5I3MA

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated thiourea-linked carboxylate zinc-chelator water-soluble inhibitor (dc31).
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHQIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i3mA00
5CXAA 3B92A 4IN9A 3AYKA 2OVZA 4XBHA 4WF6A 4H1QA 1Y0VA 1D8MA 1Q3AA 3WV3A 3LQBA 1J7NA 1I73A 2OY4A 2SRTA 2HU6A 2AIGP 2OW1A 2X3BA 1PWVA 3LJGA 4ILWD 1A86A 3LIKA 3DSLA 3SHIA 1B8YA 2A8HA 4PKWA 2OI0A 4FU4A 1YP1A 1SLNA 4WZVA 4QKZA 1S4BP 1HFCA 3DNGA 1UTTA 1UTZA 4PKTA 2RJPA 2DDYA 2CKIA 1G05A 2EROA 4FXQA 1AKLA 1SMPA 4IJOA 3I7IA 3ZXHA 4GR3A 2YB9A 1BZSA 1IAAA 5H8XA 3ZUKA 1XUCA 1CGLA 1QJIA 2POJA 2FV5A 5CZMA 1IAGA 1BQQM 1K7GA 1EB6A 3DWBA 1ZXCA 2K9CA 2OXZA 1C8TA 3L0TA 1O0QA 1H71P 5D1TA 5I43A 1BUVM 3N2VA 3LQ0A 1FBLA 1PWQA 1YQYA 2MZHA 2AYKA 2OW0A 3AYUA 2DW0A 1G9KA 1BSWA 1D8FA 2OY2A 3V96B 1JIZA 2W14A 1JH1A 3P24A 4JA1A 5D2BA 3EHXA 4H49A 3HY9A 4EFSA 2PJTA 1IABA 1G12A 4I35A 4J4MA 2DW1A 5CUHA 2X3CA 4DD8A 1MNCA 3E8RA 1CIZA 1USNA 3G5CA 2E2DA 3LIRA 1XFWA 1JAOA 4PKSA 2X3AA 1OS9A 1XFZA 5L7FA 1R54A 4WKIA 3TT4A 1MMQA 1C3IA 1SRPA 3HBVP 2XS3A 456CA 2Y6CA 3L0VA 966CA 1GO7P 2X7MA 3LJTA 1JIWP 2K2GA 3GBOA 4H3XA 1QUAA 1JK3A 2ERQA 3HBUP 4A7BA 1Y93A 2MLSA 4G0DA 4L19A 1KUKA 5D3CA 3RTSA 1AF0A 3TSKA 3KRYA 3KEKA 1HFSA 3TVCA 1BQOA 1I76A 1OMJA 3G42A 3F17A 4L6TA 3WV2A 1GE5A 1D7XA 1GXDA 2W0DA 2V4BA 2Y6DA 3AIGA 3ZVSA 2WOAA 1G49A 1JAQA 2MZEA 4ON1A 3LGPA 3DPEA 5B5OA 3EDIA 1SLMA 2JIHA 4FXYP 1ZTQA 2CLTA 1XFXA 2OZRA 5I0LA 1UEAA 2I47A 1XFUA 1C7KA 4G9LA 3OHLA 4GWNA 1HOVA 4GF1A 2TCLA 4GR0A 3U1RA 1KUGA 5LABA 1OS2A 1KUFA 1CQRA 1CXVA 3RTTA 4A3WA 1CAQA 3F16A 3VTGA 1PWUA 4GR8A 1ROSA 2OW9A 2WO9A 2W15A 1CGEA 5B5PA 3TS4A 2ERPA 2D1OA 5L79A 1OO9A 1ZS0A 4AIGA 2RJQA 4AYKA 1DMTA 1GE7A 1ND1A 2J0TA 5D1UA 1BM6A 2DW2A 3KWVC 1EAKA 4JIJA 3B8ZA 2N8RA 3K7LA 1I1IP 4H76A 1FM1A 1Z3JA 3ELMA 3Q2HA 1WNIA 3KHIA 1OM6A 2XS4A 2L0RA 5I4OA 4H82A 2OW2A 1R55A 2MLRA 4PKRA 4ZR5A 3LJZA 1RMZA 4GQLA 1ASTA 3LE9A 3P1VA 3HDBA 3WV1A 3VI1A 2JT5A 3LILA 3NX7A 3HB2P 4FVLA 1R1IA 3CKIA 1RM8A 3N2UA 4H2EA 3LKAA 5D7WA 3EDHA 1ZVXA 2JSDA 3LUMA 1BKCE 2E3XA 2FV9A 4XCTA 1GKDA 2Z2DA 3LUNA 3EDZA 1GO8P 4IUWA 4AXQA 1GKCA 1EUBA 1Y8JA 3EHYA 1SU3A 2WO8A 1L6JA 5D1SA 1KUHA 2QPJA 5BOYA 2KRJA 1ZXVA 830CA 4L63A 1JAPA 1IAEA 2JT6A 2MZIA 1HV5A 3KECA 4WK7A 4XM8A 5BOTA 1PWWA 1G4KA 3KEJA 1QJJA 3DPFA 1K7QA 3DL1A 4CTHA 1XUDA 2OVXA 3F19A 1ATLA 4JPAA 1ZP5A 3BA0A 3KMCA 3O64A 4PKQA 3LK8A 2O36A 1K7IA 2O3EA 3HDAP 5JMYA 4H84A 3F1AA 1B3DA 2J83A 2JNPA 4JQGA 1DTHA 4GUYA 1CK7A 4I03A 3KMEA 4Q1LA 4DF9A 5I12A 1BUDA 1JANA 3O2XA 1MMBA 2OXUA 1OM7A 4H30A 1IADA 1KBCA 3HY7A 1MMRA 4HX3A 1YCMA 3OHOA 1XFYA 4XM7A 1QICA 2DDFA 5I2ZA 3MA2A 3EDGA 3EWJA 3LEAA 4PKVA 5I3MA 2YIGA 4R3VA 2W12A 2W13A 3F15A 1HY7A 3HYGA 3F18A 2USNA 1BIWA 1R1HA 1UMTA 1BKCA 3USNA 4GWMA 1SATA 1OM8A 1XFVA 1O0TA 4XM6A 1R1JA 1BKCI 1YOUA 1CGFA 1XURA 4PKUA 1JJ9A 1IACA 2D1NA 1UMSA 4DPEA 1HTDA 3K7NA 3UVCA 1KUIA 1QIBA 4JP4A 1JKYA 3I7GA 4DV8A 1D5JA 1QIAA 1A85A 4AUOA 4HMAA 2OXWA 1KAPP 3B2ZA 4WKEA 1GE6A 3LMCA 1FLSA 1MMPA 3Q2GA 1AYKA 1PWPA 5BPAA
