OJEA 1XAUA 3T0EE 2DYPB 5JQ6L 1OPGL 4TRPH 1FE8L 2FJFA 2NCMA 4YK4C 3KPRD 3RVTD 2F54A 1A02N 4G5ZH 2Z0BA 1VFUA 4ONGL 5D1QB 5ERWA 3U6RA 2EDDA 3RL1B 4NBXB 4LLDA 4P46C 3ZE2E 1NAMH 4U6XB 2DQIH 1CG9A 3L5JA 1Z0MA 5AZEH 1A6UL 32C2B 4ODVH 3L5HA 2ZKHL 4JFFA 1TQCB 2EDEA 2HVJB 4KJQC 2ZPKL 3C6SB 4Z6AT 2XV6B 3IJSB 3W2DH 2GTZB 1JPST 2BMKA 4ZPTB 5ESVA 1ITCA 3VD9A 5FO9B 2B1AL 5C07D 4G8GD 1FIGL 1AR1C 3RI5K 1X5LA 4LSVH 2VZ1A 4X0KA 4MQSB 3V95A 2EDQA 2IQ9L 5D1XD 1A6VH 4JFHD 4PJ5B 4YX2H 2HVKB 3SDXB 4NGHH 4PP2A 3QDGD 4WCYL 5CD5D 3GB7A 3PHOA 4NCC2 1PD6A 3UEZA 3VFPA 1U8QA 3FB6A 3V6BR 5IB3B 1HHJB 1DEEA 3GGWB 3OKLA 3QA3B 1G7JB 1XCQA 5HD8C 1RU9L 5AYQA 4CN4A 2JELH 5HY9A 3ZYOA 5KG9A 1PYWB 2Q76B 1FQ9C 1UXWA 1CVRA 1PSKH 3OR7B 1AXIB 4PRPA 1T3FA 4G6JL 3FMGL 1ZS8A 1RURL 1BIIA 3V5KB 1XF1A 4I8DA 4QRQA 3IB4A 1AO7A 1ODAA 3VDBA 2IAMB 4U6VL 4LVNB 3VXUD 2AK4E 3HC0B 4NC1C 2NY1C 2Q6WA 1OAUH 4XH2A 4ACPA 1MH5B 1PY4A 3T8XA 5I15H 5DHXB 3MRNA 3B4NA 3OQ3B 3E6HB 2DMKA 4EBQH 2PTUA 5SWQA 4Z0XB 2VLRD 4P5TD 4NQUA 3SOBH 1FNAA 1S5HB 2ADJB 4XTRC 4NIKB 3RWFB 2IAND 2DL2A 4OCYL 3STBA 4PUBH 4LHUG 3X13B 1RZGB 1MPAH 2XY2A 3LRSB 3WFDH 3S5LB 1QNZH 3WL9B 2ADIB 3SBWA 1ZGLP 4OLZH 1HIML 1BQHB 4GW5A 5K9OA 3GIVA 1I1FB 1JRHI 1YN6A 4LVHB 2ZSVA 4GRWF 5E08H 1IC5H 1B0WA 5DVMA 4YDVA 4LQFL 5D72H 3PXHA 3K2UL 4PR5B 1I1AB 4ZAKD 4M1GH 1MWAA 5FK9B 1D5BB 2P5EE 4QHMB 4KK5C 5DSCA 4CVZA 5LAXA 1ND0B 3SKOB 4U1MA 3AMLA 1ZTXL 3QWRA 3CFIC 2C9AA 3DXAE 5HVFB 5TQ2H 5HJ3B 2VDKH 3GJFK 4LPWA 4P3CL 4UT7H 1B2WH 3RZCB 5F9JB 4UDUA 3HC4H 3ZDXF 2A0LD 3V7AG 3LZFH 5EOQL 1I1YB 3A6CL 2X4SA 1GIGL 4YE4L 1CR9H 1WF5A 1E6JH 2DQEL 1JYWA 4NQCD 3MCLL 3KPOB 5J8OA 4WFEE 4S1DC 4D3CL 2BNRA 4IMKC 1KCKA 3GSUB 4GXUM 4NPYA 4J2XA 3BPNC 1I3RB 4MA3A 1S5IH 3ULUL 5CBEA 3X3FL 4KHXL 4XC3H 3CFBA 3HI6H 1QBML 4N0CD 1FIEA 35C8L 2OXHA 2OJEB 4OZIE 2WUBL 5EZOL 3ULUC 3SN6N 1R5VA 1WAAE 1XCTB 4OB5H 5AUMA 1NGPL 2WLZA 4HKZB 2UVEA 2J8UF 2P1YA 3TJEL 4ZDHB 1WV7T 2F54B 2Q1EA 3H9SB 3HMXA 2VN4A 1J12A 4UT9H 5HYSB 3C6LA 3RAJH 3U6RB 4YBQC 4K3EL 3DVNA 4LLDB 1NCUA 1EIBA 5F7MC 1SM3H 1JNLL 3FAWA 3QFJB 4M6NH 3IAPA 2BY0A 3V0WL 5C0BE 4DN4L 3TYFA 4QT5A 3DRQB 4ODUA 4LP5A 4H8WH 4JFFB 4DGIL 1UT9A 4ZSOE 1X5XA 4IMLA 4GQPH 5GISL 5HGHA 3MJ7A 5IR1A 4QWWC 5CGYC 3D3VD 1VEMA 4OTXH 3HNSH 3MOBH 5ESVB 2R0ZH 1FBIL 1E4WL 2Q7YA 5F7FA 3T2OA 1KPUA 3LKPA 5IB1A 2A1WL 5KSBA 1WWCA 3L7FA 4OGZA 4X0KB 1QBLL 1AD9A 4NQEE 1NGQH 4FQ1H 2AK1H 2MNUA 2W92A 4JFPA 3GB7B 5E1HB 1O7VA 3PHOB 3VFPB 5DZOA 5IFHH 2DBJA 3ULVL 2YA2A 4O00A 1MI5D 5BQ7A 1RZIB 1EHXA 4ZQKA 2R69H 4MMXC 2VKXA 5HY9B 4CDHA 4TUKL 3F7YA 3P0GB 1UXWB 2HG5A 4GRWB 1P7KA 2PO6A 3HB3C 3ULVC 5EZJA 4ERSL 2HFFA 3OJDA 1FFRA 5EZLB 5BS0D 5DD6A 1BIIB 4QRQB 1AO7B 3WIIH 4F9LA 1KN4H 4BQCA 3WE6A 3MOAL 4OQTL 2VSCA 4N1EA 1OW0C 4WFGD 1L0YA 4XH2B 5KZCB 5DT1H 2F8OA 3TIEA 5E00A 2C1OA 4P5KB 1NUNB 3MRNB 4IRJA 5SWQB 2XOTA 3U0PA 4HHAB 4TUJA 2Q8AL 5CJQL 5JDSB 1JTPA 1RFDL 2ZG3A 5C8JA 3HI1B 4RISL 2Y6SC 5FGCB 2EIBA 5HI4C 1G9NH 1WTGT 2VUOA 5HHME 1AC6A 1IL1A 4XPHH 1BAFL 2D7PA 4BZ2L 2PW1A 3JV6A 2UWEE 3HZMA 3ZHKA 5DFVC 4U3XA 2OTUA 3ZE2F 4PGZA 3B3IA 2R2HA 3F6IA 4PRNB 3UJIH 3MBXH 4AEHL 1IZKA 3GIVB 5K9OB 4HS8H 5IWLA 1MFNA 3GMPB 4YDVB 2PXYC 3LKRA 1QEWA 3SPVA 1DE4A 4PJCE 1MWAB 2V7HB 4CVZB 3R0MA 4GOSA 4XMPH 2LAAA 2GSGA 5LAXB 1YEKH 1B0GB 2J8UB 4O2CB 2N4IA 4HIEB 5I73B 1OGAD 5D1QC 3MJ9H 3EZ8A 4LSRH 4UDUB 2XQBH 2AGJL 4HWEL 3C2SA 1CLZH 2BFVL 4BZ1H 4OCXL 5DJYB 1SBSH 3S37H 2HMIC 1ZHLB 3TT1H 3SE4A 2V5TA 1MRDL 3STLA 4HFWA 4NRYA 4PJ9D 4ZS7H 5J7CC 1B0RB 2AEQH 2WM0A 3NN8A 1IGMH 1TTUA 2OQJB 4MA3B 4I9WE 1EFXD 4AJ0A 1HH9A 3PWPE 5IFJB 4GAJL 2ZCKL 5DQJA 2ICWJ 4LAQL 5C0AD 3Q6FA 2ZUUA 3GUTB 3F58H 2OYPA 2GT9A 5JIPA 4OLWL 4XI5C 1I8KA 2H1PL 3QYCA 4M61B 2WZPD 4G3YH 2QR0A 2P24A 4C57C 2PYEE 5DJCA 5E94A 4QOKE 3C6LB 3S4SA 1BLNA 4FOMA 4OT1H 1NH6A 3PGCB 3MPCA 2ITCA 1R3LA 3GZKA 3OAUH 4NUGL 4K7PX 1WWAX 3MCG1 2C3GA 5JW4R 4D9RD 4QT5B 2IAMC 3K4DA 3SQBA 4LVNC 4PJ7E 5IKCB 1LO3H 4ODUB 4DCQB 5JA8B 4PJEE 3GSWA 4PFEA 1Z9OA 3ULSA 1YEGH 4CGTA 4M1CC 1J8HB 4IMLB 5D7LE 4PJXE 2APWA 3SKNA 1G7PA 5IR1B 4N1CA 5FOJA 3AS0A 2Q7YB 3VXSA 1KPUB 1RHHB 3LKPB 5IB1B 3L7FB 4K9EL 2JJTC 5E7FA 1FLRH 1LVEA 5JW3H 5J4MA 1WZKA 5LBSL 3BFOA 1T80A 2HTLD 4M3KB 