chains in the Genus database with same CATH superfamily
5CXAA 3B92A 4IN9A 3AYKA 2YUFA 2OVZA 4XBHA 4WF6A 4H1QA 1Y0VA 1D8MA 1Q3AA 3WV3A 3LQBA 1J7NA 1I73A 2OY4A 2SRTA 2HU6A 2AIGP 2OW1A 2X3BA 1PWVA 3LJGA 4ILWD 1A86A 3LIKA 3DSLA 3SHIA 1B8YA 2A8HA 4PKWA 2OI0A 4FU4A 1YP1A 1SLNA 4WZVA 4QKZA 1S4BP 1HFCA 3DNGA 1UTTA 1UTZA 4PKTA 2RJPA 2DDYA 2CKIA 1G05A 2EROA 4FXQA 1AKLA 1SMPA 4IJOA 3I7IA 3ZXHA 4GR3A 2YB9A 1BZSA 1IAAA 5H8XA 3ZUKA 1XUCA 1CGLA 1QJIA 2POJA 2FV5A 5CZMA 1IAGA 1BQQM 1K7GA 1EB6A 3DWBA 1ZXCA 2K9CA 2OXZA 1C8TA 3L0TA 1O0QA 1H71P 5D1TA 5I43A 1BUVM 3N2VA 3LQ0A 1FBLA 1PWQA 1YQYA 2MZHA 2AYKA 2OW0A 3AYUA 2DW0A 1G9KA 1BSWA 1D8FA 2OY2A 3V96B 1JIZA 2W14A 1JH1A 3P24A 4JA1A 5D2BA 3EHXA 4H49A 3HY9A 4EFSA 2PJTA 1IABA 1G12A 4I35A 4J4MA 2DW1A 5CUHA 2X3CA 4DD8A 1MNCA 3E8RA 1CIZA 1USNA 3G5CA 2E2DA 3LIRA 1XFWA 1JAOA 4PKSA 2X3AA 1OS9A 1XFZA 5L7FA 1R54A 4WKIA 3TT4A 1MMQA 1C3IA 1SRPA 3HBVP 2XS3A 456CA 2Y6CA 3L0VA 966CA 1GO7P 2X7MA 3LJTA 1JIWP 2K2GA 3GBOA 4H3XA 1QUAA 1JK3A 2ERQA 3HBUP 4A7BA 1Y93A 2MLSA 4G0DA 4L19A 1KUKA 5D3CA 3RTSA 1AF0A 3TSKA 3KRYA 3KEKA 1HFSA 3TVCA 1BQOA 1I76A 1OMJA 3G42A 3F17A 4L6TA 3WV2A 1GE5A 1D7XA 1GXDA 2W0DA 2V4BA 2Y6DA 3AIGA 3ZVSA 2WOAA 1G49A 1JAQA 2MZEA 4ON1A 3LGPA 3DPEA 5B5OA 3EDIA 1SLMA 2JIHA 4FXYP 1ZTQA 2CLTA 1XFXA 2OZRA 5I0LA 1UEAA 2I47A 1XFUA 1C7KA 4G9LA 3OHLA 4GWNA 1HOVA 4GF1A 2TCLA 4GR0A 3U1RA 1KUGA 5LABA 1OS2A 1KUFA 1CQRA 3DTKA 1CXVA 3RTTA 4A3WA 1CAQA 3F16A 3VTGA 1PWUA 4GR8A 1ROSA 2OW9A 3DTIA 2WO9A 2W15A 1CGEA 5B5PA 3TS4A 2ERPA 2D1OA 5L79A 1OO9A 1ZS0A 4AIGA 2RJQA 4AYKA 1DMTA 1GE7A 1ND1A 2J0TA 5D1UA 1BM6A 2DW2A 3KWVC 1EAKA 4JIJA 3B8ZA 2N8RA 3K7LA 1I1IP 4H76A 1FM1A 1Z3JA 3ELMA 3Q2HA 1WNIA 3KHIA 1OM6A 2XS4A 2L0RA 5I4OA 4H82A 2OW2A 1R55A 2MLRA 4PKRA 4ZR5A 3LJZA 1RMZA 4GQLA 1ASTA 3LE9A 3P1VA 3HDBA 3WV1A 3VI1A 1OZ9A 2JT5A 3LILA 3NX7A 3HB2P 4FVLA 1R1IA 3CKIA 1RM8A 3N2UA 4H2EA 3LKAA 5D7WA 3EDHA 1ZVXA 2JSDA 3LUMA 1BKCE 2E3XA 2FV9A 4XCTA 1GKDA 2Z2DA 3LUNA 3EDZA 1GO8P 4IUWA 4AXQA 1GKCA 1EUBA 1Y8JA 3EHYA 1SU3A 2WO8A 1L6JA 5D1SA 1KUHA 2QPJA 5BOYA 2KRJA 1ZXVA 830CA 4L63A 1JAPA 1IAEA 2JT6A 2MZIA 1HV5A 3KECA 4WK7A 4XM8A 5BOTA 1PWWA 1G4KA 3KEJA 1QJJA 3DPFA 1K7QA 3DL1A 4CTHA 1XUDA 2OVXA 3F19A 1ATLA 4JPAA 1ZP5A 3BA0A 3KMCA 3O64A 4PKQA 3LK8A 2O36A 1K7IA 2O3EA 3HDAP 5JMYA 4H84A 3F1AA 1B3DA 2J83A 2JNPA 4JQGA 1DTHA 4GUYA 1CK7A 4I03A 3KMEA 4Q1LA 4DF9A 5I12A 1BUDA 1JANA 3O2XA 1MMBA 2OXUA 1OM7A 4H30A 1IADA 1KBCA 3HY7A 1MMRA 4HX3A 1XAXA 1YCMA 1TVIA 3OHOA 1XFYA 4XM7A 1QICA 2DDFA 5I2ZA 3MA2A 3EDGA 3EWJA 3LEAA 4PKVA 5I3MA 2YIGA 4R3VA 2W12A 2W13A 3F15A 1HY7A 3HYGA 3F18A 2USNA 1BIWA 1R1HA 1UMTA 1XM5A 3DTEA 1BKCA 3USNA 4GWMA 1SATA 1OM8A 1XFVA 1O0TA 4XM6A 1R1JA 1BKCI 1YOUA 1CGFA 1XURA 4PKUA 1JJ9A 1IACA 2D1NA 1UMSA 4DPEA 4L7AA 1HTDA 3K7NA 3UVCA 1KUIA 1QIBA 4JP4A 1JKYA 3I7GA 4DV8A 1D5JA 1QIAA 1A85A 4AUOA 4HMAA 2OXWA 1KAPP 3B2ZA 4WKEA 1GE6A 3LMCA 1FLSA 1MMPA 3Q2GA 1AYKA 1PWPA 5BPAA
chains in the Genus database with same CATH topology
5CXAA 3B92A 4IN9A 3AYKA 2YUFA 2OVZA 4XBHA 4WF6A 4H1QA 1Y0VA 1D8MA 1Q3AA 3WV3A 3LQBA 1J7NA 1I73A 2OY4A 2SRTA 2HU6A 2AIGP 2OW1A 2X3BA 1PWVA 3LJGA 4ILWD 1A86A 3LIKA 3DSLA 3SHIA 1B8YA 2A8HA 4PKWA 2OI0A 4FU4A 1YP1A 1SLNA 4WZVA 4QKZA 1S4BP 1HFCA 3DNGA 1UTTA 1UTZA 4PKTA 2RJPA 2DDYA 2CKIA 1G05A 2EROA 4FXQA 1AKLA 1SMPA 4IJOA 3I7IA 3ZXHA 4GR3A 2YB9A 1BZSA 1IAAA 5H8XA 3ZUKA 1XUCA 1CGLA 1QJIA 2POJA 2FV5A 5CZMA 1IAGA 1BQQM 1K7GA 1EB6A 3DWBA 1ZXCA 2K9CA 2OXZA 1C8TA 3L0TA 1O0QA 1H71P 5D1TA 5I43A 1BUVM 3N2VA 3LQ0A 1FBLA 1PWQA 1YQYA 2MZHA 2AYKA 2OW0A 3AYUA 2DW0A 1G9KA 1BSWA 1D8FA 2OY2A 3V96B 1JIZA 2W14A 1JH1A 3P24A 4JA1A 5D2BA 3EHXA 4H49A 3HY9A 4EFSA 2PJTA 1IABA 1G12A 4I35A 4J4MA 2DW1A 5CUHA 2X3CA 4DD8A 1MNCA 3E8RA 1CIZA 1USNA 3G5CA 2E2DA 3LIRA 1XFWA 1JAOA 4PKSA 2X3AA 1OS9A 1XFZA 5L7FA 1R54A 4WKIA 3TT4A 1MMQA 1C3IA 1SRPA 3HBVP 2XS3A 456CA 2Y6CA 3L0VA 966CA 1GO7P 2X7MA 3LJTA 1JIWP 2K2GA 3GBOA 4H3XA 1QUAA 1JK3A 2ERQA 3HBUP 4A7BA 1Y93A 2MLSA 4G0DA 4L19A 1KUKA 5D3CA 3RTSA 1AF0A 3TSKA 3KRYA 3KEKA 1HFSA 3TVCA 1BQOA 1I76A 1OMJA 3G42A 3F17A 4L6TA 3WV2A 1GE5A 1D7XA 1GXDA 2W0DA 2V4BA 2Y6DA 3AIGA 3ZVSA 2WOAA 1G49A 1JAQA 2MZEA 4ON1A 3LGPA 3DPEA 5B5OA 3EDIA 1SLMA 2JIHA 4FXYP 1ZTQA 2CLTA 1XFXA 2OZRA 5I0LA 1UEAA 2I47A 1XFUA 1C7KA 4G9LA 3OHLA 4GWNA 1HOVA 4GF1A 2TCLA 4GR0A 3U1RA 1KUGA 5LABA 1OS2A 1KUFA 1CQRA 3DTKA 1CXVA 3RTTA 4A3WA 1CAQA 3F16A 3VTGA 1PWUA 4GR8A 1ROSA 2OW9A 3DTIA 2WO9A 2W15A 1CGEA 5B5PA 3TS4A 2ERPA 2D1OA 5L79A 1OO9A 1ZS0A 4AIGA 2RJQA 4AYKA 1DMTA 1GE7A 1ND1A 2J0TA 5D1UA 1BM6A 2DW2A 3KWVC 1EAKA 4JIJA 3B8ZA 2N8RA 3K7LA 1I1IP 4H76A 1FM1A 1Z3JA 3ELMA 3Q2HA 1WNIA 3KHIA 1OM6A 2XS4A 2L0RA 5I4OA 4H82A 2OW2A 1R55A 2MLRA 4PKRA 4ZR5A 3LJZA 1RMZA 4GQLA 1ASTA 3LE9A 3P1VA 3HDBA 3WV1A 3VI1A 2JT5A 3LILA 3NX7A 3HB2P 4FVLA 1R1IA 3CKIA 1RM8A 3N2UA 4H2EA 3LKAA 5D7WA 3EDHA 1ZVXA 2JSDA 3LUMA 1BKCE 2E3XA 2FV9A 4XCTA 1GKDA 2Z2DA 3LUNA 3EDZA 1GO8P 4IUWA 4AXQA 1GKCA 1EUBA 1Y8JA 3EHYA 1SU3A 2WO8A 1L6JA 5D1SA 1KUHA 2QPJA 5BOYA 2KRJA 1ZXVA 830CA 4L63A 1JAPA 1IAEA 2JT6A 2MZIA 1HV5A 3KECA 4WK7A 4XM8A 5BOTA 1PWWA 1G4KA 3KEJA 1QJJA 3DPFA 1K7QA 3DL1A 4CTHA 1XUDA 2OVXA 3F19A 1ATLA 