5DF0A 1EERB 4PREB 1KPRA 5J9PA 3C60D 3H9HB 5DHVA 1X4XA 1SYVA 4LVHC 2P47B 4ZQKB 2WIMA 1T4KB 1FYTD 2HG5B 1P7KB 2VC2L 2HFFB 1A7OL 3T3PE 3TVMA 1BFOA 1I1AC 4JM2A 5DD6B 5E99H 4Y4KD 1GGCH 4RDQF 4HWNA 3WE6B 4P23C 1MCEA 4QO1A 3BW9A 4Y5VB 1WSST 3MZTA 1PZ5B 3NCJH 3TO4B 1UA6H 5E8DH 4S11A 4TQEL 3TIEB 1VENA 3RQ3A 5E5UB 1G7LA 3W0WE 1P7HL 2HWZH 4N0FA 5KVFL 5IVZA 4PD4J 5DFTA 3U0PB 5CEXA 1KN2L 5HVWA 4TUJB 4EQ2A 2R4RL 5C8JB 1P9MC 3MRGA 5DS8A 4TSCL 1SEBA 3S36H 5CSBA 1GXEA 1NQBA 1IL1B 3BN9D 1S7QA 5CEZL 1QO3B 2PW1B 3GBNL 5GGSB 3MCKB 1H3GA 2OTUB 2DB8A 1EA9C 1R3HA 3PE9A 2R2HB 5T1DH 4DK3A 3JWDL 4P4RB 4XB7A 5CJOH 5B21A 1MJJA 4WI8A 5LWYH 5CMAB 1OAQL 1OGTA 3JTTA 3OGOE 1PG7L 2BVOB 1WBYA 3ZDYE 4JM2F 3QQ4A 1QEWB 3P40A 3SPVB 3VMPA 4Z7NE 4R9HA 5E4EC 3MV8A 3VGBA 2J8HA 4PJHE 2XZCL 3QCTL 1DBKL 2YD9A 4OZFH 1F2QA 3KXFD 1G0DA 1MHPL 2A73A 3TA3D 2DWEB 5DQ9A 1QACA 2COQA 4XPBL 1FO0A 2FJGA 1UWXH 3HZVB 3TGXA 3FCTA 5T3ZL 1W0VA 5C0RH 2D7NA 2Y7QA 1EDQA 4WTZA 4NKIH 3RVXD 4JHAH 4L3CA 4Q0XH 5K59F 4HFWB 1AI1L 4NZTL 3S5LG 1S3KH 1DSFL 3QHZH 2E7LC 1BQHG 5FYLH 1YECH 4WGVB 4H88H 3G08B 4HAFA 4OCWL 1EJOL 2FECI 3V5HB 1HHKB 2P5EB 3VXRA 5DQJB 2GUOA 2ESVD 5A43C 4F37F 3Q6FB 3ESUF 5SWZE 5A3ID 2EC8A 3LQAH 1KEGH 1EFQA 3EUUA 5GSVA 4ESKA 2VDRL 4LVEA 1EHLL 3TNNA 1HNGA 4W70A 2GT9B 1NSNH 5CZVH 1T83C 3SDAD 5DC0A 4JGUA 1I8KB 4FFYH 2RQ8A 4PTUB 5DDHA 1JP5A 2P24B 2QR0B 3BHBA 3PWJA 1HHIA 3P0YL 5I75C 1BLNB 4G9DB 5HHOA 4XP1L 4F57L 2PCPB 4LAJH 1I85A 2ITCB 1R3LB 1EGJH 4MVBD 3N50A 1GOHA 4IDLA 2UWEF 1OP3K 3UJJL 5LKNA 1NAKH 3TO2A 5E8OB 2JB5H 1G6VK 3LIZL 3QDMB 3ULSB 3KPPB 2G5RA 4DQOH 3SKNB 3AREC 2Q8BH 2ENSA 3QH3A 1R24A 1BVZA 3EFFA 3ARUA 4EXKA 3MGOA 5FUZH 3WEXA 3FOMB 4J3TA 5E0QA 1F90L 4PJCF 4F15C 4L5FH 4R0LA 3QQ9C 3CU7A 1MRCL 1LO2L 2XWJA 1ZVHA 1MAJA 4HIXH 3RRQA 2A2QT 3L3OA 4GKOA 3RKDD 3MRLA 4UILH 1KPRB 5E2WL 3UZVB 4F7PB 2I26N 5DHVB 4QRTA 4HXBH 2H32A 3CK0L 5HYSG 1SYVB 1PKQA 1RVFH 3GBML 4YUEH 2P48B 3ORJA 1ZE3C 5FYKL 2UUDH 3G04A 2A6KA 3GNML 1HNFA 4YXHH 1YYML 4NFDA 3QXVA 5LQBL 4JKLA 3TVMB 1KCRH 3PHQB 1V3MA 1FRGH 1MJUL 4EN3D 4JM2B 4I0PA 3WS3B 4FQJL 5F7YC 6FABL 3R4DA 3QUYA 4KK8D 5E8PA 1QSFD 4OM0L 1C12B 3S35L 3SE8L 1G7LB 4PRHA 5ECJE 2G75B 3P30H 4N0FB 5IVZB 3X3GL 3BT2L 5CEXB 5LGHL 3E3QE 1K5NA 3NCMA 4NQEB 4L9LA 5DMYA 1F3RB 3T77A 2V9TA 3S34L 2BNUA 5DS8B 1SEBB 3DUSB 4LCIH 3QCVL 2VITB 4OZGE 1MIMH 1YMHA 2R9HC 1H3PL 5KVGH 3SDDA 4P2QD 5JXAL 3V9FA 2QQQA 1QFUH 2FHBA 4GKSA 5IROC 4LLAA 4U33A 4X6BA 1MJJB 1CFVL 5EOTA 2B8OT 2CIKA 1N7ML 1OGTB 5JPMA 3MRPA 3JTTB 4MAYD 2YA0A 4PJ7F 5MEPB 3UJTH 1WBYB 3LD8C 3VFRB 2J6EA 3MV8B 4RMQA 3V4VL 4HH9A 3NAAL 2ORBL 1Q94A 1OM3L 4KZDL 1F4YH 1AQKH 4PPTA 5GSRB 5AG8A 2YOCA 5EU6A 3O3AB 3C6LC 1YYLL 5DQ9B 1JPTH 2DN7A 1A6WH 4OF8A 2VLKA 4XCEA 4XP5L 1E4XI 2BSED 1FO0B 5M95B 1V7NL 3U36A 2Z91B 2UWEB 3FCTB 4FZEH 1W0VB 2XWBA 2Y7QB 4JRYE 3BIKB 4JFEB 1RZ7L 2VDNH 2X1WL 3C5ZA 3PWLA 3UTOA 4URTB 1RZ8A 2DL9A 2NTSP 3VFSA 4KDWA 2JCCF 2ZJSH 1M1SA 1JV5B 3MV9A 1WBXB 3MBEA 3WFCL 1YPZE 5J11C 1AHWB 3IVKA 3L3HA 3AY4C 2APBA 2I9LB 5L7XL 1KB9J 1XGYL 2NY6C 2OR9H 3RGVA 4KKBD 3O3BA 5H8DA 3F65A 3VXNB 1TVDA 1CFTB 3QG7L 1MCWM 4XGZB 3RWIA 5DDHB 1L7TH 1WZ1H 3PWJB 4F9PC 3VFNB 3V6FB 4MS8C 4UT6L 3LMJL 1T7XA 2ZCLH 4PBWD 4LOUC 5I1GL 1EO7A 1ZHBA 4DN3H 3BKML 5TH2A 3TO2B 5KJRH 2VWEE 2NY4B 4WI7A 4N8CL 5MEOA 4Y5VC 4JFZH 4JM4H 5J0BA 1MFBH 4MJ4A 3TO4C 2NY7L 2G60H 5IB4A 1FORL 1LEIA 4QRRA 4O4YL 3QH3B 1JCKA 1R24B 3B2VL 1BBDL 4KPHH 3MGOB 4Z7NF 5AYUH 1AFVH 1MCOH 3FOLA 3L1OL 1BZ9A 2XWJB 4S1SL 4WHYG 5IVXE 3U4BL 3JXAA 2PYEB 3MRLB 2CDEA 3UROR 1DFBH 3IFLL 1L4IA 2WWMD 1JGVL 3NZ8A 4OKVB 4IRSA 1PKQB 1U8IA 1I7RA 4X7SH 4YHNA 3G04B 4WV1C 4RQQA 3KAAA 4XPFL 5CZXD 1MVFA 1IQWL 3KS0J 3GSVA 3AAZA 2R0LL 2A74A 2E9BA 5IF0B 1KB5A 4I0PB 3MO1A 5E56A 1U3JA 5D7LB 1IGYA 4OD1H 5DEGB 2GYSA 3SGKC 3K74B 1EEQA 1HXYB 3B83A 4KZEL 1Q1JL 3D69A 4CNIB 4PRHB 4ZNEA 4YQXL 1G7QA 3LVEA 4GG6E 4PG2A 3T77B 1LWRA 2BNUB 4PJBA 3GKWL 2XRAH 4KAQH 2R56L 4LSTL 2ED8A 1F4WL 5B38A 4HS3B 3OL2A 4EOWL 3O81A 2DQJL 4LLMB 3CVHB 4H25A 2ID5A 1RUPL 1WCBB 1IGTA 3SDDB 5HDQL 3UTTA 4PY7A 4OJFL 2JCCB 1QQDA 5HTSA 5DI8A 2HN7A 4X6BB 3EHBC 4AYFA 4NM8L 4X5XA 1L7IH 3REWA 5JPMB 3ME0A 3TV3H 1NDMA 1IGCL 1QR4A 5T3XH 1I3VA 3SDCD 