4JPAA 1ZP5A 3BA0A 3KMCA 3O64A 4PKQA 3LK8A 2O36A 1K7IA 2O3EA 3HDAP 5JMYA 4H84A 3F1AA 1B3DA 2J83A 2JNPA 4JQGA 1DTHA 4GUYA 1CK7A 4I03A 3KMEA 4Q1LA 4DF9A 5I12A 1BUDA 1JANA 3O2XA 1MMBA 2OXUA 1OM7A 4H30A 1IADA 1KBCA 3HY7A 1MMRA 4HX3A 1YCMA 3OHOA 1XFYA 4XM7A 1QICA 2DDFA 5I2ZA 3MA2A 3EDGA 3EWJA 3LEAA 4PKVA 5I3MA 2YIGA 4R3VA 2W12A 2W13A 3F15A 1HY7A 3HYGA 3F18A 2USNA 1BIWA 1R1HA 1UMTA 3DTEA 1BKCA 3USNA 4GWMA 1SATA 1OM8A 1XFVA 1O0TA 4XM6A 1R1JA 1BKCI 1YOUA 1CGFA 1XURA 4PKUA 1JJ9A 1IACA 2D1NA 1UMSA 4DPEA 4L7AA 1HTDA 3K7NA 3UVCA 1KUIA 1QIBA 4JP4A 1JKYA 3I7GA 4DV8A 1D5JA 1QIAA 1A85A 4AUOA 4HMAA 2OXWA 1KAPP 3B2ZA 4WKEA 1GE6A 3LMCA 1FLSA 1MMPA 3Q2GA 1AYKA 1PWPA 5BPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXA A;  3B92 A;  4IN9 A;  3AYK A;  2OVZ A;  4XBH A;  4WF6 A;  4H1Q A;  1Y0V A;  1D8M A;  1Q3A A;  3WV3 A;  3LQB A;  1J7N A;  1I73 A;  2OY4 A;  2SRT A;  2HU6 A;  2AIG P;  2OW1 A;  2X3B A;  1PWV A;  3LJG A;  4ILW D;  1A86 A;  3LIK A;  3DSL A;  3SHI A;  1B8Y A;  2A8H A;  4PKW A;  2OI0 A;  4FU4 A;  1YP1 A;  1SLN A;  4WZV A;  4QKZ A;  1S4B P;  1HFC A;  3DNG A;  1UTT A;  1UTZ A;  4PKT A;  2RJP A;  2DDY A;  2CKI A;  1G05 A;  2ERO A;  4FXQ A;  1AKL A;  1SMP A;  4IJO A;  3I7I A;  3ZXH A;  4GR3 A;  2YB9 A;  1BZS A;  1IAA A;  5H8X A;  3ZUK A;  1XUC A;  1CGL A;  1QJI A;  2POJ A;  2FV5 A;  5CZM A;  1IAG A;  1BQQ M;  1K7G A;  1EB6 A;  3DWB A;  1ZXC A;  2K9C A;  2OXZ A;  1C8T A;  3L0T A;  1O0Q A;  1H71 P;  5D1T A;  5I43 A;  1BUV M;  3N2V A;  3LQ0 A;  1FBL A;  1PWQ A;  1YQY A;  2MZH A;  2AYK A;  2OW0 A;  3AYU A;  2DW0 A;  1G9K A;  1BSW A;  1D8F A;  2OY2 A;  3V96 B;  1JIZ A;  2W14 A;  1JH1 A;  3P24 A;  4JA1 A;  5D2B A;  3EHX A;  4H49 A;  3HY9 A;  4EFS A;  2PJT A;  1IAB A;  1G12 A;  4I35 A;  4J4M A;  2DW1 A;  5CUH A;  2X3C A;  4DD8 A;  1MNC A;  3E8R A;  1CIZ A;  1USN A;  3G5C A;  2E2D A;  3LIR A;  1XFW A;  1JAO A;  4PKS A;  2X3A A;  1OS9 A;  1XFZ A;  5L7F A;  1R54 A;  4WKI A;  3TT4 A;  1MMQ A;  1C3I A;  1SRP A;  3HBV P;  2XS3 A;  456C A;  2Y6C A;  3L0V A;  966C A;  1GO7 P;  2X7M A;  3LJT A;  1JIW P;  2K2G A;  3GBO A;  4H3X A;  1QUA A;  1JK3 A;  2ERQ A;  3HBU P;  4A7B A;  1Y93 A;  2MLS A;  4G0D A;  4L19 A;  1KUK A;  5D3C A;  3RTS A;  1AF0 A;  3TSK A;  3KRY A;  3KEK A;  1HFS A;  3TVC A;  1BQO A;  1I76 A;  1OMJ A;  3G42 A;  3F17 A;  4L6T A;  3WV2 A;  1GE5 A;  1D7X A;  1GXD A;  2W0D A;  2V4B A;  2Y6D A;  3AIG A;  3ZVS A;  2WOA A;  1G49 A;  1JAQ A;  2MZE A;  4ON1 A;  3LGP A;  3DPE A;  5B5O A;  3EDI A;  1SLM A;  2JIH A;  4FXY P;  1ZTQ A;  2CLT A;  1XFX A;  2OZR A;  5I0L A;  1UEA A;  2I47 A;  1XFU A;  1C7K A;  4G9L A;  3OHL A;  4GWN A;  1HOV A;  4GF1 A;  2TCL A;  4GR0 A;  3U1R A;  1KUG A;  5LAB A;  1OS2 A;  1KUF A;  1CQR A;  1CXV A;  3RTT A;  4A3W A;  1CAQ A;  3F16 A;  3VTG A;  1PWU A;  4GR8 A;  1ROS A;  2OW9 A;  2WO9 A;  2W15 A;  1CGE A;  5B5P A;  3TS4 A;  2ERP A;  2D1O A;  5L79 A;  1OO9 A;  1ZS0 A;  4AIG A;  2RJQ A;  4AYK A;  1DMT A;  1GE7 A;  1ND1 A;  2J0T A;  5D1U A;  1BM6 A;  2DW2 A;  3KWV C;  1EAK A;  4JIJ A;  3B8Z A;  2N8R A;  3K7L A;  1I1I P;  4H76 A;  1FM1 A;  1Z3J A;  3ELM A;  3Q2H A;  1WNI A;  3KHI A;  1OM6 A;  2XS4 A;  2L0R A;  5I4O A;  4H82 A;  2OW2 A;  1R55 A;  2MLR A;  4PKR A;  4ZR5 A;  3LJZ A;  1RMZ A;  4GQL A;  1AST A;  3LE9 A;  3P1V A;  3HDB A;  3WV1 A;  3VI1 A;  2JT5 A;  3LIL A;  3NX7 A;  3HB2 P;  4FVL A;  1R1I A;  3CKI A;  1RM8 A;  3N2U A;  4H2E A;  3LKA A;  5D7W A;  3EDH A;  1ZVX A;  2JSD A;  3LUM A;  1BKC E;  2E3X A;  2FV9 A;  4XCT A;  1GKD A;  2Z2D A;  3LUN A;  3EDZ A;  1GO8 P;  4IUW A;  4AXQ A;  1GKC A;  1EUB A;  1Y8J A;  3EHY A;  1SU3 A;  2WO8 A;  1L6J A;  5D1S A;  1KUH A;  2QPJ A;  5BOY A;  2KRJ A;  1ZXV A;  830C A;  4L63 A;  1JAP A;  1IAE A;  2JT6 A;  2MZI A;  1HV5 A;  3KEC A;  4WK7 A;  4XM8 A;  5BOT A;  1PWW A;  1G4K A;  3KEJ A;  1QJJ A;  3DPF A;  1K7Q A;  3DL1 A;  4CTH A;  1XUD A;  2OVX A;  3F19 A;  1ATL A;  4JPA A;  1ZP5 A;  3BA0 A;  3KMC A;  3O64 A;  4PKQ A;  3LK8 A;  2O36 A;  1K7I A;  2O3E A;  3HDA P;  5JMY A;  4H84 A;  3F1A A;  1B3D A;  2J83 A;  2JNP A;  4JQG A;  1DTH A;  4GUY A;  1CK7 A;  4I03 A;  3KME A;  4Q1L A;  4DF9 A;  5I12 A;  1BUD A;  1JAN A;  3O2X A;  1MMB A;  2OXU A;  1OM7 A;  4H30 A;  1IAD A;  1KBC A;  3HY7 A;  1MMR A;  4HX3 A;  1YCM A;  3OHO A;  1XFY A;  4XM7 A;  1QIC A;  2DDF A;  5I2Z A;  3MA2 A;  3EDG A;  3EWJ A;  3LEA A;  4PKV A;  5I3M A;  2YIG A;  4R3V A;  2W12 A;  2W13 A;  3F15 A;  1HY7 A;  3HYG A;  3F18 A;  2USN A;  1BIW A;  1R1H A;  1UMT A;  1BKC A;  3USN A;  4GWM A;  1SAT A;  1OM8 A;  1XFV A;  1O0T A;  4XM6 A;  1R1J A;  1BKC I;  1YOU A;  1CGF A;  1XUR A;  4PKU A;  1JJ9 A;  1IAC A;  2D1N A;  1UMS A;  4DPE A;  1HTD A;  3K7N A;  3UVC A;  1KUI A;  1QIB A;  4JP4 A;  1JKY A;  3I7G A;  4DV8 A;  1D5J A;  1QIA A;  1A85 A;  4AUO A;  4HMA A;  2OXW A;  1KAP P;  3B2Z A;  4WKE A;  1GE6 A;  3LMC A;  1FLS A;  1MMP A;  3Q2G A;  1AYK A;  1PWP A;  5BPA A; 
#chains in the Genus database with same CATH topology
 5CXA A;  3B92 A;  4IN9 A;  3AYK A;  2YUF A;  2OVZ A;  4XBH A;  4WF6 A;  4H1Q A;  1Y0V A;  1D8M A;  1Q3A A;  3WV3 A;  3LQB A;  1J7N A;  1I73 A;  2OY4 A;  2SRT A;  2HU6 A;  2AIG P;  2OW1 A;  2X3B A;  1PWV A;  3LJG A;  4ILW D;  1A86 A;  3LIK A;  3DSL A;  3SHI A;  1B8Y A;  2A8H A;  4PKW A;  2OI0 A;  4FU4 A;  1YP1 A;  1SLN A;  4WZV A;  4QKZ A;  1S4B P;  1HFC A;  3DNG A;  1UTT A;  1UTZ A;  4PKT A;  2RJP A;  2DDY A;  2CKI A;  1G05 A;  2ERO A;  