1N3NA 4YDIH 3VFTB 1T5WB 2ITDB 5KSAA 5JMRA 3QAZC 2FEDC 4PRDA 3UPCA 1OQXA 3LPFA 2VLLA 4P2RD 4XNUL 4YBLB 5EU6B 1Z6JT 1CDUA 1T1ZA 2IEPA 3O6LH 1CTNA 1U3ZA 4JAMA 1MFAL 2Y06H 3BD4A 2NZ9D 2VLKB 4XCEB 2DICA 3R06B 3T2PA 3VWKA 2BRQA 4P9HH 4QF1B 4BQ9A 2NXZC 1RUAH 4XPTH 3DX9A 1JJUA 4JPWL 3C5ZB 1IQDB 2V2TA 1E4JA 4JRXE 5E2TH 1RZ8B 4C55A 1AP2B 1HH6A 2D7TH 1KEML 1RUKL 1IKNC 1F4XL 1I4FB 4JQIL 3MBEB 3CFJA 1SEQL 4J3OC 4YFLI 2MMXA 3IVKB 1CE1L 3FZUD 1RUMH 5C0CD 5ICXA 5IFAH 4WEBL 3E8UL 1DVFA 3L3HB 1YDPA 4EXPX 1UCBL 4PRIA 1JWUA 4HJJH 2QQLL 3OAYK 1QLEL 1FC1A 4MA7L 1DLHB 2I27N 4BFIB 5JQHC 1ORSA 1WIOA 3ARYA 2VDMH 1INQA 3RWIB 1AGFA 5DMIL 3OJMB 3PG2A 1HKFA 3FQNA 1YMMA 4N5ED 1OTTC 3RWDA 4ZFGH 2LE9A 1GGYA 2Z8VC 2BNRE 4QKXB 5M94B 3KJ6L 3TPKA 3WLWD 4K23L 5B22A 4JM2C 2SEBB 1KPVA 5J12B 5TH2B 5FM8A 4Z7VA 1S7WA 1TMCB 3OKYA 5FKAB 5MEOB 3QR2A 1AY1H 4KY1L 4O02L 4JE4B 2J88H 3ZKXB 1J5OH 2VLJD 1NGYA 3HFML 2FL5A 5I1KH 1DEDA 4L3ED 5IB4B 5E6ZA 1TCRA 4MLSA 1LEIB 4WTWA 3P4NA 2XNAA 3EJYD 1RJYA 2WK2A 5EBLB 1T03H 4Z78B 4M7KH 5IBTH 1N0XL 1BZ9B 2R2EB 4H20L 2X4RA 4KMTH 2VZ3A 5AWNH 3FO0H 5F1IA 2R2BB 4LASH 3ARFB 4M62L 1LO0L 4P46D 4PD4K 3FN0H 2M26A 1VPOH 3I2CH 4K3JH 7FABH 3NZ8B 3MLXH 4IRSB 1U8IB 1I7RB 5E7BA 1KTLA 2NY5C 3WJJA 1I9EA 5EPMA 4J4PC 5JUEL 4JVWA 3QUXB 2DLFL 4X9HA 4XVUC 1NCDL 3DUHA 4DKAA 3AAZB 1CFSA 1X5HA 1Y6NR 2A74B 4KJQD 4Z7VF 4UOW0 1ZHNA 3MO1B 4LEXH 4RDQG 1IGYB 1MCSA 1KENH 5KSBE 3OR6A 4JRWA 1IGFL 1FL5A 1HSAA 5I1LB 3QHFH 4P49A 5TDPB 1T22A 1ZSDA 3OKDA 3OF6A 3D69B 3PP4H 1AR1D 1TZHB 3UTQA 5SX4I 1YJDL 4Y2DA 3RNQA 2VN7A 3FQUB 1NLDH 1G7QB 3HG1D 5IQ7L 2C5DC 4PJBB 4K3DL 1YJDC 5B38B 1KC5H 2BNQE 2A77H 3HI5H 3SHSA 4H25B 4N1HB 1UADC 5HD8D 3VFVA 1IGTB 4QNPF 2DIBA 2FGWL 3UTTB 4DOHB 2IG2L 4PY7B 3EO9H 3WBDA 2DQCH 3QDJA 4X6FA 3O8XA 4MDIA 1OAYH 1AHWC 5KTEL 1DQMH 3N85H 5I1AA 2R2CA 2VDPH 2VL5B 3CSYA 1LHZA 5D5MA 5BZWA 2NY1D 3U7WH 1ZWIB 5HI5C 5FM5M 5KSAB 3P9MB 4XBEL 4PRDB 5E2JA 2VLLB 1NGZA 3O45A 5D70H 4Y4HA 3UPAA 3G5XA 2X4UA 1U36A 1TITA 1HEZA 3GRWL 5JHLL 5HYJE 1T1ZB 4LU5L 1VSCA 2Z8WC 4KV5F 1R0AL 4XTRD 2D0FA 3UTSA 4JAMB 3VD3A 1I85C 3L5XL 3GJFA 1MCLA 1G6RH 3VWKB 5ID0B 2HFEB 1RI8A 4XP6H 2HH0H 3PJSB 1XZ0A 4RZCA 3WJLC 1DBAH 5CP3H 2WINB 3DX9B 3ARGD 3Q1SH 1QKZL 2FD6L 4LGPB 1BECA 4M7JH 2V2TB 1B90A 3KPRA 4OGAC 4ZFZA 3VRJB 4D9QD 1ZANH 4FFWC 4P2OD 3G6DL 3QIWB 4DFHA 5F7HA 4CU8A 1A5FL 4Q7DA 2UVFA 4KK5D 4X7DC 5K9JH 4FFVC 5ICXB 1YQVL 4DVRL 4R26H 3CFDA 1DVFB 1Y18B 5JQ6H 3ZYZA 1BEYL 1S7XA 3KPNB 4KI5F 3BE1H 4PRIB 2CLVB 2EIZB 1B6UA 3RWJB 3QUKB 2F53E 1I9JL 3MLTA 1KTDA 1ORSB 2P44B 1KLUA 1WFOA 5C71A 1BOGA 1R3KB 4ALAL 1LO5B 4GG6F 1W72A 2ILLA 4WFGE 4LGRB 3TF7C 1A6UH 1ZT4A 2HKFH 5FHBL 1KJVA 5C07A 4G8GA 2P7TA 1QSEA 2QKIA 2FSEA 2IGFL 4K07A 3WUZA 3ZKNC 5CEYA 5D1XA 4Z7VB 3D18A 4WTZG 4S1DD 5I1JH 3MUGA 4NRXA 3OXSA 5F1NA 4LSQH 3MR9A 2ICWI 1A21A 2OL3B 3WHE0 2FL5B 4TOYH 1TCRB 2CMRL 1PDKA 4AEEA 1FIGH 3P4NB 2XNAB 5DO2D 4LLQB 2MHAA 3BESR 4KFZC 2VXTL 2IQ9H 3ULUD 4KJWD 3MLPA 2OXGA 4XAWL 3VXQA 1MCWW 1MQKL 4N8VA 5FUCE 2X4RB 2O5ZL 2H2PC 1K6QH 4WGWB 5F1IB 4FQQB 4IS6B 3VXUA 4KUZH 4Z7UE 2I5YL 5F1KC 4YBQD 1KJ2L 4B5EA 2HKHH 2F74A 2H41A 1ERNA 1XGQB 4R90H 3B9KA 5EPMB 2ATKA 3FMGH 1G9EA 2VLRA 4XCCH 4P5TA 4JZJC 4V1DE 3SJVB 4X4ZA 1NMCB 1JN6B 3BH9B 4Y0GA 5EO9B 1XGPA 4LK4A 1XGRB 4U6VH 4Q97A 4YGAB 1N4XL 2IANA 2VIRA 4LPVA 2EDKA 1CQKA 1A6AB 1T20B 4CMHB 3NABH 5CGYD 4BFEA 1FL5B 2BK8A 1T89A 1HSAB 1C7SA 3BP4B 4WWKB 3OKDB 4WDIB 3TP4A 4FMFA 4OKDA 1PJ9A 4Y2DB 4QXUH 1QP1A 4DFIA 3BP7A 3RY4A 1ZLWH 4ZAKA 3RTQB 3C5ZC 1T6VN 3MV7A 1E28B 3FQTA 5CHNB 1TVHB 4TVPH 4X7CC 3ULVD 1UVQB 3O8XB 4MDIB 2NY2D 5C7XL 1Q9KA 2APTA 1TVBB 3FRUB 3BZEA 5BZWB 3ZTNL 1MHCB 1EAPB 2B2XH 1IAIH 4PGEB 2WAHA 4TPRL 5I30L 2YXFA 5ACMA 4X4YA 1EK3A 1NGZB 3O45B 5EUOA 2D31B 4NQCA 1JYVA 3G5XB 1ZA3A 4P3CH 2Y6SD 1PY9A 3VI3E 1AGDA 1D3CA 3GI8L 3UTSB 1KB9K 4M43L 1B4RA 1WC7B 1MUJB 4DAGH 1XZ0B 4U4BA 3MCLH 2PW2B 5FYLE 3FQRA 4W68A 3ZKXC 4FFZH 4HEME 4N8PA 4RX4D 5T1KB 1MAKA 2EYRA 2V9RA 3KPRB 4ZFZB 2VKWA 1GSMA 4QEGA 5J3HD 2PXYD 4L4TA 2Y36H 1Q0YL 3GJEB 4KHXH 5EIVA 4YAQA 4U1SA 1A3LH 4HUUB 3A0OA 4LPUA 1VEOA 2KBGA 1S7XB 4WHDA 3TJEH 2A6IA 2CSPA 3CUPA 1GCFA 4XHQA 3ARFC 1JGLL 3UYRH 3MLTB 3BZDA 5EUOF 1S9XA 2X4PA 