4FXQ A;  1AKL A;  1SMP A;  4IJO A;  3I7I A;  3ZXH A;  4GR3 A;  2YB9 A;  1BZS A;  1IAA A;  5H8X A;  3ZUK A;  1XUC A;  1CGL A;  1QJI A;  2POJ A;  2FV5 A;  5CZM A;  1IAG A;  1BQQ M;  1K7G A;  1EB6 A;  3DWB A;  1ZXC A;  2K9C A;  2OXZ A;  1C8T A;  3L0T A;  1O0Q A;  1H71 P;  5D1T A;  5I43 A;  1BUV M;  3N2V A;  3LQ0 A;  1FBL A;  1PWQ A;  1YQY A;  2MZH A;  2AYK A;  2OW0 A;  3AYU A;  2DW0 A;  1G9K A;  1BSW A;  1D8F A;  2OY2 A;  3V96 B;  1JIZ A;  2W14 A;  1JH1 A;  3P24 A;  4JA1 A;  5D2B A;  3EHX A;  4H49 A;  3HY9 A;  4EFS A;  2PJT A;  1IAB A;  1G12 A;  4I35 A;  4J4M A;  2DW1 A;  5CUH A;  2X3C A;  4DD8 A;  1MNC A;  3E8R A;  1CIZ A;  1USN A;  3G5C A;  2E2D A;  3LIR A;  1XFW A;  1JAO A;  4PKS A;  2X3A A;  1OS9 A;  1XFZ A;  5L7F A;  1R54 A;  4WKI A;  3TT4 A;  1MMQ A;  1C3I A;  1SRP A;  3HBV P;  2XS3 A;  456C A;  2Y6C A;  3L0V A;  966C A;  1GO7 P;  2X7M A;  3LJT A;  1JIW P;  2K2G A;  3GBO A;  4H3X A;  1QUA A;  1JK3 A;  2ERQ A;  3HBU P;  4A7B A;  1Y93 A;  2MLS A;  4G0D A;  4L19 A;  1KUK A;  5D3C A;  3RTS A;  1AF0 A;  3TSK A;  3KRY A;  3KEK A;  1HFS A;  3TVC A;  1BQO A;  1I76 A;  1OMJ A;  3G42 A;  3F17 A;  4L6T A;  3WV2 A;  1GE5 A;  1D7X A;  1GXD A;  2W0D A;  2V4B A;  2Y6D A;  3AIG A;  3ZVS A;  2WOA A;  1G49 A;  1JAQ A;  2MZE A;  4ON1 A;  3LGP A;  3DPE A;  5B5O A;  3EDI A;  1SLM A;  2JIH A;  4FXY P;  1ZTQ A;  2CLT A;  1XFX A;  2OZR A;  5I0L A;  1UEA A;  2I47 A;  1XFU A;  1C7K A;  4G9L A;  3OHL A;  4GWN A;  1HOV A;  4GF1 A;  2TCL A;  4GR0 A;  3U1R A;  1KUG A;  5LAB A;  1OS2 A;  1KUF A;  1CQR A;  3DTK A;  1CXV A;  3RTT A;  4A3W A;  1CAQ A;  3F16 A;  3VTG A;  1PWU A;  4GR8 A;  1ROS A;  2OW9 A;  3DTI A;  2WO9 A;  2W15 A;  1CGE A;  5B5P A;  3TS4 A;  2ERP A;  2D1O A;  5L79 A;  1OO9 A;  1ZS0 A;  4AIG A;  2RJQ A;  4AYK A;  1DMT A;  1GE7 A;  1ND1 A;  2J0T A;  5D1U A;  1BM6 A;  2DW2 A;  3KWV C;  1EAK A;  4JIJ A;  3B8Z A;  2N8R A;  3K7L A;  1I1I P;  4H76 A;  1FM1 A;  1Z3J A;  3ELM A;  3Q2H A;  1WNI A;  3KHI A;  1OM6 A;  2XS4 A;  2L0R A;  5I4O A;  4H82 A;  2OW2 A;  1R55 A;  2MLR A;  4PKR A;  4ZR5 A;  3LJZ A;  1RMZ A;  4GQL A;  1AST A;  3LE9 A;  3P1V A;  3HDB A;  3WV1 A;  3VI1 A;  1OZ9 A;  2JT5 A;  3LIL A;  3NX7 A;  3HB2 P;  4FVL A;  1R1I A;  3CKI A;  1RM8 A;  3N2U A;  4H2E A;  3LKA A;  5D7W A;  3EDH A;  1ZVX A;  2JSD A;  3LUM A;  1BKC E;  2E3X A;  2FV9 A;  4XCT A;  1GKD A;  2Z2D A;  3LUN A;  3EDZ A;  1GO8 P;  4IUW A;  4AXQ A;  1GKC A;  1EUB A;  1Y8J A;  3EHY A;  1SU3 A;  2WO8 A;  1L6J A;  5D1S A;  1KUH A;  2QPJ A;  5BOY A;  2KRJ A;  1ZXV A;  830C A;  4L63 A;  1JAP A;  1IAE A;  2JT6 A;  2MZI A;  1HV5 A;  3KEC A;  4WK7 A;  4XM8 A;  5BOT A;  1PWW A;  1G4K A;  3KEJ A;  1QJJ A;  3DPF A;  1K7Q A;  3DL1 A;  4CTH