2BP3A 4J3XA 5KVDL 4NRZB 1BOGB 1V7ML 2VXSH 2XKNA 5EFIA 3LOWA 2E7CA 3D3VA 4BUHA 1I9RH 1ZT4B 2Q87A 5T1MA 3QUXC 5GXBB 4PJGA 1KJVB 5C07B 3EDJA 4G8GB 2P7TB 4CRPA 1XR9A 2FSEB 4PS4L 3MRFB 3EJZC 4JRXB 5D1XB 1P4LB 3D18B 5E2VL 3T0XA 5C08E 3VD4A 4NRXB 2CO7B 4WU7B 3QDGB 2YD2A 3G6JA 4YWGL 2P8PA 3S3SA 2C3VA 1JZ5A 4YZFE 1MI5A 1FBIH 2AJSL 1QPPA 5E5MA 4PJ5D 4KQ4L 1LE5A 3RIFF 1QBLH 2MHAB 3GSNA 4LF3A 5D7KE 3LN4A 3VXQB 4I4WA 2MCG1 5F7WC 5DD3H 5HHOE 3T3ME 5BS0A 3O2DA 5T1LD 1D5ZA 5FCUH 1WIPA 4M7LT 2ADFH 3WIHL 3CX5J 3VXUB 2YD8A 4F7MB 4X9FA 3IDXH 4R2GC 5CAYB 2QSTA 2JE8A 1JHTA 5BMFH 1QRND 5TF1L 5D7SH 3D9AL 5HHVH 3KXFE 4LDLB 5KANG 4XWOC 2ZP0T 2VLRB 3VFGL 2E6PA 4K7PL 3QO0A 4P5TB 2IAMD 5ELIA 1SJEA 5D1ZC 2VR4A 4ZOCA 3I9GL 4ZD3H 4P5MA 1R3IH 4Q6YA 1XGPB 3MOAH 3IRZA 4LHJB 1U2HA 5KSAC 4E41E 5D9SB 2IANB 3JBG7 5CJBA 2RB8A 1UH3A 3FONB 1BPVA 1JWMB 3N1GC 3MUZ1 1A0QL 3MRDA 3E3QC 3DMMD 3OSKA 5IQ9A 1KF9B 4RRPG 1OT1A 1RFDH 1J1PH 4JO2H 4ZO9A 4L8SA 3VWKC 2QV2A 4N0UE 4MXQC 3BP7B 5FV2A 4ZAKB 1PLGH 4UBDC 1OAKL 5IHUL 2ESVE 4LKXA 3TBTA 4DW2L 1XMWA 4FQXA 1CZ8L 1OGAA 3NGBC 5DJDA 2M2DA 3G5VA 1TENA 2AXJA 3QIWC 2F5AL 1SHMA 2FNBA 1BF8A 5IK3A 2V9QA 4LBEA 1NMBH 5E1AB 1ZV5A 2D2OA 1Q9KB 4PJ8C 1HE7A 2PTTA 4P23D 5SX5K 3BZEB 2AW2A 3DWTA 3MLVH 4GMTL 3WKMH 5EZIH 4X6DA 4MD0A 5H37H 4A6YL 4WUUE 5EUOB 1VGKB 4PJ9A 2NQCA 4NQCB 1GZQA 4NNPH 4X7TA 1BP3B 3CFKA 3ETBF 4JQXA 1IT9L 2A9ML 4YIQA 5DTFA 2AGJH 2BSRA 1AGDB 1NCBL 2CDFA 5EBGA 5GGVL 4HUVB 2BFVH 3LRGA 4MB3A 4PV9B 5FDYA 5FYKU 1UCTA 3TESA 1NCAL 4YXKL 5C0AA 4Z7UF 1WWBX 3RA7H 4LDOB 4TRPL 4XP9H 4F33B 3U30B 3FQRB 3V4PL 4JREC 4M1DL 5IMOA 5CEZD 4G5ZL 4R4NC 5FOBA 4UAOB 5EN2B 4C56E 4ZFOA 2WUCH 2ZWLT 4PJDE 1NAML 4GAJH 4YAQB 3MRBB 1D5MA 3NPSB 4LAQH 4NZRL 1KT2B 4QRUB 1UWGH 2JJWA 5AZEL 1CDGA 4LPTA 3KPMA 4NC2B 1NGXA 5F9AC 4ODVL 4OLWH 3W39B 5C0FB 1WFUA 1XF2A 4XBPA 4D0CB 5DJAA 2MQCA 4APQC 1OWRM 3NCYS 1AH1A 3LKSA 5TDNB 5L88H 3CXHJ 3BUTA 2DJ4A 2AERT 3QFJD 5E6ID 4HX1A 1HKLH 1D9KC 2XKNB 5EFIB 3RL2A 1BX2B 5KW9L 3D3VB 4CN6A 2VWEC 3WDHA 3QJFB 5T1MB 4G9FE 4LSVL 4AIZA 3H8NA 1CBVH 3LEXB 4ZXBD 5E8NB 2N1KA 5T3ZD 1LD9A 3ZZ1A 3U9UA 3G6JB 4UB0H 2AABH 2P8PB 4WWKC 4DEPC 2B20A 3P73A 3IKKA 1MI5B 2JELL 5BVJA 3QCUH 2GTWA 3CH1B 4M9PA 3FTGA 4U1NA 3MRCA 1T0MB 4Y2DC 1PSKL 1LE5B 1HHGA 5H2BA 3GSNB 4LF3B 4YHYC 4N68A 1U2CA 3LN4B 5DMKB 3QZWA 3TN0C 1CD1A 4L4VE 3QHTC 5BS0B 3RTQC 4JFOB 2HT3C 2XN9E 2D7QA 4Y4KA 8CGTA 3HAEH 1WFTA 2APXA 4MHHG 3MNWA 3NH7L 1AKJD 1JHTB 3WDIA 2DIAA 2VC2H 2CQVA 4EBQL 1I8LC 4U05A 4GSDH 4F7CA 3SOBL 2XYCA 5LXGH 3F5WB 3QO0B 1SJEB 4QRRE 4P5MB 3O4LD 1Q72H 3KYKH 1TTFA 1VA9A 5D93B 4KI5C 3PWNA 3IRPX 4ONOA 4PUBL 1NBYA 4LEOA 2R1YB 2AXHA 1MPAL 3ARED 3TH2T 4R3SA 3MRDB 1AGCB 5FECA 4OLZL 5HGDB 5JNYA 5IQ9B 2RIKA 1YC8A 1IC5L 3P77A 4XCFH 3DRTA 4XPGL 2WQ8A 3KYOB 5FM5O 4G8IA 2P45B 5D72L 4GW4A 1KJMA 1VKXB 1BVKB 4EI5D 5EG6C 5HI3C 1IC4H 3TBSA 1YEDB 4LKXB 2XA3A 3RGHA 4NO3A 1CICD 3TBTB 5TQ2L 3RVTC 4Y1AA 2VDKL 3FKUS 1OGAB 3Q5OA 5DJDB 3U83A 1A9EA 5T3XE 3G5VB 4V1DB 4UT7L 2PYFB 3HC4L 1EEYA 4LBEB 5FYKD 4LVOC 2RAMA 3DBXA 1Q8MA 2PTTB 3LZFL 3M17B 2IQAA 2FEEL 3QCTH 1W0WB 5EUKB 2X9XA 1OCWH 2BXZA 1CR9L 5KBNC 4X6DB 4Y5YB 1QFWH 4HSQA 4MD0B 1CLCA 4PJ9B 2IJ0C 4WI3A 4XMLL 1FFPB 1GZQB 2YPKB 4X7TB 1FAKT 1KIPA 5DTFB 2FZ3A 3MZGB 1S5IL 3DVGA 1NFIA 2EE9A 3T3MF 3VMNA 1EFXB 3HPJB 3HI6L 2G9HB 5FGSA 2VXVH 1OSPL 1MF2H 3BISA 4OB5L 1DSFH 5ISZE 3MOQA 1K8IB 1P69B 3SDAA 4YFLF 5CD5C 4M5ZH 3FFDA 5IMOB 4NN6B 3E0GA 4ZS6C 4MGXA 4U3HA 4ZFOB 3RAJL 1EJOH 4X7EC 3MRHA 4QGTA 3AGVA 1DQQA 4X4XB 4J12A 3D85D 4A2MA 2AXFA 4LLUA 5I6XB 3G5YA 3IDIB 3LS4H 4M6NL 5CS7A 1G7MA 5CSZA 2VDRH 3PGDB 2L0DA 1NGXB 3QXTA 3VWJA 2CGRH 4FMKA 2X09A 1ADQA 3V0VB 2DAVA 1XF2B 4XBPB 4H8WL 2AEIT 4GLRH 3VGAB 1VFMA 1ZAGA 3LKSB 3IU3B 4ISVB 3WO3B 3VFUA 3C09B 1EMTH 4HX1B 4LRIA 3HNSL 4ZO8A 3MOBL 2I9TB 3UJJH 4ELMA 4Q9RH 4ODHH 4LCYB 1WBZA 5I19H 2AJUH 4NNXA 1AGEA 3LIZH 3HMXL 1J8HD 4FQ1L 3D39E 3BPLB 1LD9B 4EIGB 5IFHL 3U9UB 2OX5A 1BD2D 3C60B 4N5UA 4PLOB 3CDCA 5DJ8A 3T0ED 3P73B 1F90H 4OM1H 5IB5B 2R69L 5BVJB 2XZAH 4P3WA 2D03H 4ZUSA 4U1NB 5IOPB 4GMSH 1LO2H 1FYTB 1HHGB 1F42A 3A67L 3BDYL 5A16B 5IHZB 4QHNA 2NY6D 4MNQD 3WFEH 3QWQB 5TDOA 3CC5B 1XGUA 1I3GH 1DUZA 1YMME 3WIIL 4Y4KB 3CSGA 3OTTA 5LVEA 1LEGA 3ZE0E 4BK4A 5DT1L 2J12B 4PJAF 4MS8D 4LPCA 1QSFA 3H7BA 1YYMH 2YUWA 3SGEI 4LOUD 5HYEA 5LQBH 4F7CB 3B8YA 1U92B 4QXTB 4Q58C 3RZWA 5C08B 4ELMF 2A0LC 3QJHA 2V7NB 3QIBD 3SY0A 1QLRA 1U41A 1U91A 1G9NL 5EC2B 1CL7L 1M7XA 3OX8B 3PWNB 2CXKA 3QPQC 4YBHA 4XPHL 3QEGH 4LMQI 5GS0H 2OJZH 1NBQA 1F3DH 4PJDF 2GK2A 1T21A 2BDNH 1ACYH 4JY6A 3UJIL 2MPAH 3MBXL 4P2QA 5JNYB 2GJJA 4HS8L 3MACH 3VFOB 3LEVH 3P77B 4WI5A 2PN5A 2YWYA 3SO3B 1WLHA 4RFEA 4U0QB 3S34H 2B5IB 4G8IB 4MAYA 4UQ3A 4GW4B 4JKPH 1U42A 5SWSE 1SY6A 2IPTH 4MA8L 1H3PH 4M5YL 2FX7L 4G80A 1LEKA 2DDQL 1RJLA 1QRKA 4XMPL 3U30C 5JXAH 1YEKL 1E4KA 1LK2A 1AD0A 1EBPA 4NO3B 1IAKA 4UAOC 3KXFB 2DJSA 3BJLA 1MFCH 3MLZH 1ZHKA 3MJ9L 3CZFB 4HC1A 3F62A 3F7RA 4LSRL 2XWTA 4DVBA 2AK4D 2VQ1A 3TA3B 4S2SB 2XQBL 2NW2B 3LDBC 2FO1A 4G42A 3PDOA 4NM4L 1CLZL 4J3SA 5F9WB 4BZ1L 5K9KA 3S37L 1V3JA 1SBSL 2VYRE 4PB9H 2IQAB 5EC1B 3TT1L 4WW2A 2ORBH 3PWVA 5INCA 4HKBA 2EYSA 5DK0B 1C1EH 4HWBA 3BDXA 1FG2A 1PX4A 3STZA 2AEQL 3SKJL 1GC1C 5B8CA 3G6AA 3EFDH 2YZ8A 5FA4B 1NFDE 3WNOA 4RGMB 2FZ3B 3O11A 4N0UB 2Y1VA 3DVGB 3CNKA 1NFIB 2DJUA 5J6GA 4JPVL 2MOVA 2P4AB 4QTHA 2ICWA 1D5XA 3DARA 3QDJE 4U1JA 2ESVB 1BFSA 4GKZA 2FCBA 3QXUA 1VHPA 2XXMB 5MHSE 1MY7A 3SDAB 5D5ME 5F7EH 2NY3D 4G3YL 4MDJA 4KH2A 1I7TB 3BI9X 3MRHB 4OT1L 4WI6A 5KVMC 1DQQB 1ES0B 4YHPA 3DXAD 2DQHH 5BV7H 3T2NH 1TNMA 3OAUL 2IF7A 2OSLA 1XGYH 2FEDD 1N59A 4EI6A 2C1PA 1H0DA 1LO3L 1VACA 4OI7A 3HLAA 3QG7H 3DECA 3TBWB 3N1MC 2AVGA 4MD5A 4PJAB 1KCSH 4UT6H 1FGVL 5GGUA 4MNGE 1PG7W 3IYLW 2EEAA 4JFXA 1MFDL 2NXZD 3P4MA 1FZMA 4WFED 2IFFH 1P7QD 4X6EB 4ELMB 3L3GB 4DK6A 3CX5K 1WBZB 5JW3L 1FLRL 4NNXB 4I0KA 4NSKA 1RD6A 4C56B 1S8DA 4U1GB 4WU5A 4L4JA 1FV1B 3ZL4L 3PWUA 3MRJB 3VW3L 4PJDB 3C5SB 4G6KL 4JGJA 5I2IA 5JIIA 3E6FA 2VZTA 5DJ8B 4JQVC 3BD3A 4MWFA 3SGDI 1Q38A 4ZUSB 3QEUB 3IFNL 1BJ8A 5DRZA 5DA0B 3UXFA 2BHZA 1PZUB 5C0JA 3U4BH 5E99L 4EDWH 4XBGA 1GGCL 4EN3B 1MELA 4JFDE 1G7IB 1U0QA 3GMQA 1F3JA 3MLUH 1CD8A 4HW6A 3B9EA 2I07A 1QSEE 2F15A 1JGVH 3NCJL 1UA6L 5E8DL 2ICEA 1OTTD 4MMZC 5C0BD 1QSFB 4OF5A 2HWZL 2UV3A 4EUPH 3PP3H 1IQWH 2CKBA 3PQYE 5KS9F 2A83A 2CUHA 3MUHL 3MGTB 1SQ2N 2DIJA 3QJHB 4UUJB 1QLRB 2CLZA 1U91B 3S36L 3FB8B 1KLGA 4JKMA 3ARRA 4Y5YC 4KZEH 1Q1JH 2A9NH 4F7TA 5JLZA 1T21B 1UG9A 3QNYA 4P2QB 5CJOL 4NQED 4QHUB 4YQXH 5LWYL 1UH4A 2GFBB 4BSWA 4L4VB 1CFQB 4JG1H 5JMOC 3GKWH 2JIXA 3SDCA 2Q86A 3DX6A 1RUPH 3NCYP 4JKKA 4Y16C 4TVPE 4G80B 5DYOA 3MXVH 2HAZA 1RJLB 5GRWA 5IT2H 4QLRA 3BXNB 1AD0B 1LK2B 1RMFH 4ENEC 1IAKB 2X4TA 4NN6C 4J4PD 5HGAA 3SCMD 1FHGA 5DRWB 2RCSL 1N8ZB 5I66A 2E9JA 3QNZA 1IGCH 2XWTB 4PGDA 4W4NA 4XVUD 4JJ5B 7CGTA 2LU3A 1TPXB 5I6XC 3CLFH 4G42B 4RMTA 1FJ1A 4X7FC 3RJQB 1ITBB 4U1HA 4XCYA 4WW2B 1Z0NA 4NKIL 4PB0H 5INCB 4HKBB 1S3KL 5C0IA 3QHZL 3A6BH 4AH2A 1FG2B 4PRBA 3STZB 4OZHE 5B8CB 4MB4A 3RY6A 5HHMD 2NNAA 1MFAH 3CCHB 5CGTA 1YECL 3O11B 3I6LE 5J6GB 3MV7E 3HUJE 4MJ2A 4F7EA 2X1OA 1AIFA 1F6AB 2ICWB 1DLFH 5C0CA 3ZE0F 2WW8A 3LQAL 5CFHA 4OF7A 1LP9A 3CXHK 3QEQD 4EZMA 3EO0A 1QFHA 1NSNL 5CZVL 2GITA 25C8H 4GKZB 4FP8L 2HTLC 1DP0A 1XIWB 3DI3B 3TJHC 3C60C 1KEMH 3LQAC 1F4XH 3KPSD 4JQIH 2AJXH 4NNYB 4OF6A 2WV3A 1CE1H 3JV0A 4YHPB 5IB2A 1MQ8A 4WEBH 4FNLH 3RUGE 3L5WA 2MFNA 5EU4A 4ODWA 1N59B 1NAKL 2C1PB 1FZJA 3RX5A 4OLYH 2JB5L 3L5IA 4KDTA 3WN5A 3DV6A 3DLQR 1RZKH 1LO4H 5H35B 5L0QC 4FTVA 1L0XA 2VLJA 5DMIH 4DQOL 2VO5A 2D7OA 5D2NE 3F6LA 5FUZL 4JHWH 5GGUB 3ZSSA 5ETUB 3MFGB 2W91A 1MFEH 5KS9B 1FZMB 4LQ1A 3KYNA 3EOTL 5BJTA 4LHUA 3L3KA 4L4TE 4I9WD 4ZO7A 2AJ3A 3GHEH 5ALCH 4NSKB 3PWPD 4OGAD 5FB8A 1S8DB 3LRHA 4POYA 3I6GA 4FFWD 4H5SA 5ANME 3U82B 1MLBA 4OV5A 3ROOA 1BQLH 1JPGA 4HXBL 5J6HA 4P46A 3E6FB 2QHRH 5E95B 4KMQA 4YUEL 5MERA 4KRLB 1N0XH 1U8NA 1ZA6B 2Y23A 4OZFG 4FQIL 4YXHL 3K80A 2B5IC 1BZQK 2YD1A 1KCRL 4U1IA 4X5LA 2HFGH 1GZPA 1IGIL 1FRGL 2PYED 5C0JB 4QOKD 1TCMA 2HJLB 3ARDD 3PV6A 4D8PA 4LLWA 5DMJB 5IG7B 1TNNA 1ZEAH 2R1XA 1NFDF 4PJGE 2EECA 1CXFA 4G7VL 5T5NF 3VE0A 2KL6A 5LJYH 2EH7H 5LGKA 5JUEH 4OD3L 3BEWA 3P30L 3TA3C 2X44D 1INEH 1YY9D 3DSFH 4RAVB 2LTQB 5GRVL 1ZLVH 2A83B 5D7LD 3D39B 2DM3A 2DI7A 5F9WC 5DRXB 1U95A 4ZG1A 3HG1A 4JY5L 5E5RB 1OTUD 2CLZB 2F58H 3QUMH 2QLVB 2ZOLA 3OB0H 4UI2A 1DBJH 3RVXC 3ISWA 5KVGL 3I75A 4PRAA 3NCFB 