A;  1XUD A;  2OVX A;  3F19 A;  1ATL A;  4JPA A;  1ZP5 A;  3BA0 A;  3KMC A;  3O64 A;  4PKQ A;  3LK8 A;  2O36 A;  1K7I A;  2O3E A;  3HDA P;  5JMY A;  4H84 A;  3F1A A;  1B3D A;  2J83 A;  2JNP A;  4JQG A;  1DTH A;  4GUY A;  1CK7 A;  4I03 A;  3KME A;  4Q1L A;  4DF9 A;  5I12 A;  1BUD A;  1JAN A;  3O2X A;  1MMB A;  2OXU A;  1OM7 A;  4H30 A;  1IAD A;  1KBC A;  3HY7 A;  1MMR A;  4HX3 A;  1XAX A;  1YCM A;  1TVI A;  3OHO A;  1XFY A;  4XM7 A;  1QIC A;  2DDF A;  5I2Z A;  3MA2 A;  3EDG A;  3EWJ A;  3LEA A;  4PKV A;  5I3M A;  2YIG A;  4R3V A;  2W12 A;  2W13 A;  3F15 A;  1HY7 A;  3HYG A;  3F18 A;  2USN A;  1BIW A;  1R1H A;  1UMT A;  1XM5 A;  3DTE A;  1BKC A;  3USN A;  4GWM A;  1SAT A;  1OM8 A;  1XFV A;  1O0T A;  4XM6 A;  1R1J A;  1BKC I;  1YOU A;  1CGF A;  1XUR A;  4PKU A;  1JJ9 A;  1IAC A;  2D1N A;  1UMS A;  4DPE A;  4L7A A;  1HTD A;  3K7N A;  3UVC A;  1KUI A;  1QIB A;  4JP4 A;  1JKY A;  3I7G A;  4DV8 A;  1D5J A;  1QIA A;  1A85 A;  4AUO A;  4HMA A;  2OXW A;  1KAP P;  3B2Z A;  4WKE A;  1GE6 A;  3LMC A;  1FLS A;  1MMP A;  3Q2G A;  1AYK A;  1PWP A;  5BPA A; 
#chains in the Genus database with same CATH homology
 5CXA A;  3B92 A;  4IN9 A;  3AYK A;  2YUF A;  2OVZ A;  4XBH A;  4WF6 A;  4H1Q A;  1Y0V A;  1D8M A;  1Q3A A;  3WV3 A;  3LQB A;  1J7N A;  1I73 A;  2OY4 A;  2SRT A;  2HU6 A;  2AIG P;  2OW1 A;  2X3B A;  1PWV A;  3LJG A;  4ILW D;  1A86 A;  3LIK A;  3DSL A;  3SHI A;  1B8Y A;  2A8H A;  4PKW A;  2OI0 A;  4FU4 A;  1YP1 A;  1SLN A;  4WZV A;  4QKZ A;  1S4B P;  1HFC A;  3DNG A;  1UTT A;  1UTZ A;  4PKT A;  2RJP A;  2DDY A;  2CKI A;  1G05 A;  2ERO A;  4FXQ A;  1AKL A;  1SMP A;  4IJO A;  3I7I A;  3ZXH A;  4GR3 A;  2YB9 A;  1BZS A;  1IAA A;  5H8X A;  3ZUK A;  1XUC A;  1CGL A;  1QJI A;  2POJ A;  2FV5 A;  5CZM A;  1IAG A;  1BQQ M;  1K7G A;  1EB6 A;  3DWB A;  1ZXC A;  2K9C A;  2OXZ A;  1C8T A;  3L0T A;  1O0Q A;  1H71 P;  5D1T A;  5I43 A;  1BUV M;  3N2V A;  3LQ0 A;  1FBL A;  1PWQ A;  1YQY A;  2MZH A;  2AYK A;  2OW0 A;  3AYU A;  2DW0 A;  1G9K A;  1BSW A;  1D8F A;  2OY2 A;  3V96 B;  1JIZ A;  2W14 A;  1JH1 A;  3P24 A;  4JA1 A;  5D2B A;  3EHX A;  4H49 A;  3HY9 A;  4EFS A;  2PJT A;  1IAB A;  1G12 A;  4I35 A;  4J4M A;  2DW1 A;  5CUH A;  2X3C A;  4DD8 A;  1MNC A;  3E8R A;  1CIZ A;  1USN A;  3G5C A;  2E2D A;  3LIR A;  1XFW A;  1JAO A;  4PKS A;  2X3A A;  1OS9 A;  1XFZ A;  5L7F A;  1R54 A;  4WKI A;  3TT4 A;  1MMQ A;  1C3I A;  1SRP A;  3HBV P;  2XS3 A;  456C A;  2Y6C A;  3L0V A;  966C A;  1GO7 P;  2X7M A;  3LJT A;  1JIW P;  2K2G A;  3GBO A;  4H3X A;  1QUA A;  1JK3 A;  2ERQ A;  3HBU P;  4A7B A;  1Y93 A;  2MLS A;  4G0D A;  4L19 A;  1KUK A;  5D3C A;  3RTS A;  1AF0 A;  3TSK A;  3KRY A;  3KEK A;  1HFS A;  3TVC A;  1BQO A;  1I76 A;  1OMJ A;  3G42 A;  3F17 A;  4L6T A;  3WV2 A;  1GE5 A;  1D7X A;  1GXD A;  2W0D A;  2V4B A;  2Y6D A;  3AIG A;  3ZVS A;  2WOA A;  1G49 A;  1JAQ A;  2MZE A;  4ON1 A;  3LGP A;  3DPE A;  5B5O A;  3EDI A;  1SLM A;  2JIH A;  4FXY P;  1ZTQ A;  2CLT A;  1XFX A;  2OZR A;  5I0L A;  1UEA A;  2I47 A;  1XFU A;  1C7K A;  4G9L A;  3OHL A;  4GWN A;  1HOV A;  4GF1 A;  2TCL A;  4GR0 A;  3U1R A;  1KUG A;  5LAB A;  1OS2 A;  1KUF A;  1CQR A;  3DTK A;  1CXV A;  3RTT A;  4A3W A;  1CAQ A;  3F16 A;  3VTG A;  1PWU A;  4GR8 A;  1ROS A;  2OW9 A;  3DTI A;  2WO9 A;  2W15 A;  1CGE A;  5B5P A;  3TS4 A;  2ERP A;  2D1O A;  5L79 A;  1OO9 A;  1ZS0 A;  4AIG A;  2RJQ A;  4AYK A;  1DMT A;  1GE7 A;  1ND1 A;  2J0T A;  5D1U A;  1BM6 A;  2DW2 A;  3KWV C;  1EAK A;  4JIJ A;  3B8Z A;  2N8R A;  3K7L A;  1I1I P;  4H76 A;  1FM1 A;  1Z3J A;  3ELM A;  3Q2H A;  1WNI A;  3KHI A;  1OM6 A;  2XS4 A;  2L0R A;  5I4O A;  4H82 A;  2OW2 A;  1R55 A;  2MLR A;  4PKR A;  4ZR5 A;  3LJZ A;  1RMZ A;  4GQL A;  1AST A;  3LE9 A;  3P1V A;  3HDB A;  3WV1 A;  3VI1 A;  2JT5 A;  3LIL A;  3NX7 A;  3HB2 P;  4FVL A;  1R1I A;  3CKI A;  1RM8 A;  3N2U A;  4H2E A;  3LKA A;  5D7W A;  3EDH A;  1ZVX A;  2JSD A;  3LUM A;  1BKC E;  2E3X A;  2FV9 A;  4XCT A;  1GKD A;  2Z2D A;  3LUN A;  3EDZ A;  1GO8 P;  4IUW A;  4AXQ A;  1GKC A;  1EUB A;  1Y8J A;  3EHY A;  1SU3 A;  2WO8 A;  1L6J A;  5D1S A;  1KUH A;  2QPJ A;  5BOY A;  2KRJ A;  1ZXV A;  830C A;  4L63 A;  1JAP A;  1IAE A;  2JT6 A;  2MZI A;  1HV5 A;  3KEC A;  4WK7 A;  4XM8 A;  5BOT A;  1PWW A;  1G4K A;  3KEJ A;  1QJJ A;  3DPF A;  1K7Q A;  3DL1 A;  4CTH A;  1XUD A;  2OVX A;  3F19 A;  1ATL A;  4JPA A;  1ZP5 A;  3BA0 A;  3KMC A;  3O64 A;  4PKQ A;  3LK8 A;  2O36 A;  1K7I A;  2O3E A;  3HDA P;  5JMY A;  4H84 A;  3F1A A;  1B3D A;  2J83 A;  2JNP A;  4JQG A;  1DTH A;  4GUY A;  1CK7 A;  4I03 A;  3KME A;  4Q1L A;  4DF9 A;  5I12 A;  1BUD A;  1JAN A;  3O2X A;  1MMB A;  2OXU A;  1OM7 A;  4H30 A;  1IAD A;  1KBC A;  3HY7 A;  1MMR A;  4HX3 A;  1YCM A;  3OHO A;  1XFY A;  4XM7 A;  1QIC A;  2DDF A;  5I2Z A;  3MA2 A;  3EDG A;  3EWJ A;  3LEA A;  4PKV A;  5I3M A;  2YIG A;  4R3V A;  2W12 A;  2W13 A;  3F15 A;  1HY7 A;  3HYG A;  3F18 A;  2USN A;  1BIW A;  1R1H A;  1UMT A;  3DTE A;  1BKC A;  3USN A;  4GWM A;  1SAT A;  1OM8 A;  1XFV A;  1O0T A;  4XM6 A;  1R1J A;  1BKC I;  1YOU A;  1CGF A;  1XUR A;  4PKU A;  1JJ9 A;  1IAC A;  2D1N A;  1UMS A;  4DPE A;  4L7A A;  1HTD A;  3K7N A;  3UVC A;  1KUI A;  1QIB A;  4JP4 A;  1JKY A;  3I7G A;  4DV8 A;  1D5J A;  1QIA A;  1A85 A;  4AUO A;  4HMA A;  2OXW A;  1KAP P;  3B2Z A;  4WKE A;  1GE6 A;  3LMC A;  1FLS A;  1MMP A;  3Q2G A;  1AYK A;  1PWP A;  5BPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...