3O41B 4F7TB 5I8EB 4KWUA 4TUOA 1ZT7A 3HNVH 3QNYB 1QFUL 1FCCA 4XZUA 3RWGA 2CRYA 5C09A 4RGMC 3BYTA 3MTRA 2MJWA 4BSWB 5HYQA 5L9DH 1CT8A 5DUML 1T7VA 4MQ7A 2PETA 2H2PD 3UJTL 3WLBA 4MJIE 4Y19E 3EDFA 3SDCB 1DQLL 3DX6B 3HE6B 4CU7A 3DYOA 5D7IE 2X6MA 5TF0A 4PYGA 3Q2CA 3CFEB 1IFHL 4N90E 1F4YL 1AQKL 5E24E 2BVEA 5JW5B 4P2RB 5HGAB 3GSXB 1UWEL 1M05B 1OLZA 2VE6A 5KTEH 1JPTL 1HI6A 4HT1H 2FYYA 4MVBC 3W0WD 4FZEL 2VLME 3RDTB 4BA8A 5I9QB 1DR9A 3T4YB 3P2TA 3KNBB 1P2CA 3ARGA 3GRWH 4ODTH 4PRBB 1A6ZB 2ZJSL 4O5LH 3HRZA 4P2OA 5C0EA 4GW1A 3EOBA 4CKVX 3K0WA 4Z7QE 1NL0H 5C0CB 3QEHA 1CQYA 2FD6H 3RPKA 1KG0A 2OR9L 4U1GC 3ES6B 4NDMA 5AEAA 5INDA 4OIBA 2GK0B 3WV0A 4UINH 3RKDC 4GAYB 4IOIB 1S7UA 3HN3A 4QHKJ 1MIEH 3AXLB 4OBSA 2KQNA 1L7TL 1WZ1L 2XICA 3ILQD 4FG6C 2FDBP 4WENB 3S3PA 5IB2B 3L5WB 5FYJL 2ZCLL 4X5WA 4WO4C 3U2SB 4WIQA 3TYGH 4DN3L 5EU4B 2EYTA 4M6OH 1IJ9A 4EN3C 3DJ9A 1SMOA 3ARXA 3IXAA 3EYUH 4JFZL 4PP1C 3WN5B 4ZUVA 1MFBL 1G6RB 4IMKA 1N5AA 1J05A 1NFDB 4ELKA 3BGFB 3Q5TA 5JHDD 2G60L 1CFBA 4HJ0C 3OKMB 4KK8C 2VLJB 4L3EB 3BKJL 3CMOL 4MXWH 2AJYH 2HLAA 1JPFA 5AYUL 43CAB 2H26A 2X42A 1MCOL 1AFVL 5CP7A 1KJ3L 4GAFB 1N2RA 1SJXA 1T2QL 1U8PA 2BX5A 5BJTB 3W11D 1K9TA 1KCVL 1UB6A 4M02A 3JUZA 4HJGB 1JTOA 2YPLE 5JO5A 5FB8B 2OR8A 3VGEA 3I6GB 1MLBB 4OV5B 2CMRH 1DFBL 2YWZA 5SWZD 5J6HB 4P46B 3ZHDA 4GRLB 5MERB 2V5YA 1U3HC 4X7SL 4I5BA 4ORGA 3DETC 1MCFA 4XAWH 4U1IB 4Y2OA 1YEJH 4M8QA 3ARFD 2OCFD 2W38A 1YC7A 1ZVSA 4OZHF 5FA3A 4B41A 2H6PA 1KIUA 4GXVH 3CD4A 3KYMA 4S0TD 2EDBA 1UZ8A 3HUJF 3HKFA 4I77L 3NFPA 3BEWB 4X99A 1TPXC 2XZZA 3EJZD 3SKMA 5LGJA 3ULUF 1U95B 1CDBA 3HG1B 2EC9T 2O5XH 3MJ8B 3WYRA 2XRAL 4KAQL 4OD2A 3GMNB 2IBZX 2BVPA 4ODSH 2ZOLB 3W81A 2FHCA 4NC0B 2W9DL 3I75B 4PRAB 1K8DA 1WICA 1P4IH 4TUOB 1ZT7B 1RIHH 4IIQB 4IHOA 2P8LB 4XZUB 3RWGB 4K8RH 3VA2C 4YC2C 2OI9B 1L7IL 3BGMA 3TV3L 2YR3A 1LQSR 4GKNB 5HYQB 1KB5L 1FG9C 3G5ZB 5T3XL 2WWKO 1U6AH 2VABA 4YDIL 4LL9A 1AGBA 2EE2A 2NY1B 3O3EB 4R2GD 1OW0A 5BVPH 2BCKB 3EYVA 1XIWC 3BX7C 1TZGL 5DD1H 3DROA 4OQTA 4XWOD 4DGVH 1K4DA 3O6LL 5D1ZD 5DC4B 4MYWB 5C7XH 4RSVA 1C5BH 2Y06L 5I8OH 1H3WM 1L0QA 5DGQA 4P9HL 2FYYB 1M6OA 5I30H 1RUAL 4WW1A 4WFHE 4XPTL 4LKCA 5JXEC 4KTYA 3ARGB 5E2TL 2QJDA 1HSBA 4ONHA 2D7TL 1JF1A 3ULVF 5DR5H 3HRZB 4P2OB 5C0EB 2R23B 4JPIB 2PXYA 3EOBB 5L2KA 4Y1AE 1FFQA 1RUML 4O51B 2C4FU 2DYPA 3QEHB 1MCKA 2XPGA 4HJJL 3NPZB 5DEFB 2FLBT 3WXWL 4NDMB 1NBZA 1TQBB 3BWAA 1FAIL 2OS7A 4RGNE 1JZ2A 8FABB 3VXME 5D1QA 3LY6A 4C83B 3QIWD 3RL1A 3V8OA 1NEZA 1Q9OA 1X7QA 1Q0YH 4U6XA 2WWMC 3N0PB 1BJMA 3H3PL 1F4AA 4PJ8D 1IAMA 3NA9H 4ZFGL 32C2A 5L2JA 5CZXC 4WY7H 4X5WB 4L8DB 5GGRY 3U0TB 3OKKB 1F8TH 2CO6B 5GQBA 2ZSWB 3C6SA 3KDMA 3IJSA 1AY1L 3IXAB 1EBAA 2J88L 4ZUVB 5EBWB 1J5OL 4ELKB 1N5AB 1J05B 3GEWB 5I1KL 5IESH 1AXTH 4QCIA 4O9HH 4ZPTA 1IM9D 2VQTA 1X3DA 2Y5EA 2V2XA 4JRYD 2LTQC 3REVB 4DUVA 1JZ4A 2H26B 1CGXA 4M7KL 4OFKA 5DUPH 5IBTL 4PJ5A 4AIXA 1N2RB 2CPCA 3MUY1 1U8PB 4KMTL 3S9DB 3PIQA 5AWNL 3FO0L 3WD5L 4R4ND 4LASL 4YWGH 5T1LA 2IMMA 1IEAA 3TFKD 1VPOL 4K3JL 2Q76A 2WWKT 3MLXL 2XQYG 3NIGF 2FX8H 3BQUC 3TCLB 4I5BB 4X8JB 2YUVA 1G0YR 5DQDH 4Z9KB 1OAXH 2IAMA 4APQD 4M8QB 2AQ3A 4XX1E 3SDCC 5IMKA 3ARWA 3HC0A 3VFWA 3HE6C 5D7JC 2YBRA 1H3UA 2P43B 2F9BT 2CK0L 2H6PB 1MSPA 3KYMB 1D9KD 5ENWB 3E6HA 3QHFL 3KGRA 1UZ8B 3TWCL 4Z0XA 4Z7QF 5K33A 3PP4L 4X80H 3NFPB 5CIPA 2WBJD 2ZNWA 1NLDL 4XVJH 4JN2B 2JJTA 5ICZA 1U9KA 4ONFH 5C3TA 5ANMB 5GZOC 4X83A 3RDTC 4QY8A 4OD2B 5I1DB 5I9QC 4NOFA 2A77L 3F12A 5GGSY 3HI5L 2ADIA 1A0QH 3R8QA 4IOFD 3V52H 2PKDA 3UZEA 1BQHA 1I1FA 3S97C 2G5BB 3EO9L 4IHOB 1HQRB 3FN3A 5I74B 3UYPA 1W8OA 3S8WA 3BGMB 1OAYL 3TN0D 4GAGL 1DQML 1I1AA 3N85L 5FK9A 4QHMA 2HT3D 2VDPL 3FZUC 5C9KA 1MLCB 2NY2B 3MJGX 4PG9B 1TJIH 3U7WL 2EDFA 4P23A 1AGBB 2YRLA 1A7RH 1FZKB 3BDBA 1H9VA 3NFNA 5SV3A 3L6FA 5D70L 2DTML 3OBAA 2ZUQC 4FQCH 4MJ5B 2F5AH 3JV4B 3DROB 4NFCA 5FM4A 4ODXB 3T65B 3QUZC 2Y07H 1A7BA 4RBPK 1P9MA 4N5EC 4AQ1B 2EKJA 3B9VA 2X70A 3WLWC 4GMTH 1PEZA 2HH0L 4HZLA 3TH3T 3IDYC 1K85A 3KPOA 3DUUB 4LKCB 4R4BA 1ZLUK 2VR9A 3Q1SL 4LSUL 4DWHA 3BGFC 4M7JL 5BOPA 3FHAA 1IT9H 2A9MH 4HUWA 1NUGA 1ZANL 1D6EB 1JF1B 4NOBA 3GHBH 3CXDL 3BIAX 4MJIB 4PRPD 3TBYA 1NCAH 4HWUA 4YXKH 2NX5E 3LQZB 5K9JL 3DGGB 1CGUA 2ZG2A 2GEEA 5HI3D 1XCTA 4R26L 5T1KD 4HKZA 3W9DB 2ARJQ 2FRGP 2XPGB 1TJGH 2R29L 3BE1L 4ZDHA 3V4PH 4Q9QH 4M1DH 3H9SA 2BOCA 1NBZB 2QADD 3BWAB 1BREA 1KXTB 1MCBA 4U1LA 5HYSA 4MNQE 4YPGB 3IXTA 4AG4H 1NEZB 2CRIA 1R3JA 3JVGC 1Q9OB 1X7QB 5L6YH 4GRLC 1OSZB 4NZRH 3QFJA 5E6IA 3BZ4A 1A7NL 3IAGC 5EOCH 5AD0B 2HKFL 1H3VA 5L2JB 5FAAA 4LCWE 5F72S 4CW1A 3DRQA 4Z7WF 3P4LA 5I1JL 3KDMB 2E7LA 4LSQL 4PJFE 2HYMA 3F7QA 4QCIB 4KROD 4QRPE 4TOYL 1CXLA 4OFYD 4POUB 2E27H 1UFUA 5KW9H 2D3VA 2V2XB 1PVHA 5ESAA 2D0HA 5A2KH 3WFZA 4AIOA 2LFGA 1U58A 5E9DE 3C8DA 4JRXD 5CLTA 5BZDB 2JKXA 3MRMB 3PIQB 1T83A 1JE6A 4QXGH 1K6QL 3QWRD 5B39B 4ZS6D 5T1LB 4KUZL 1RZIA 1NC2B 1IEAB 1W72L 4IIQC 2HKHL 3IETA 2OI9C 2OK0H 4R90L 4KVNH 3B5GA 5EZLA 4R97B 1QRNB 2YPVL 3GO1H 1B88A 4XCCL 5KANI 1YA5A 1FH5L 1TETH 4I2XB 5F3HB 5IMKB 3O4LA 3VFWB 2EO9A 4CUCA 2HT2C 2YBRB 4N9GA 2BNRD 1BWMA 4P5KA 3NABL 3NH7H 4S10A 3AREA 2O5YH 3QDHA 5T5NG 4HHAA 2NTFB 5JA9A 4GQ9L 1OVZA 5JDSA 3DMMB 3GI9L 3CVIL 1YN7A 3HI1A 5ADOL 3QULB 4CU6A 5CIPB 3OB8A 4QXUL 1JGEA 5ICZB 2CLRB 4UMGA 1NJ9B 5MENE 2J4WL 4QY8B 3KPQB 5I1IL 5MP6L 3F12B 3RHWK 4GRWH 4PRNA 5TFSL 3ARGC 5FKPA 4TVPL 1CICA 1AC0A 3GMPA 4XPGH 4P2OC 3H0TA 3HAEB 3D87B 1T0PB 3VI4E 4UU9B 1BIHA 2V7HA 4HUNB 1OY3B 1IEBB 1CXEA 3U9PL 1U8JA 4I3GA 3HC3H 5IMMB 2B2XL 4P23B 1B0GA 3M07A 2J8UA 1IAIL 3HS0A 4O2CA 1TQBC 4HIEA 3QT2A 4NN5C 2FR4A 2NYYC 4PJIE 3GIZH 5BRZE 3NFNB 3L6FB 3LV3B 3LSOA 2IPKA 3TT3L 1KCLA 4HMEA 1GL4B 5DJYA 5FO8A 1ZHLA 3QPQD 2X70B 2CIIB 2K1MA 3RWHB 4DAGL 2QSQA 4HZLB 3MRRA 4Z7WB 1OARH 2K9UA 4CJ1A 4R4BB 1B0RA 1KUMA 4XMLH 3MRIA 3DYPA 4FFZL 3O0RH 3B6SA 5DFWH 4UTAH 5IROA 1HN1A 2OQJA 2A6DA 4HUWB 4OUOA 2R1WB 5D96C 1MWAH 2BNQD 5IFJA 3KJ4B 2GSIB 2Y36L 3BPCB 1UACH 3TBYB 5DO2C 4JB9L 1RAMA 4JEGB 1A3LL 1OSPH 3GUTA 4MQTB 2V5SA 4GG8B 4KJWC 5E4EB 4RFNC 3PABB 3FT4B 4PGBA 2EH8L 3RVVD 2BOCB 3TM6A 4M6MH 3UYRL 4M61A 4U1LB 1BFVH 3F7VA 3IXTB 1NKRA 3PGCA 1RK0A 1R3JB 2QQNL 4IRJD 2NPLX 1U8OA 2VXSL 3DTXB 5E6IB 3BZ4B 1FLTX 2DD8H 3KVQA 3LEYH 1I9RL 5GGRA 3QO1B 4Z76B 5ITBL 3U1SH 4CW1B 1RHFA 5IKCA 1VGEH 4DCQA 5HYJD 2EKSA 4ZXBB 3ZKSD 1J8HA 3ZO0A 4DTGH 1FPTH 5D2NC 4KXZI 5HPMB 3U4EA 1F11A 1LP9E 1BD2A 3SEPA 5ESAB 1RHHA 3T0EA 2KZWA 1U58B 3AY4A 5IBLC 3B5TA 4CL7A 1WZMA 5BXFB 3B2UC 1JFQL 3HMXH 2D0GA 4AY0A 4WUKH 1UENA 5DD3L 5IW1B 4PREA 2W0FB 3H9HA 4Y5XC 5FCUL 5C2BL 4J3WA 1H5BB 2ADFL 1F00I 3MFFB 3FT2A 3N9GL 3IDXL 1T4KA 4YO0B 3RPIB 5F8QC 4F9PA 2BXYA 3VRIB 5I75B 1DBBH 3IETB 5I74C 5BMFL 1KIQA 4MHHI 5D7SL 1AKJB 3A67H 1AR2A 2F53D 2W65B 3BDYH 5HHVL 4U31A 1HILA 1FFOB 3SE9H 5DJ2B 4ZD3L 3HNTH 4TN9A 5EDXA 2BZDA 1R3IL 2NY2C 4WHTA 3MMEA 4Y5VA 3O4LB 2QSCH 5EO0B 1PZ5A 4JFQA 3TO4A 4N9GB 3DI2B 4TSAL 4D2NA 2D7MA 4OFVA 3AREB 1MCQA 1LK3L 2ZUYA 1JBJA 2C3WA 2DKSA 1O7SA 1GOFA 2H45A 4F15B 1YN7B 1J1PL 2AKRA 4HQQL 4FQ2H 3O2DL 4JO2L 4POZC 1JGEB 5J06A 1CL7H 1AXSA 1F4HA 1UB5A 1QO3A 5GGSA 3WCYA 2PUQT 3MCKA 1PLGL 5FHAH 4EI5B 1JMXA 2E9IA 3UPRB 3NIFE 4P4RA 5GRJH 5FKPB 1AQDA 4WI2A 2B4CL 5CMAA 1CICB 3QEQE 4WV1A 1C8PA 3CIQA 3CDGB 5J3HC 3H0TB 4LSSH 4L3AA 2BVOA 5HHPA 2AK4A 1EUTA 1NMBL 3KPSE 2ARJB 2YRPA 4XAKE 2RFXB 5CD3A 4I3RH 5JOPE 1U8MA 4M5YH 4MA8H 4PJFF 2FX7H 4UOJA 2DDQH 1U8JB 5GZND 3SGKA 1X9QA 3MLVL 3WKML 5EZIL 3HS0B 3MROA 2CRMA 4AT6B 1E4XL 4P48A 2C4XA 4V1DD 4LPXA 2FR4B 2X1PA 5C6WH 2DWEA 3LSOB 2IPKB 4NNPL 2IH3A 1B3JA 5HHQB 1JHLH 4NM4H 3HZVA 2EDNA 4OFPA 1WFNA 5FO8B 3FO9B 4OGYH 4X6CE 2BOBB 3CJJA 3MRRB 3IDNB 3RA7L 4M7ZC 1Z9SA 4XP9L 3VXTA 3SKJH 3MRIB 4XRCA 3RIFK 3B6SB 4K94L 5I1EH 3VG9C 2DQGH 1X5KA 5F44A 2A6DB 2WUCL 3G08A 4F2MA 3V5HA 1HHKA 4JPVH 4PTTA 3ZYIA 2P5EA 1ULVA 4ZUUB 1PQZB 3D85B 1UWGL 4UIKL 5HHXH 3LD8B 4Y16D 5HGBB 4KC3B 4PGBB 4ENED 4XWGH 2DLTA 4PTUA 5M7QA 2OP4H 1DL7L 4CMMB 5L88L 1I1CA 3F7VB 1AE6H 3D2UD 4G9DA 1RK0B 1HKLL 1U8OB 2PCPA 1URLA 4R97C 3H3BC 2P8MB 5GGRB 1I8IB 5E8OA 2W9LA 1CBVL 5F89A 2HTKD 2EKSB 1OD7A 3ARZA 3QDMA 5IP4A 3KPPA 4S1QL 1QLFB 2P5WE 4U0RB 1BBJA 4U2YA 4FQLH 4UB0L 2AABL 1IKNA 1MRFH 1FGVH 3U4EB 4BKLB 1F11B 5DZLA 3FOMA 5I8CA 3X17A 1BD2B 3DMMC 5D2LE 3JWOH 3QCUL 4KKLC 5DD5H 2AS5M 2ED7A 5J11B 3T0EB 4JHBA 1MFDH 5FYLD 4HK0B 2OTPA 3BVNB 4QHKI 2JF1A 1A1NA 1OP5H 1B9ZA 2NY6B 4PJIF 4MNQB 3EYFA 3ZL4H 3TJHD 3VW3H 4K9EC 4F7PA 4G6KH 2DF3A 3FT2B 1NEZG 3PHSA 4JFYA 3S96B 3IFNH 3GMLB 1F5WA 1KIQB 3BZFB 3OHXA 4GSDL 5H37G 2VDOH 3PHQA 1FYHB 1HILB 3DHJA 1VDGA 1KYOJ 1UKTA 4LCCC 5LXGL 5J89A 3WS3A 1I9IH 4G8FB 4WHTB 3C2AH 3OAZH 1Q72L 3KYKL 3MMEB 3QIBB 4QRPB 2P42B 4JFQB 5HYIA 4RWYH 5IIEA 2BSSB 1C12A 5ESQB 1EHNA 4ORZC 4OLEA 2G75A 3UTPE 5E9DB 4P57B 3WHXB 2FWOB 5TPWH 4K2UL 4BUGA 4OZIF 2FATH 1W0YT 1NGWB 4NQEA 5C08D 1WAAF 2X2YA 3L3DB 1JI1A 3FRPG 4MNHB 4XCFL 3VXRD 2AKRB 2YUZA 3TNMB 3DUSA 3EO1B 1EEZA 4HCRA 2VITA 1T66D 5DHVH 1CDCA 4OCSH 1AXSB 4BH8B 1UB5B 3AB0C 3MA7A 1CD9B 2YHGA 5FYJU 5I18H 5B39G 1IC4L 5D7KD 3T1FB 2DM4A 1HWGB 1AQDB 4Y89A 2CJUL 5HHOD 1L6XA 4WV1B 4J4PA 3SCMA 3KJ4C 4H26A 4AK1A 1J0ZA 3O6MH 5MEPA 2IALA 5HHPB 4HG4J 3JWDC 2AK4B 4NKOA 4M3JA 2ICCA 3VFRA 5CD3B 3K8KA 2OZ4A 1R5WA 1U8MB 3RVUC 5F7DA 2NW3A 4E9LA 4EUPB 1QOKA 3RNKB 1ORQB 3MROB 1OCWL 5GSRA 2CRZA 3ARTA 1QFWL 3O3AA 4JVUA 2RCSH 1Q9LB 1HWHB 2WLYA 4OF3A 15C8H 2IH3B 4E41D 5E6IC 4Z95H 3I6KB 5JHDE 3PGFH 1WCQA 2Z91A 1A64A 2UWEA 4CAGA 1PG7X 2IH1A 3Q48A 3BIKA 2VXVL 5F7NC 1CDHA 1MF2L 4JFEA 3BMVA 3O3DB 1CTOA 4ZXBC 3VXTB 5KVEH 4FHBD 2NY5H 4XRCB 2OR7A 3FFCE 4M5ZL 1JV5A 4K55A 1WBXA 3FO1B 3N1QC 4F2MB 2NY3B 4JG0L 4PJCA 1AHWA 3HAEG 2OZ4H 4PTTB 2RJMA 3MLWH 4NQDE 2FIKA 1UWXK 3LS4L 2I9LA 3I84A 3DXAB 3WSQL 3PDGA 5JORB 5FUOH 3VCLA 2CGRL 1IE5A 5BRZB 3QAZB 4FP8H 3QUYD 4ZUWA 3VXNA 1CFTA 3UMTA 1H5BC 3IDJB 2AEPL 1MJ7H 4XGZA 5C6TH 1Q0XH 1RZJH 2YK1H 1A2YB 3VFNA 1FO0H 4U6YA 3V6FA 3D25A 1EMTL 3GSQA 3IKCB 1HDMB 5J13B 3LH2H 4LLVA 1I7UB 2BERA 3BGAA 4WUUD 5JPNA 3BP6A 4W81A 3WJLA 4Q9RL 2NXZB 5HHNB 4ODHL 2F19H 5I19L 5F89B 1P7QB 2AJUL 3O9WC 4WI9A 5F9DC 1CXIA 5L2KE 3WFBL 2C4FT 1H8NA 1BBJB 2W59A 2R8SH 1ZK9A 1J1OL 4TNWK 5I8CB 4OM1L 4KRPC 3ZE1E 2XZAL 1LGVA 4OZIB 3VH8G 2D03L 3O6KH 4GMSL 5EU3A 1ADQL 1NANI 2BC4B 3AM8C 3EOTH 5KN5A 1A1NB 4C56D 3WFEL 4M00A 5AAWA 3C87A 2I60H 2XT1B 2PYEA 1I3GL 4QOKA 3EYFB 3ARDA 4NQTA 1BF2A 4P59H 4EI5C 2DQFA 2EEBA 1T1YB 4FG6D 4OKVA 2FO4B 2WIIB 3FQXB 1CICC 1JYXA 3EKCA 5IW6A 3PL6C 1FSKB 1NC4D 2H9GB 4JFYB 5F1OB 4FQIH 1FNEA 5C0BB 4WO4D 3OHXB 2ZOKB 4PJ7A 2E6JA 1IGIH 3ARQA 2AV1A 2EE6A 3HE7C 2GJ6E 4XNYH 5IF0A 4ZSOB 2A6JB 2XZQH 5D7LA 3V0AC 3MYJB 4PP1D 5DEGA 4XXDA 3WXVH 4HJ0D 1HXYA 3QEGL 5GS0L 2OJZL 4G7VH 3KYAA 2DI8A 3UDWC 3M8OL 3SDXE 5IIEB 4G9FD 2X7LA 4HLZG 3U0WH 2BDNL 1ACYL 4CNIA 4EDXB 2MPAL 4OD3H 2FHFA 3MV9D 5EO1B 2UUDK 1JHKH 3MACL 3BKYH 5DZNA 5TQ0H 3V6OC 5GS3A 1B4JH 3LEVL 3P4OB 2J8OA 1II4E 4PY8J 3MQIA 1KTRL 4JR9H 4G6MH 2X89D 4JY5H 3T4AA 1EEZB 3FAXA 3WNPA 4HS3A 1DUYB 2X4QA 4JKPL 1A3RH 4LLMA 2H32H 3CVHA 4GH7B 2IPTL 1X4YA 1WCBA 3MA7B 3UBXI 3CSPA 2AV7A 4UDTB 5AZ2H 2MTPA 3WDJA 2GAZA 1TDQA 2JCCA 1U3HD 4R96A 3DETD 1MFCL 3MLZL 2HRPL 4JLRB 2VMFA 4L4VD 2M1KA 1GH7A 1UXSA 3WIFA 3S35X 1S78D 1S7TA 3SCMB 2XN9D 2JJSA 1KJ2A 4H26B 5DUMH 5I1CL 4NFBA 5GRVK 1NCNA 4JZJA 2IALB 4PJEF 4GS7B 4NKOB 3VFTA 3EIFA 2DQDH 1DQLH 1CXHA 1T5WA 2ITDA 4PJXF 1R5WB 3IS1X 4PB9L 5F7DB 1WIUA 2NW3B 3W0WA 1IFHH 4RMSA 5EU7C 3IFPA 1C1EL 4QRRD 3AU1B 1UWEH 3QXWA 3RKPA 3NBNA 4JJHA 1N6UA 4WTXA 3EFDL 1XF3B 4WJ5B 5HHMB 5GJSH 4I3SH 3R06A 4QF1A 2NLJA 1SY6L 3QIUD 5DVOA 3ZDZE 2IH1B 2AJVH 1IQDA 3VJ6B 3QEQB 4HC1L 4U0RC 1AP2A 4OGXL 3T3PF 5F7EL 2BVTA 1I4FA 1Y6KR 3KPSB 1FVDA 4PJCB 3T0EC 4LNVA 2J6EH 4NHUA 1H3XA 2FIKB 5BV7L 2DQHL 3IAQA 3RBGA 3T2NL 2VQUA 1N6QH 2N7BA 4H0IA 4HUXB 4OQ1A 1WEJH 1CLOL 1JGDB 5T3XD 3VCLB 4JY4B 1DLHA 1XIWD 1EZVY 3I50H 4BFIA 1S7SA 4ZUWB 3G9AB 5IBUB 3BEVB 4NJAH 1ZXQA 3INUH 3RWCA 3EDKA 4U6YB 5HVHC 1KCSL 3D25B 2F5BH 2R0KL 5F71A 3GSQB 3LAFA 5FYJH 4DUXA 4LLVB 2LU4A 4WEUD 4KVCH 2SEBA 5JPNB 2IFFL 1N6VA 3BP6B 3LPWA 5JXED 5FKAA 5ID1A 3QIBC 1A4KB 1JGUH 1OAZH 5JOFB 4H1LB 3SE3C 4HV8B 3GBLA 3LS5H 3PWPB 3BKJH 3CMOH 5F70A 5I71C 4RRPA 3ZDYF 3T0DA 2RBLA 1X5IA 5F7LB 5EBLA 4Z78A 2F54E 4Q2ZB 3H9SE 2V6HA 1KJ3H 5ISZD 5D8JH 2R2EA 2C26A 1T2QH 4PJHF 5EU3B 1EX0A 1IILE 2ARWA 4YJZL 4YHLH 5KN5B 1KCVH 4KKAC 4GT7A 4EDWL 2R2BA 5GS1B 5GRUH 3ARFA 1RULH 1AJ7L 4QOKB 3ARDB 3MLUL 2DQFB 1X5JA 4YEFA 4KRNA 2BHYA 1CI5A 4JFFE 5IW6B 1H3TA 4F80A 1FNEB 3MREA 3QUXA 4PJ7B 3VG0H 2AV1B 4PJEB 2NR6D 1HOCA 2P5WB 4PJXB 4AENA 3DVIA 4XXDB 1WUNT 3GK8H 1T5XA 4CN1A 1KFAH 5I1LA 2OTWB 4YHIA 1OP9A 2FX9H 5TDPA 2A9NL 2AJZB 2X7LB 4I77H 1FL3B